Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.76.14ON66448224090.0
YEL060C (PRB1)6.14ON63548022440.0
Skud_5.296.14ON60848022370.0
Smik_5.276.14ON60847722290.0
SAKL0E01012g6.14ON54448817340.0
TDEL0G045506.14ON56448616920.0
Kwal_56.223876.14ON54348616190.0
KLTH0C11396g6.14ON55049516180.0
TBLA0A073006.14ON57347815940.0
NCAS0F002206.14ON69543216020.0
KLLA0D00979g6.14ON56148415860.0
NDAI0K028806.14ON70449215840.0
ZYRO0C07942g6.14ON54848215130.0
ACR012C6.14ON54150915030.0
CAGL0B03619g6.14ON46847214930.0
Kpol_1032.56.14ON68048014780.0
KNAG0E009206.14ON53145613960.0
KAFR0L003606.14ON50243713770.0
Ecym_30186.14ON57547513800.0
Kpol_1045.756.14ON47748013490.0
Suva_15.1786.14ON47641512731e-169
TPHA0M002306.14ON58545512671e-167
Smik_15.1726.14ON47841812561e-167
Skud_15.1646.14ON48241812451e-165
YOR003W (YSP3)6.14ON47841812381e-164
CAGL0E02651g6.14ON48541610501e-136
KAFR0B065506.14ON4564189841e-126
NCAS0D026306.14ON4514219061e-115
NDAI0I022806.14ON4824318161e-101
KNAG0F02970singletonON4203527932e-98
CAGL0L13266gsingletonON5794387732e-93
ZYRO0D08822g6.313ON4903904621e-49
NCAS0D043906.313ON4923934612e-49
Suva_3.846.313ON5274424571e-48
Smik_3.1496.313ON4913234504e-48
Kpol_1028.616.313ON5183214481e-47
SAKL0A02002g6.313ON4793864434e-47
YCR045C (RRT12)6.313ON4913934417e-47
TDEL0A072806.313ON4363734361e-46
Skud_3.1246.313ON5403234412e-46
KNAG0I024706.313ON4753964267e-45
Kpol_1018.56.313ON4653204213e-44
KAFR0J024506.313ON4783594196e-44
TBLA0F039706.313ON7343354297e-44
CAGL0L10802g6.313ON5173404172e-43
KLTH0A06094g6.313ON4963164111e-42
NDAI0I005606.313ON4833954092e-42
Ecym_21056.313ON6103224124e-42
TPHA0D037606.313ON6073193992e-40
AAR069W6.313ON7683253998e-40
Kwal_23.61836.313ON4933263757e-38
KLLA0F06028g6.313ON5083213741e-37
Kwal_33.133721.78ON3773103211e-31
Kpol_2000.691.78ON3863122991e-28
TBLA0A067006.313ON4972583032e-28
KLTH0F02288g1.78ON3803162955e-28
ZYRO0F16764g1.78ON3863262663e-24
TPHA0B045201.78ON3883562353e-20
TDEL0C062301.78ON3643342165e-18
TBLA0A054101.78ON3822801972e-15
NCAS0A008802.6ON83366790.62
SAKL0G00440g2.6ON83663790.81
Skud_7.10na 1ON56670780.93
ZYRO0F15598g2.6ON79063780.96
NDAI0E016308.608ON456115771.1
Skud_14.1012.6ON81967771.4
YNL238W (KEX2)2.6ON81464733.6
TBLA0B001302.6ON84259733.6
CAGL0J07546g2.6ON78961734.0
Suva_14.1062.6ON80964734.1
Ecym_32574.261ON127461725.0
KAFR0A080402.6ON76663716.5
Kwal_56.233206.80ON60438708.7
Smik_14.972.6ON81464708.7
KNAG0A041808.463ON85659699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.7
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   932   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   868   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   866   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   863   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   672   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   656   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   628   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   627   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   618   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   621   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   615   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   614   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   587   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   583   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   579   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   573   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   542   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   535   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   536   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   524   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   494   e-169
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   492   e-167
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   488   e-167
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   484   e-165
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   481   e-164
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   409   e-136
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   383   e-126
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     353   e-115
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   318   e-101
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              310   2e-98
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   302   2e-93
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   182   1e-49
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   182   2e-49
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   180   1e-48
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   177   4e-48
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   177   1e-47
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   175   4e-47
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   174   7e-47
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   172   1e-46
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   174   2e-46
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   168   7e-45
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   166   3e-44
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   166   6e-44
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   169   7e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   165   2e-43
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   162   1e-42
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    162   2e-42
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   163   4e-42
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   158   2e-40
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   158   8e-40
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   149   7e-38
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   148   1e-37
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   128   1e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   119   1e-28
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   121   2e-28
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   118   5e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   107   3e-24
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    95   3e-20
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    88   5e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    80   2e-15
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.62 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.81 
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    35   0.93 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.96 
NDAI0E01630 Chr5 complement(324500..325870) [1371 bp, 456 aa] {O...    34   1.1  
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    34   1.4  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   3.6  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   3.6  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    33   4.0  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    33   4.1  
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    32   5.0  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   6.5  
Kwal_56.23320 s56 complement(491440..493254) [1815 bp, 604 aa] {...    32   8.7  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   8.7  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    31   9.8  

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/482 (94%), Positives = 456/482 (94%)

Query: 183 DHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENL 242
           DHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENL
Sbjct: 183 DHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENL 242

Query: 243 AAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKD 302
           AAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKD
Sbjct: 243 AAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKD 302

Query: 303 SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362
           SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD
Sbjct: 303 SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362

Query: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 422
           FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGTMSD
Sbjct: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSD 422

Query: 423 VLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 482
           VLKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN
Sbjct: 423 VLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 482

Query: 483 ENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT 542
           ENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT
Sbjct: 483 ENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT 542

Query: 543 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD 602
           LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD
Sbjct: 543 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD 602

Query: 603 DTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLN 662
           DTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLN
Sbjct: 603 DTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLN 662

Query: 663 II 664
           II
Sbjct: 663 II 664

 Score =  160 bits (404), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 76/93 (81%), Positives = 76/93 (81%)

Query: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP 60
          MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP
Sbjct: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP 60

Query: 61 PHKKGXXXXXXXXXXXXXXXXXHARKHRKGEHM 93
          PHKKG                 HARKHRKGEHM
Sbjct: 61 PHKKGRKERKDVESKDKDDEDRHARKHRKGEHM 93

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/480 (87%), Positives = 441/480 (91%), Gaps = 1/480 (0%)

Query: 185 HRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAA 244
           H  +LAPLVST QFNPDAI+KIIPNRYIIVFK+  P EE  FH+E VQQAQLQSVENL+A
Sbjct: 157 HHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSA 216

Query: 245 EDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSV 304
           EDAFFIST+D +LS+SEAGGIQDSFNID+LFSGYIGYFTQEIVDLIRQNPLVDFVE+DS+
Sbjct: 217 EDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSI 276

Query: 305 VEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFE 364
           VEAT+FDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN+NHKDFE
Sbjct: 277 VEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFE 336

Query: 365 KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVL 424
           KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGTMSDV+
Sbjct: 337 KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVV 396

Query: 425 KGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN 484
           KGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVE GIHFAVAAGNEN
Sbjct: 397 KGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNEN 456

Query: 485 QDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLS 544
           QDACNTSPASADKAITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD+ATATLS
Sbjct: 457 QDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLS 516

Query: 545 GTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDT 604
           GTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLKKKLIHYSTKDILFDIP+DT
Sbjct: 517 GTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDT 576

Query: 605 PNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
           PN LIYNGGGQDLSAFWNDTKKSH SSGFKQELN+DEFIGSKTDLIF+QVRD+LDKLNII
Sbjct: 577 PNVLIYNGGGQDLSAFWNDTKKSH-SSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/55 (70%), Positives = 46/55 (83%)

Query: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDR 55
          MKL+NTLFTLGALG ISAALVIPNLE+ ADH EL+ KEDHH+ P+  EF +D+D 
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTKDDDE 55

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/480 (87%), Positives = 439/480 (91%), Gaps = 1/480 (0%)

Query: 185 HRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAA 244
           H  KLAPLVST QF+P A+ KIIPNRYIIVFKK VP E   FH+E+V QAQLQSVENL+A
Sbjct: 130 HNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSA 189

Query: 245 EDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSV 304
           EDAFFISTRD++LS+SE GGIQDSFNID++FSGYIGYFTQEI+DLIRQNPLVDFVE+DSV
Sbjct: 190 EDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSV 249

Query: 305 VEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFE 364
           VEATDFDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFE
Sbjct: 250 VEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFE 309

Query: 365 KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVL 424
           KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGTMSDV+
Sbjct: 310 KRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVV 369

Query: 425 KGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN 484
           KGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN
Sbjct: 370 KGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN 429

Query: 485 QDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLS 544
           QDACNTSPASADKAITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATATLS
Sbjct: 430 QDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLS 489

Query: 545 GTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDT 604
           GTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLK KLIHYSTKDILFD+P+DT
Sbjct: 490 GTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDT 549

Query: 605 PNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
           PNALIYNGGGQDLSAFWNDTKKSHSS  FKQELN+DEFIGSKTDLIFEQVRDVLDKLNII
Sbjct: 550 PNALIYNGGGQDLSAFWNDTKKSHSSR-FKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 42/65 (64%)

Query: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP 60
          MKL+NTL TLGALG ISAALVIPNLE  ADH EL+ +++H +   HA     +     + 
Sbjct: 1  MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGGSSHESAKE 60

Query: 61 PHKKG 65
           H+ G
Sbjct: 61 SHEDG 65

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/477 (87%), Positives = 437/477 (91%), Gaps = 1/477 (0%)

Query: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           KLAPLVST QFNPDAI+KIIPNRYI+VFKK VP EE  FH+E+V QAQLQSVENL+AEDA
Sbjct: 133 KLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDA 192

Query: 248 FFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEA 307
           FF STRD  LS+SEAGGIQDSFNID++FSGYIGYFTQEI+DLIRQNPLVDFVE+DSVVEA
Sbjct: 193 FFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEA 252

Query: 308 TDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 367
           T+FDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN+NHKDFEKRA
Sbjct: 253 TEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRA 312

Query: 368 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGV 427
           IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGTMSDV+KGV
Sbjct: 313 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGV 372

Query: 428 EYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 487
           EY              GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA
Sbjct: 373 EYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 432

Query: 488 CNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTS 547
           CNTSPASADKAITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSDEATATLSGTS
Sbjct: 433 CNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTS 492

Query: 548 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNA 607
           MASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLKKKLIHYSTKDILFDIP+DTPN 
Sbjct: 493 MASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNF 552

Query: 608 LIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
           LIYNGGGQDLSAFWNDTKKSH  SG K ELN+DEFIGSKTDL+FEQVRDVLDKLNII
Sbjct: 553 LIYNGGGQDLSAFWNDTKKSH-PSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLNII 608

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEF 49
          MKL+NTLFTLGALG ISAALVIPNLE+ AD+ EL+ K+   +   + +F
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKF 49

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/488 (68%), Positives = 386/488 (79%), Gaps = 18/488 (3%)

Query: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           KLAPLVS+ Q  P     IIP+RYIIVFKKD  PEE +FH+E + +A  +SV  L ++D+
Sbjct: 64  KLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDS 118

Query: 248 FFISTRDAA-----LSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKD 302
           FF +T+ +A      + S  GGIQ+SF+I ++ +GYIGYFT E+VD IR N  V+F+EKD
Sbjct: 119 FFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKD 178

Query: 303 SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362
           S+V A++FDTQN APWGL+R+SHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG+NVNHKD
Sbjct: 179 SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKD 238

Query: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 422
           F  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYG            LRSNGSGTMSD
Sbjct: 239 FNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSD 298

Query: 423 VLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 482
           V+KGVE+              GFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGN
Sbjct: 299 VVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358

Query: 483 ENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT 542
           ENQDACNTSPA+A+ AITVGASTLSDDRAYFSN+GKCVD+FAPGLN+LSTYIGS+ ATAT
Sbjct: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATAT 418

Query: 543 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD 602
           LSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD+L+++P+
Sbjct: 419 LSGTSMASPHVAGLLTYFLSLQPDSDSEFFQAS--GITPAQLKKKLIAYSTKDVLYELPE 476

Query: 603 DTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQ---ELNLDEFIGS---KTDLIFEQVRD 656
           DTPN LIYNGGGQDLS FW  +++     G  Q   +  L E I S   KTDL+FE+VR 
Sbjct: 477 DTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRS 536

Query: 657 VLDKLNII 664
           V DKLNII
Sbjct: 537 VFDKLNII 544

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/486 (67%), Positives = 382/486 (78%), Gaps = 17/486 (3%)

Query: 185 HRG---KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241
           HRG   K+   V+     P+A     P+RYI+V K    PEE A H E + Q+QLQSV  
Sbjct: 90  HRGIVHKMGEGVAPLSIPPNAF----PHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGE 144

Query: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301
           LA +D FF     +A      GGIQDSF++  L +GY+GYFT  +V+LIR++P+VDFVE 
Sbjct: 145 LAQDDPFF-----SAQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEM 199

Query: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361
           DS V A++FDTQN APWGL+R+SHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+NV H+
Sbjct: 200 DSPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQ 259

Query: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 421
           DFE RA WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MS
Sbjct: 260 DFEGRAHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMS 319

Query: 422 DVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481
           DV+KGVE+              GFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAG
Sbjct: 320 DVIKGVEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAG 379

Query: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA 541
           NENQDACNTSPA+A++A+TVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIGSD+ATA
Sbjct: 380 NENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATA 439

Query: 542 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIP 601
           TLSGTSMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+P
Sbjct: 440 TLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLP 499

Query: 602 DDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEF---IGSKTDLIFEQVRDVL 658
           +DTPNALIYNGGG  L  FW+   K  +++ F Q+ +L E    +G+KTD +F+QVRDVL
Sbjct: 500 EDTPNALIYNGGGHGLKGFWDGHDKQEANTRF-QDTDLQELSDNLGAKTDALFDQVRDVL 558

Query: 659 DKLNII 664
           D+LNII
Sbjct: 559 DRLNII 564

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/486 (64%), Positives = 371/486 (76%), Gaps = 19/486 (3%)

Query: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248
           L+PLV+        +   IP+RYI+VFK  V PEE  FH E V +A  QSV  L A DAF
Sbjct: 67  LSPLVTARN-----MYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121

Query: 249 FISTRD---AALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVV 305
           F +T D     +++S  GGI DSF+++ +  GYIGYFTQEIVD IR NPLV FVE+DS+V
Sbjct: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181

Query: 306 EATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 365
            A +FDTQN APWGL+R+SHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+N++HKDFE 
Sbjct: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241

Query: 366 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLK 425
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+K
Sbjct: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVK 301

Query: 426 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 485
           GVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361

Query: 486 DACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSG 545
           DACN+SPA+A+ AITVGASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421

Query: 546 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTP 605
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+P+DT 
Sbjct: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 606 NALIYNGGGQDLSAFW-NDTK------KSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVL 658
           N LIYNGGGQDL  FW  D +      K +++S F+  ++  E    KTD ++E++R++ 
Sbjct: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537

Query: 659 DKLNII 664
           + LNII
Sbjct: 538 EGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/495 (64%), Positives = 372/495 (75%), Gaps = 27/495 (5%)

Query: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           +L+PLVS+           IP+RYI+VFK+++ PEE  FH++ V +A LQSV  L +   
Sbjct: 65  ELSPLVSSS-----GKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHE 119

Query: 248 FFIST------RDAAL-------SSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNP 294
           FF ST      RD  L       + +  GGIQDSF++  L +GYIGYFT EIVD IR NP
Sbjct: 120 FFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNP 179

Query: 295 LVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDT 354
           LVDFVE+DSVV A +F TQN APWGL+R+SHRE+LNLGSFNKYLYDDDAG+GVTSYVIDT
Sbjct: 180 LVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDT 239

Query: 355 GVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 414
           GVNV+HKDFE RA WGKTIP ND D DGNGHGTHCAGTIASKHYG            LRS
Sbjct: 240 GVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRS 299

Query: 415 NGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 474
           NGSG+MSDV+KGVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+AGI
Sbjct: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359

Query: 475 HFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYI 534
           HFAVAAGNENQDACN+SPASA+ A+TVGASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYI
Sbjct: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 419

Query: 535 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTK 594
           GSD ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK
Sbjct: 420 GSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAA-GGITPSQLKKKLIAYSTK 478

Query: 595 DILFDIPDDTPNALIYNGGGQDLSAFWN-----DTKKSHSSSGFKQELNLDEFIGSKTDL 649
           ++L DIPDDT N LI+NGGG+ L  FW      D  +   SS  +  ++  E    KTD+
Sbjct: 479 NVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE---EKTDV 535

Query: 650 IFEQVRDVLDKLNII 664
           ++E++R+V D +NII
Sbjct: 536 LYEEIREVFDHMNII 550

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/478 (65%), Positives = 360/478 (75%), Gaps = 17/478 (3%)

Query: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248
           +APL S +  +P     IIP+RYII FKKDV PEE  FH++++ + Q QS+  L  +  +
Sbjct: 111 IAPLYS-QSLHPQ---NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166

Query: 249 FISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEAT 308
           F S     L       I DSFNI+SL  GYIGYFT +++D IR NPLV FVE+DS V   
Sbjct: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222

Query: 309 DFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAI 368
           +FDTQN APWGLAR+SHRERLNLGSFNKYL+DD AG GVT+YVIDTGVNV H DFE RA 
Sbjct: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282

Query: 369 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVE 428
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVLKGVE
Sbjct: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVE 342

Query: 429 YXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 488
           Y              GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402

Query: 489 NTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSM 548
           NTSPASA  AITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD+ATATLSGTSM
Sbjct: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462

Query: 549 ASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNAL 608
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIP+ TPN L
Sbjct: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522

Query: 609 IYNGGGQDLSAFWNDTKKS--HSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
           ++NG GQDLS FWN +K +   S+  +K   NLD  +G   D++++Q   +  K+N++
Sbjct: 523 VFNGAGQDLSDFWNISKPADLESNEVYK---NLD-LVG---DVLYDQFTGIFKKMNLL 573

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/432 (69%), Positives = 348/432 (80%), Gaps = 3/432 (0%)

Query: 191 PLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFI 250
           P+VS    N +A + IIPNRYI+VFKK + PEE  FH+E + Q QL+S   L  +D FF 
Sbjct: 83  PVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFF- 141

Query: 251 STRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDF 310
           S       S   GGI  +FNI +L +GY+GYFT E+++LIR NPLV++VEKDS+V+AT+F
Sbjct: 142 SASAIEDESINQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEF 201

Query: 311 DTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWG 370
           D QN+APWGLAR+SHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N  H DF KRA+WG
Sbjct: 202 DNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWG 261

Query: 371 KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYX 430
           KTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSDV+KGVE+ 
Sbjct: 262 KTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFA 321

Query: 431 XXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNT 490
                        GFKGSTANMSLGGGKSP LDLAVNAAV+AGIHFAVAAGNENQDACNT
Sbjct: 322 AESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNT 381

Query: 491 SPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMAS 550
           SPASA++AITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG D+ATATLSGTSMAS
Sbjct: 382 SPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMAS 441

Query: 551 PHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIY 610
           PHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+LFD+P+ TPN LI+
Sbjct: 442 PHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIF 499

Query: 611 NGGGQDLSAFWN 622
           NG G +L   WN
Sbjct: 500 NGAGGNLDDLWN 511

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/484 (63%), Positives = 360/484 (74%), Gaps = 14/484 (2%)

Query: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248
           LAPL +        I   IPNRYIIVFKKD   +E  FH+E V     +++ +LA  D F
Sbjct: 84  LAPLSTVND-----IANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPF 138

Query: 249 FISTRD-----AALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDS 303
           F +T          + S  GGIQDSF+I    SGY+GYFT+E++D IR++PLV+FVE+DS
Sbjct: 139 FTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDS 198

Query: 304 VVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDF 363
           +V +  F+TQNSAPWGLAR+SHRE+LNLGSFNKYLYDDDAG+GVT+YV+DTGVNVNHKDF
Sbjct: 199 MVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDF 258

Query: 364 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 423
           + RA+WGKTIP +D D+DGNGHGTHCAGTI S HYG            LRSNGSGTMSDV
Sbjct: 259 DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDV 318

Query: 424 LKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 483
           +KGVEY              GFKGSTANMSLGGGKSPALDLAVNAAV+AG+HFAVAAGNE
Sbjct: 319 VKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNE 378

Query: 484 NQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATL 543
           NQDACNTSPA+A+ AITVGASTLSD+RAYFSN+GKCVD+F PGLNILSTYIGSD ATATL
Sbjct: 379 NQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATL 438

Query: 544 SGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDD 603
           SGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKKKLI +STK++L D+P+D
Sbjct: 439 SGTSMATPHVVGLLTYFLSLQPDADSEYFHAAG-GITPSQLKKKLIDFSTKNVLSDLPED 497

Query: 604 TPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIG---SKTDLIFEQVRDVLDK 660
           T N LIYNGGGQDL   W              E +L+  I    SKTD IF+ VR +LD+
Sbjct: 498 TVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQ 557

Query: 661 LNII 664
            NII
Sbjct: 558 FNII 561

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHREL-MGKEDHH----DGPKH 46
          MK +NTL T+ AL  ++ ALVIP +     H +  +  +DH     D P+H
Sbjct: 1  MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQH 51

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/492 (63%), Positives = 371/492 (75%), Gaps = 17/492 (3%)

Query: 188 KLAPLVSTEQFNPDAIT------KIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVEN 241
           KLAPL+ T  F  D  T      +I+PN+YIIVFK  +  +E ++H+E + + Q QS   
Sbjct: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 242 LAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEK 301
           L     FF ST +    S   GGI  SFNI+++ SGY GYFTQE++DLIR NPLV +VE+
Sbjct: 274 LPPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVER 333

Query: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHK 361
           DS+V+ T+F+TQN+APWGL+R+SHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+NVNH 
Sbjct: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393

Query: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 421
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMS 453

Query: 422 DVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481
           DV+KGVE+               +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAG
Sbjct: 454 DVIKGVEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512

Query: 482 NENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEAT 540
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSN+G+CVDVFAPGLNILSTY+G  ++ T
Sbjct: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572

Query: 541 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQD-SLTPQQLKKKLIHYSTKDILFD 599
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632

Query: 600 IPDDTPNALIYNGGGQDLSAFWNDT--KKSHSSSGFKQELNLDEFIGS-----KTDLIFE 652
           +PD TPN LIYNG G D+S  WN    +++H     + ++N +  + S     KTDL F+
Sbjct: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692

Query: 653 QVRDVLDKLNII 664
           Q+R+V +K+NII
Sbjct: 693 QIRNVFEKMNII 704

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/482 (61%), Positives = 353/482 (73%), Gaps = 13/482 (2%)

Query: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           + APLV      P+    ++ NRYII+FKK V P+E  FHRE ++Q  LQ V  L  E +
Sbjct: 75  RFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHS 129

Query: 248 FFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEA 307
           FF   R   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DSVV  
Sbjct: 130 FFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYT 189

Query: 308 TDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 367
              DT+N APWGLAR+SHRERLNLGS+NKYLYD+  G GVTSYVIDTGVNV+H  F  RA
Sbjct: 190 QKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRA 249

Query: 368 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGV 427
            WGKTIP  D D DGNGHGTHCAGTI S  YG            LRSNGSG+MSDVLKGV
Sbjct: 250 KWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGV 309

Query: 428 EYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 487
           E+              GFKGSTANMSLGGGKSP+LD AVNAAV AG++FAVAAGNE+QDA
Sbjct: 310 EWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDA 369

Query: 488 CNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTS 547
           CNTSPASA   ITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSD +TATLSGTS
Sbjct: 370 CNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTS 429

Query: 548 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNA 607
           MASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TPN 
Sbjct: 430 MASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTPNL 487

Query: 608 LIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLD-----EFIGSKTDLIFEQVRDVLDKLN 662
           LIYNGGG DLS FW  +K+      F ++++L+     + +GSKTD +F Q+R ++D+L+
Sbjct: 488 LIYNGGGGDLSGFWG-SKEVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLD 546

Query: 663 II 664
           II
Sbjct: 547 II 548

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/509 (58%), Positives = 361/509 (70%), Gaps = 31/509 (6%)

Query: 185 HRGKLAPLVSTEQ--------------FNPDAITKIIPNRYIIVFKKDVPPEEAAFHRET 230
           HRG+L   ++ E               F  D +T+ IP++YI+VF++ V  EEAAFH E 
Sbjct: 35  HRGQLVQWMARENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMEL 94

Query: 231 VQQAQLQSVENLAAEDAFFISTR----DAALSSSEA-GGIQDSFNIDSLFSGYIGYFTQE 285
           V+ A  +SV  L  + AFF STR    +  ++++ A GGI+  F +     GY+GYFT++
Sbjct: 95  VEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTED 154

Query: 286 IVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGR 345
           +V L+R NP V FVE+DS+V A+DF TQN APWGLARVSHRE+LN GSFNKYLYDD++G 
Sbjct: 155 MVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGE 214

Query: 346 GVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXX 405
           GVTSYVIDTG+N++H DFE RA+WGKTIP ND D DGNGHGTHCAGTIASK YG      
Sbjct: 215 GVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGVAKKAN 274

Query: 406 XXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLA 465
                 LRSNG+G+MSDVL+GVEY              GFKGSTANMSLGGG+S ALDLA
Sbjct: 275 VVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQALDLA 334

Query: 466 VNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAP 525
           V+AAV+AGIHFAVAAGNENQDACNTSPA++ KAITVGASTL+DDRAYFSN+G+CVD+FAP
Sbjct: 335 VDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAP 394

Query: 526 GLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLK 585
           G+NILSTYIGSD A ATLSGTSMASPHVAGLLTYFLSLQP  DSEF    + +++P+ LK
Sbjct: 395 GMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEF--RNKQTISPEVLK 452

Query: 586 KKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQE-------LN 638
           KK+I + TKD L  +P  T N LIYNGGG DLS FW +  K  S   F           +
Sbjct: 453 KKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSD 512

Query: 639 LDEFI---GSKTDLIFEQVRDVLDKLNII 664
           LD  I    S TD +F   R +LD++NII
Sbjct: 513 LDRLIHELESSTDAMFSGFRTILDRMNII 541

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/472 (62%), Positives = 350/472 (74%), Gaps = 17/472 (3%)

Query: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265
           ++P++YI+V KK V PE  A     V  A   ++ +L  E  FF       L     GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57

Query: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325
           +D FNI+ LF G IGYF + +V L+ ++ +V+FVE+DSVV A++FDTQN+APWGLAR+SH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+NV H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 386 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGF 445
           GTHCAGTIASKHYG            L+S+GSGTMSDV+KGVEY               F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQ 564
           LSDDRAYFSN+GKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 565 PGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPD-DTPNALIYNGGGQDLSAFWND 623
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+PD D+PN LIYNG G DL  FWN 
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 624 T-----KKSHSSSGFKQELNLD---EFIGSK---TDLIFEQVRDVLDKLNII 664
           T        H       EL LD   + +G +   TD +F QVR++LDK+NII
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/480 (59%), Positives = 359/480 (74%), Gaps = 19/480 (3%)

Query: 188 KLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           K APL S E    + +  +IPN+YIIVFKKDV  ++   H++ + +AQ Q          
Sbjct: 215 KYAPLHSMENTKYENL--VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ---------- 262

Query: 248 FFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEA 307
            + S  D   SSS  GGI+++FN+ +LF GYIG+F +++V  IR +P+VDFVE+DS+V A
Sbjct: 263 -YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHA 320

Query: 308 TDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRA 367
            + DTQN+APWGLAR+SHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+N+ HK+F  RA
Sbjct: 321 NEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRA 380

Query: 368 IWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGV 427
           +WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTMSDVLKGV
Sbjct: 381 VWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGV 440

Query: 428 EYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDA 487
           EY              GFKGSTANMSLGGGKS +LDLAV+AAV++GIHFAVAAGNENQDA
Sbjct: 441 EYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDA 500

Query: 488 CNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTS 547
           CN+SPA+++ AITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSDEATATLSGTS
Sbjct: 501 CNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTS 560

Query: 548 MASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNA 607
           MASPHVAGLL+YFLS+QP +DSEFF  G +S++P QLKKKLI YSTK++  D+P+ TPN 
Sbjct: 561 MASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNL 620

Query: 608 LIYNGGGQDLSAFWNDTKKSHSSSGFK-QELNLDEFIGSK---TDLIFEQVRDVLDKLNI 663
           L+YN  G ++S FW    +S +    + +E  L++ + S     D     ++ V +++++
Sbjct: 621 LVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 331/456 (72%), Gaps = 20/456 (4%)

Query: 209 NRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQDS 268
           N+YII+FK+ V  E+ + H++ +QQ  L+              T D +     A  + DS
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLE--------------TSDVSAQGIVAD-VLDS 140

Query: 269 FNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRER 328
           F+++ + SGY+   +  +++L+R++P V  VE+DS V   +FDTQN+APWGLAR+SHR+ 
Sbjct: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200

Query: 329 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 388
           L+LGSFNKYLYDD AG GV SY+IDTG+NV HK+FE RA WGKTIP ND D DGNGHGTH
Sbjct: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260

Query: 389 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGS 448
           CAGTIASKHYG            LRSNGSG+MSDV+ GVE+               FKGS
Sbjct: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320

Query: 449 TANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 508
           TANMSLGGGKSP+LD  V+AAV+ G+HF+VAAGNENQDACNTSPA++++AITVGASTLSD
Sbjct: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380

Query: 509 DRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSD 568
           DRAYFSN+G CVD+FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLLTYFLSLQP   
Sbjct: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440

Query: 569 SEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSH 628
           S+F    Q  +TP+QLKKKL+ YSTK +LFD+P+DTPNALIYNGGG DLS FW D  K  
Sbjct: 441 SQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498

Query: 629 SSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
               F  E    + + + +D +FEQVR +  KLNI 
Sbjct: 499 HKPLFAHEY---DNVWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/437 (61%), Positives = 322/437 (73%), Gaps = 13/437 (2%)

Query: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248
           LAP+      N DA   IIP+RYIIVFK  V  E+  FH+E +    LQ     + +   
Sbjct: 46  LAPV-----HNADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTE 99

Query: 249 FISTRDAALSS--SEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVE 306
           ++ T      S     GGI   F+I SL SGYI Y + E++  IR NPL+ F+E D++V 
Sbjct: 100 YLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVH 159

Query: 307 ATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 366
            TDF+TQN+APWGLAR+SHRE LNL +FNKYLYDDDAG+ V +YVIDTGV+VNH +F  R
Sbjct: 160 TTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219

Query: 367 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKG 426
           A WGKTIPLND+D+DGNGHGTH AGTI S+HYG            LRSNGSG+MSDV+KG
Sbjct: 220 AHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKG 279

Query: 427 VEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 486
           VE+                KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQ+
Sbjct: 280 VEF-AVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338

Query: 487 ACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DEATATLSG 545
           ACN+SPASA++A+TVGAST+SD+RAYFSN+G+CVD+FAPGLNILSTYIG+ D+ TATLSG
Sbjct: 339 ACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSG 398

Query: 546 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTP 605
           TSMASPHVAGLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+P+ TP
Sbjct: 399 TSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGTP 455

Query: 606 NALIYNGGGQDLSAFWN 622
           N LIYNGGGQDLS FWN
Sbjct: 456 NVLIYNGGGQDLSDFWN 472

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/475 (57%), Positives = 343/475 (72%), Gaps = 19/475 (4%)

Query: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTR----DAALSS 259
           ++ IP+RYI++FK  V   +   H++ V  A ++++  L    +FF +T     +   + 
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 260 SEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWG 319
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A+DF+TQ  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 320 LARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 379
           LARVSHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+N++H +FE RA WGKTIP ND D
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 380 LDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXX 439
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDVL+GVEY          
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345

Query: 440 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 499
                FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+ K I
Sbjct: 346 DPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 500 TVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 559
           TV ASTLSDDRAYFSN+G CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 560 FLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSA 619
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 620 FWN------DTKKSHSSSG----FKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664
           FWN      + +K  SS G    F+ E +L + + S +  +F ++R+ LD+L++I
Sbjct: 522 FWNSKCDGCEQEKVSSSHGKADDFESE-SLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/480 (55%), Positives = 336/480 (70%), Gaps = 27/480 (5%)

Query: 192 LVSTEQFNPDAI----TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDA 247
           LV  E+  P ++    +++IP  YI+VF + V   E + H ET+ Q QLQSV +L  +  
Sbjct: 16  LVLPEEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHE 75

Query: 248 FF-ISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVE 306
           FF IST     S+   GG++D F I +   GY G FT E+V+ +R +PLV F+E+DS+V 
Sbjct: 76  FFTISTSSDVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVH 135

Query: 307 ATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 366
            T+  TQ +APWGLAR+SHR RLNL +FNKYLYDD  G+GV +YVIDTG+N+ + DF  R
Sbjct: 136 TTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGR 195

Query: 367 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKG 426
           A WGKTIP  + ++DGNGHGTH AGTIAS HYG            LRSNG+G+MSDVLKG
Sbjct: 196 AYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKG 255

Query: 427 VEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 486
           VEY              GFKGS ANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQD
Sbjct: 256 VEYVVGAHQRDVGTA--GFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQD 313

Query: 487 ACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGT 546
           ACNTSPA+A++AITVGASTLSD RAYFSN+G+CV +FAPGLNILSTYIGS +ATATLSGT
Sbjct: 314 ACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGT 373

Query: 547 SMASPHVAGLLTYFLSLQPGSDSEFFEMGQ-DSLTPQQLKKKLIHYSTKDILFDIPDDTP 605
           SMASPH+AGL+ YFLSLQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TP
Sbjct: 374 SMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTP 433

Query: 606 NALIYNGGGQDLSAFW--NDTKKSHSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNI 663
           N + YNG G+ L  FW  ND  K++ S                  +I EQ++ +L+K+NI
Sbjct: 434 NVIAYNGAGKSLEDFWNANDYVKNYQSL-----------------VITEQLQFILNKMNI 476

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  494 bits (1273), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/415 (56%), Positives = 308/415 (74%), Gaps = 5/415 (1%)

Query: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266
           +P RYII F +D        H+  +Q+ Q +SV  LA +DAFF+ST  +A S  + GGI 
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124

Query: 267 DSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHR 326
             F+I+ LF GY GYFT+E++  + Q+P++ F+E++S V+ T+   Q  APWGL R+SHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 327 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHG 386
           E+   G   +YLY+D AGRGVTSYV+DTG+++NH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 387 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFK 446
           THCAG I S+H+G            LRSNG GT+SDV+KG+EY               FK
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 447 GSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTL 506
           GSTAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 507 SDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPG 566
           SDDRA+FS++G CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 567 SDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ +DTPN LIYNGGG+ L  FW
Sbjct: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  492 bits (1267), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 264/455 (58%), Positives = 315/455 (69%), Gaps = 32/455 (7%)

Query: 209 NRYIIVFKKDVPPEE---------AAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSS 259
           +RYIIVFKK V  E+         A F R + +Q    +    A  D F           
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGF----------- 182

Query: 260 SEAGGIQDSFNIDSLFSGYIGYF-TQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPW 318
                + D+F +   FSGYI    + +IVD IR NPLVD+VEKDSVV + D +TQN+APW
Sbjct: 183 ---DRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPW 238

Query: 319 GLARVSHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLND 377
           GLAR+SHRE LNLG+FNKYLY  + AG+GVT+YV+DTG++V+H +F +RA WGKTIP+ND
Sbjct: 239 GLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPIND 298

Query: 378 EDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXX- 436
            D+DGNGHGTHCAGTI S+HYG            LRS+GSGTMSDVLKGVE+        
Sbjct: 299 YDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKH 358

Query: 437 ---XXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPA 493
                      +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA
Sbjct: 359 LEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPA 418

Query: 494 SADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 553
           +A+ AITVGASTLSDDRAYFSNYGKCVD+FAPGLNILSTYIG+++ATATLSGTSMASPHV
Sbjct: 419 AAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHV 478

Query: 554 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGG 613
           AGLLTY LSLQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG
Sbjct: 479 AGLLTYLLSLQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGG 537

Query: 614 GQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTD 648
               + FW       S        +L  F+ S  D
Sbjct: 538 FNS-TDFWASAAAPQSHKVKTNRYSLGSFLDSIQD 571

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  488 bits (1256), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 233/418 (55%), Positives = 301/418 (72%), Gaps = 3/418 (0%)

Query: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263
           T++IP RYI+VF +D+  +    HR+ VQ+A   SV  LA +D F      +     + G
Sbjct: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123

Query: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323
           GI  SF+I+ LF GY GYFT EI++L+ Q+PL+ F+E++S V  ++   Q  APWGL R+
Sbjct: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183

Query: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243

Query: 384 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXX 443
           GHGTHCAG I SKHYG            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303

Query: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503
            FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363

Query: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423

Query: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI D+TPN LIYNGGG+ L   W
Sbjct: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  484 bits (1245), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 228/418 (54%), Positives = 300/418 (71%), Gaps = 3/418 (0%)

Query: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263
           +K +P RYIIVF +D+       H + +Q+AQ  SV  +  +D+F  +   +A  + + G
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125

Query: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323
           GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  ++   Q  APWGL R+
Sbjct: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185

Query: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245

Query: 384 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXX 443
           GHGTHCAG I S+H+G            LRSNG GT+SDV+KG+EY              
Sbjct: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGS 305

Query: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503
            FKGSTAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 306 KFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365

Query: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425

Query: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ ++TPN L+YNGGG+ L  FW
Sbjct: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  481 bits (1238), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 233/418 (55%), Positives = 301/418 (72%), Gaps = 3/418 (0%)

Query: 204 TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAG 263
           T+ +P RY+IVF +D+  ++   H + VQ+    SV  L   DAF+     +  S S+ G
Sbjct: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFG 123

Query: 264 GIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARV 323
           GI + F+I+ LF GY GYFT EI+ +I Q+P++ FVE+++ V+ ++   Q  APWGL RV
Sbjct: 124 GIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRV 183

Query: 324 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGN 383
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243

Query: 384 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXX 443
           GHGTHCAG I SKH+G            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303

Query: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503
            FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363

Query: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563
           ST SDDRA+FSN+G CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423

Query: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI DDTPN LIYNGGG+ L  FW
Sbjct: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  409 bits (1050), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/416 (50%), Positives = 274/416 (65%), Gaps = 5/416 (1%)

Query: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265
           IIPNRYI++FK  V  +E   H   +++    S+     +D+ F         S+   G+
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI---FLQDSDFGKATQYNDISTRGIGL 129

Query: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V   ++  Q   PWGL R+S 
Sbjct: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189

Query: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385
           RE+L +     Y YDD  G+   ++VIDTG+ V+H+DFE RA WGKTI  ND D D NGH
Sbjct: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249

Query: 386 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGF 445
           GTHCAGTIASKHYG            LRS+GSG+MSDV++GVEY                
Sbjct: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTKSNL 308

Query: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505
           KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACN+SPASA   ITVG ST
Sbjct: 309 KGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGST 368

Query: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 565
           LSDD A+FSNYG+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 566 GSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFW 621
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N L+YNGGG++LS FW
Sbjct: 429 DHKSQFYHE-HSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  383 bits (984), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 262/418 (62%), Gaps = 21/418 (5%)

Query: 206 IIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGI 265
           II ++YI++FK      E   H         + ++N     ++    +D   S+      
Sbjct: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104

Query: 266 QDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325
            + F I +  SGYI     E + L+RQ+P+V  +E DS V A     Q   PWGL+R+S 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 326 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGH 385
           R R+ +G    Y YDD     VT+YV+DTG+ ++H+ F  RA WGKTI  ND D D +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 386 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGF 445
           GTH AG IAS  +G            LRSNG G MSDVLKG+E+                
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS---- 280

Query: 446 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 505
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 506 LSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 565
            SD+RA+FSN+G+CVDVFAPG+N++STYIGSD AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 566 GSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWND 623
             DS +F      +TP +LK+K++ + +KD+L+++P++TPN +IYNG G++LS FW D
Sbjct: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  353 bits (906), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 190/421 (45%), Positives = 253/421 (60%), Gaps = 26/421 (6%)

Query: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266
           IPN+YI++FK D         RET          +LA  +++ ++T D   +      I 
Sbjct: 53  IPNQYIVLFKSDT----TDIQRET----------HLATLNSWLLNT-DPQYT------IL 91

Query: 267 DSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHR 326
            SF +     GY     ++++  +  +P++  +E+DS V A     Q  +PWGLAR+S R
Sbjct: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151

Query: 327 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI-PLNDEDLDGNG 384
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211

Query: 385 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXX-XX 443
           HGTHCAG I S  YG            L + G G MS V++G+EY               
Sbjct: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271

Query: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503
           GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331

Query: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLTYFLS 562
           S+ SDDR +FSN+G CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL+ YFLS
Sbjct: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391

Query: 563 LQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWN 622
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IP+ TPN ++YNGGG  L  FWN
Sbjct: 392 LQPDTKSQFY-TGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

Query: 623 D 623
           +
Sbjct: 451 N 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  318 bits (816), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/431 (42%), Positives = 255/431 (59%), Gaps = 24/431 (5%)

Query: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266
           IP++YI++F+ D    + +   + +     +  +     D +        +S+   G I 
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMI- 121

Query: 267 DSFNIDSLFSGYIGYFTQEIVD-LIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325
                       I  F +++ + +     ++  +E+DS V    F TQ  + WGL+R+S 
Sbjct: 122 --------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQ 173

Query: 326 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGN 383
           R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  L D N
Sbjct: 174 RNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSN 233

Query: 384 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXX 443
           GHGTHCAG I SK YG            L   G G+MSDV+ G+E+              
Sbjct: 234 GHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISS 293

Query: 444 G------FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 497
                  FKGS  N+SLG  KSP+LD+A+ +A + GIH  VAAGNE++DAC TSPA +  
Sbjct: 294 SSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPA 353

Query: 498 AITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGL 556
            ITVGAS+ SDDRA+FSN+G CVDVFAPG+NI STYIG ++  T +LSG+SM+SP V+GL
Sbjct: 354 VITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGL 413

Query: 557 LTYFLSLQPGSDSEFFEMGQDSL-TPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQ 615
             Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+YNGGG+
Sbjct: 414 TAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469

Query: 616 DLSAFWNDTKK 626
           DLS FWN T+K
Sbjct: 470 DLSGFWNATRK 480

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  310 bits (793), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 159/352 (45%), Positives = 219/352 (62%), Gaps = 9/352 (2%)

Query: 267 DSFNI-DSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH 325
           + F+I D L    +  F    V  + Q P V+ VE +S V A +   Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 326 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNG 384
           R+R+ +G    Y YD   + + V  Y++DTG+ V+H++FE RA WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 385 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXG 444
           HGTHCAG +    YG            L + G G MSDV++G+E+               
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDE--- 251

Query: 445 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 504
            +GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA+ D  +TVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 505 TLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDE-ATATLSGTSMASPHVAGLLTYFLSL 563
           T SDDRA+FSN+G C+DVFAPG+N+ S+Y+G+ +  T +LSGTS ++PHVAGL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 564 QPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQ 615
           +P + S+F     +   P QLK+KL+  +T+  LF++PDDT N +I+NG  Q
Sbjct: 372 EPDTKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  302 bits (773), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 252/438 (57%), Gaps = 10/438 (2%)

Query: 190 APLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFF 249
           APLV+    N +    I+P RYI++FK      E   H +TV + QL+   +LA  D FF
Sbjct: 52  APLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFF 111

Query: 250 ISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATD 309
             TRD   S+ E GG+  +F+I S F+GY+GYFT E+V+ IR+  +VD+VE DS++   D
Sbjct: 112 HHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDD 171

Query: 310 FDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIW 369
            +T +++ W LAR+SHR +L L +FN+Y +D + G+ + +Y++DTGV   H  + +R I 
Sbjct: 172 KETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIR 231

Query: 370 GKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEY 429
           G  I  N+++ D NGHGT  AG +  +  G            L   G GT+S+++KG+ +
Sbjct: 232 GIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSF 291

Query: 430 XXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACN 489
                         G  G+    S+ G KS +L+ A +  V +GIH  V AG +  +ACN
Sbjct: 292 --VNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACN 349

Query: 490 TSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATAT----LSG 545
           +SPAS+ K ITV   +++D+     N+G CVD++ PG  + +TY   +    T    ++G
Sbjct: 350 SSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTG 409

Query: 546 TSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTP 605
           +S A+  VAGLL YF SLQPG  +         LTP++LK++LI + TK  L ++   +P
Sbjct: 410 SSAAAAQVAGLLAYFASLQPGLGTP----DVIPLTPEELKERLIDFGTKGKLTNLERMSP 465

Query: 606 NALIYNGGGQDLSAFWND 623
           N + +NG G +L +F+ND
Sbjct: 466 NIIAFNGAGGNLDSFFND 483

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 181/390 (46%), Gaps = 65/390 (16%)

Query: 265 IQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLV-------DFVEKDSVVEATDFD------ 311
           I  +F+  S F G     +Q++V+ IR NPLV        F   D V+   +        
Sbjct: 52  ISHTFSFGS-FRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGD 110

Query: 312 --------------TQNSAPWGLARVSHRERLNLG---------SFNKYLYDDDAGRGVT 348
                          Q  AP  LAR+S R  L            SFN Y Y    GR + 
Sbjct: 111 NLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNIN 170

Query: 349 SYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXX 408
           +Y+IDTG+   HKDF  RAI+G+     +   D NGHGTH AG + S ++G         
Sbjct: 171 AYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIE 229

Query: 409 XXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNA 468
              L + G G ++ V+  VE+              G KG  AN+SLG  ++  ++ A+ A
Sbjct: 230 VKALNNRGQGNLTTVISAVEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKA 283

Query: 469 AVEAGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGL 527
           A EAG+   VAAGN N +AC  SPASA +AITVGA    +D  A FSN+G CVD+FA G+
Sbjct: 284 AHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGV 343

Query: 528 NILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKK 587
            + S            SGTSMASP V GL+   L                 + P+ +K K
Sbjct: 344 KVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILL--------------DKGVEPENIKAK 389

Query: 588 LIHYSTKDI-----LFDIPDDTPNALIYNG 612
           L+  +T D+     LF  P  TPN + +NG
Sbjct: 390 LVELATHDLLQRRTLFFKP-GTPNRIAFNG 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 145/393 (36%), Positives = 198/393 (50%), Gaps = 73/393 (18%)

Query: 265 IQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATD-------------FD 311
           I  +F+I S F G+    T ++++ I++NPLV  V  +  V A +             FD
Sbjct: 58  IGKTFSIGS-FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 312 -----------TQNSAPWGLARVSHRERL---------NLGSFNKYLYDDDA-GRGVTSY 350
                       Q  AP  LAR+S R++L          L S  KY YD  + G  V +Y
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAY 175

Query: 351 VIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXX 409
           +ID+G+ + H++F  RAI G  I L  E   D NGHGTH AG + SK YG          
Sbjct: 176 IIDSGIYLEHEEFNGRAIPG--IDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEI 233

Query: 410 XXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKG-STANMSLGGGKSPALDLAVNA 468
             L   G G+++ VL G+E+                KG   AN+SLG  ++  L+ A+ A
Sbjct: 234 KVLNRLGQGSLAMVLGGIEFAVKHCQETSK------KGRCVANLSLGSMRTAILNKAIKA 287

Query: 469 AVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFA 524
           A++AG+   VAAGN N +AC  SPASA +AITVGA    DDR    A FSN+G+C+D+FA
Sbjct: 288 AIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFA 344

Query: 525 PGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFEMGQDSL 579
           PG+ I S  I  D+   T SGTSMASP VAGL    L+L  G  +E       EMG D++
Sbjct: 345 PGVVIKSLSIFKDKEDVTYSGTSMASPTVAGLAA--LTLDQGVSAEEVKDYILEMGTDNV 402

Query: 580 TPQQLKKKLIHYSTKDILFDIPDDTPNALIYNG 612
                      +  + +LF     TPN + +NG
Sbjct: 403 -----------FHRRSLLFK--PGTPNKICFNG 422

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  180 bits (457), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 142/442 (32%), Positives = 206/442 (46%), Gaps = 75/442 (16%)

Query: 225 AFHRETVQQAQLQSV-ENLAAEDAF------------FISTRDAALSSSEAGGIQDSFNI 271
           A HR    Q  L S+  NLA  + +            F ST + +        I+  F+I
Sbjct: 36  ARHRTMKAQCILISLLANLALAEEYLVRFKNPTAFQQFTSTSNRSWRQFIDHRIEKKFSI 95

Query: 272 DSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDT------------------- 312
            S F G     ++ +V+ ++++PL+  +  +   EA D D                    
Sbjct: 96  GS-FRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKYAYQDIDE 154

Query: 313 ------QNSAPWGLARVSHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVN 357
                 Q  AP  LAR+S   +L             FN Y  D+  G+GV +Y++DTG++
Sbjct: 155 AQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIH 214

Query: 358 VNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNG 416
             H +FE R I G  + L  E   D NGHGTH AG + S+ +G            L  +G
Sbjct: 215 AEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDG 272

Query: 417 SGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHF 476
           SG  S+VL G+E+                K   AN+SLG  +SP +++AV  A+E GI F
Sbjct: 273 SGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIVF 329

Query: 477 AVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIG 535
             AAGN N DA   SPASA+  ITVGA     D  A FSN+G CV++FAPG+ I S    
Sbjct: 330 VAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHL 389

Query: 536 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKD 595
           +D  +  LSGTSM++P V G+    LS                + P+ + +++ + ST++
Sbjct: 390 NDNESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTRN 435

Query: 596 I-----LFDIPDDTPNALIYNG 612
           +     LF  P  TPN ++YNG
Sbjct: 436 VFHRRTLFFKP-STPNQILYNG 456

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  177 bits (450), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 164/323 (50%), Gaps = 36/323 (11%)

Query: 306 EATDFDTQNSAPWGLARVSHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 356
           E  +   Q+ AP  LAR+S   +L             FN Y  DD  G+ V +Y++DTG+
Sbjct: 118 EEQNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGI 177

Query: 357 NVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 415
             +H +FE R I G  I L  E   D NGHGTH AG + SK YG            L  +
Sbjct: 178 FADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 235

Query: 416 GSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 475
           GSG  S+VL G+E+                K   AN+SLG  +SP +++AV  A+E GI 
Sbjct: 236 GSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIV 292

Query: 476 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYI 534
           F  AAGN N DA   SPASA+  ITVGA     D  A FSN+G CV++FAPG+ I S   
Sbjct: 293 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 352

Query: 535 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTK 594
            +   T  LSGTSM++P V G+    LS                + P+ + ++L + ST+
Sbjct: 353 LNFNDTLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTR 398

Query: 595 DI-----LFDIPDDTPNALIYNG 612
           ++     LF  P  TPN ++YNG
Sbjct: 399 NVFHRRTLFFKP-STPNQILYNG 420

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 157/321 (48%), Gaps = 40/321 (12%)

Query: 311 DTQNSAPWGLARVSHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 361
           + Q  AP  L R+S R +L            F  Y Y+D   G  + +Y++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 421
           DFE R I G  +   +   D NGHGTH AG + SK +G            L   GSG ++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 422 DVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481
            VL G+++                K   ANMSLG  ++  ++ A++ A +AG+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQG---KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 482 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNI--LSTYIG 535
           N N  AC TSPASA  AITVGA    DDR    AYFSN+G CVD+FAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 536 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKD 595
           S     T SGTSMASP VAGL    L                 + P  +K KL+H STKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL--------------DKGVEPFDVKDKLLHLSTKD 430

Query: 596 IL----FDIPDDTPNALIYNG 612
           +           TPN + YNG
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG 451

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  175 bits (443), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 129/386 (33%), Positives = 180/386 (46%), Gaps = 53/386 (13%)

Query: 254 DAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATD---- 309
           D +L S  +  I  +F+    F G+   F ++ V+ +++NPLV  V  +SV    D    
Sbjct: 41  DMSLKSFVSTRISKTFSFGK-FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQ 99

Query: 310 --------FDTQNSAPWGLARVSHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDT 354
                   +  Q  AP  LAR+S R  L           FN Y      G  V +Y+IDT
Sbjct: 100 IAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDT 159

Query: 355 GVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 414
           G+   HKD   RA +G  + + +   D NGHGTH AG + S+ +G            L +
Sbjct: 160 GIYKQHKDLGGRAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNA 218

Query: 415 NGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 474
            G G ++ V+  +E+                    AN+SLG  ++  L+ AV AAVE+G+
Sbjct: 219 KGQGNLTSVISSIEFSVNHCKKSGML-------CVANLSLGSLRNTVLNQAVEAAVESGL 271

Query: 475 HFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNIL 530
              VAAGN N +AC  SPASA  AITVGA    DDR    A FSN+G CVDVFA G+ ++
Sbjct: 272 VVVVAAGNSNVNACWNSPASAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVM 328

Query: 531 STYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIH 590
           S            SGTSMASP VAGL    L                 + P  +K+K+I 
Sbjct: 329 SLSNMPPFKPVAYSGTSMASPSVAGLAAVLL--------------DSGIDPPDIKQKIID 374

Query: 591 YSTKDIL----FDIPDDTPNALIYNG 612
            +T+++           TPN + +NG
Sbjct: 375 LATENVFQKRTLVFKPGTPNRIAFNG 400

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  174 bits (441), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 188/393 (47%), Gaps = 66/393 (16%)

Query: 265 IQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSA-------- 316
           I+  F+I S F G     ++ +V+ ++++PLV  +  +   EA + D+ NSA        
Sbjct: 49  IEKKFSIGS-FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNA 107

Query: 317 ---------------------PWGLARVSHRERLNL---------GSFNKYLYDDDAGRG 346
                                P  LAR+S   +L             FN Y   D  G+ 
Sbjct: 108 TAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQD 167

Query: 347 VTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXX 405
           V +Y++DTG+  +H +FE R I G  I L  E   D NGHGTH AG + SK YG      
Sbjct: 168 VNAYIMDTGIFADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVN 225

Query: 406 XXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLA 465
                 L  +GSG  S+VL G+E+                K   AN+SLG  +SP +++A
Sbjct: 226 LVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMA 282

Query: 466 VNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFA 524
           V  A+E GI F  AAGN N DA   SPASA+  ITVGA     D  A FSN+G CV++FA
Sbjct: 283 VEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFA 342

Query: 525 PGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQL 584
           PG+ I S    +   T  LSGTSM++P V G+    LS                + P+ +
Sbjct: 343 PGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLS--------------KGIEPEMI 388

Query: 585 KKKLIHYSTKDI-----LFDIPDDTPNALIYNG 612
            +++ + ST+++     LF  P  TPN ++YNG
Sbjct: 389 AQEIEYLSTRNVFHRRTLFFKP-STPNQILYNG 420

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 177/373 (47%), Gaps = 61/373 (16%)

Query: 284 QEIVDLIRQNPLV-------DFVEKDSV-VEATDFDT-----QNSAPWGLARVSHRERLN 330
           +++VD IR++PLV        FV  D    E  +F++     Q  AP  L+R+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 331 L----------GSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL 380
                      GSFN Y  +   G G+ +Y+IDTG+   H +F  RA++G       EDL
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFG-------EDL 184

Query: 381 ------DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXX 434
                 DGNGHGTH AG + S  YG            L + G G ++ V+  +E+     
Sbjct: 185 TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHC 244

Query: 435 XXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPAS 494
                      KG   N+SLG  ++  ++ AV AA EAGI   VAAGN N +AC  SPAS
Sbjct: 245 RSSEG------KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPAS 298

Query: 495 ADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 553
           A +AITVGA    +D  A FSN+G CVD+FAPG+ + S            SGTSMASP +
Sbjct: 299 APEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSI 358

Query: 554 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDIL----FDIPDDTPNALI 609
            GL    L               + +   ++K  ++  +T D+           TPN + 
Sbjct: 359 TGLAAILL--------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVA 404

Query: 610 YNGGGQDLSAFWN 622
           +NG  ++   F N
Sbjct: 405 FNGVKKNDDKFSN 417

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  174 bits (441), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 164/323 (50%), Gaps = 36/323 (11%)

Query: 306 EATDFDTQNSAPWGLARVSHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 356
           EA +   Q+ AP  LAR+S   +L             FN Y  DD  G+ V +Y++DTG+
Sbjct: 167 EAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 357 NVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 415
             +H +FE R I G  I L  E   D NGHGTH AG + SK YG            L  +
Sbjct: 227 FSDHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 284

Query: 416 GSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 475
           GSG  S+VL G+E+                K   AN+SLG  +SP +++AV  A+E GI 
Sbjct: 285 GSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIV 341

Query: 476 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYI 534
           F  AAGN N DA   SPASA+  ITVGA     D  A FSN+G CV++FAPG+ I S   
Sbjct: 342 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 401

Query: 535 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTK 594
            + E T  LSGTSM++P V G+    LS                + P  + +++ + ST+
Sbjct: 402 LNYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEYLSTR 447

Query: 595 DI-----LFDIPDDTPNALIYNG 612
           ++     LF  P  T N ++YNG
Sbjct: 448 NVFHRRTLFFKP-STANQILYNG 469

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  168 bits (426), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 132/396 (33%), Positives = 181/396 (45%), Gaps = 54/396 (13%)

Query: 246 DAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVV 305
           + F  S     L     G I   F I  L  G     + +++D I+++P V  V  + +V
Sbjct: 33  ERFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPFVKEVVPNIMV 91

Query: 306 EATDFDT------------QNSAPWGLARVSHRERLNLGSFNK--------YLYDDDA-G 344
           +A + D             Q  AP  LAR+S R +L     NK        Y YD  A G
Sbjct: 92  KAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQG 151

Query: 345 RGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXX 404
               +Y++DTGV  +HK+FE R  +G       E  D NGHGTH AG + SK +G     
Sbjct: 152 ATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHV 210

Query: 405 XXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDL 464
                  L + G+GT+  +L  +E+                     NMSLG  KS  L+ 
Sbjct: 211 QLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQ 264

Query: 465 AVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCV 520
           A+N   + GI   VAAGN N +AC TSP+SA  AITVGA    DDR    A FSN+G CV
Sbjct: 265 AINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCV 321

Query: 521 DVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLT 580
           D+FAPG+N+ S       +    SGTSMASP V G++   L               D + 
Sbjct: 322 DIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD--------------DGVP 367

Query: 581 PQQLKKKLIHYSTKDIL----FDIPDDTPNALIYNG 612
           P+ ++  L   +T  +           TPN+++YNG
Sbjct: 368 PEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNG 403

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  166 bits (421), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 159/320 (49%), Gaps = 47/320 (14%)

Query: 313 QNSAPWGLARVSHRERL-----NLGSF-NKYLYDDDA---GRGVTSYVIDTGVNVNHKDF 363
           Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V +Y+IDTG+   H +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 364 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 422
           E R  +   I L  E   D NGHGTH AG + SK +G            L   G G +S 
Sbjct: 175 EGRVKFA--IDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 423 VLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 482
           +LK +E+                K   AN+S G  ++  +D A+  A  AGI   VAAGN
Sbjct: 233 ILKALEFTIRHCKESVD------KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 483 ENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNI--LSTYIGS 536
            N DAC  SPAS+   ITVGA    DDR    A FSN+G CVDVFAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 537 DEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDI 596
           D     LSGTSMASP V+G+    L                 L P+ +K K+I  STK+I
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL--------------DKGLNPKFVKSKIIESSTKNI 387

Query: 597 L----FDIPDDTPNALIYNG 612
                  I  +TPN +++NG
Sbjct: 388 FHQGTIMIKPNTPNLIVFNG 407

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  166 bits (419), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 178/359 (49%), Gaps = 53/359 (14%)

Query: 284 QEIVDLIRQNPLVDFVEKDSVVEATDFD--------------TQNSAPWGLARVSHRERL 329
           Q+I++ ++QNPLV  +  + + +A + D               Q+ AP  LAR+S R++L
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 330 -----NLGS----FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL 380
                N+ S    FN Y   +  G  V +Y++D+GV+ N  DFE R  +G      D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEG 194

Query: 381 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXX 440
           D NGHGTH AG + SK YG            L   G GT+  VL  +E+           
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE- 253

Query: 441 XXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAIT 500
                K   AN+SLG  K+  ++ A+ AA E G+   VAAGN N +AC TSPASA++AIT
Sbjct: 254 -----KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAIT 308

Query: 501 VGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGL 556
           VGA    DDR    A FSN+G CVD++APG+ + S          + SGTSMASP V G 
Sbjct: 309 VGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQ 365

Query: 557 LTYFLSLQPGSD---SEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNG 612
           +   L     +D   S   +M  D +           +  + +LF    +TPN +++NG
Sbjct: 366 VAILLDKGIPNDDIKSTLIKMATDDV-----------FQKRTLLFK--PNTPNRVLFNG 411

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  169 bits (429), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 164/335 (48%), Gaps = 43/335 (12%)

Query: 308 TDFDTQNSAPWGLARVSHRERL-----NLGSFNK---YLYDD-DAGRGVTSYVIDTGVNV 358
           + F  Q  AP  LAR+S R++L     N   F +   Y YDD D G GV +YVIDTG+  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 359 NHKDFEKRAIWGKTIPLNDEDLDG------NGHGTHCAGTIASKHYGXXXXXXXXXXXXL 412
            HKDFE R  +G        DL G      NGHGTH AG I SK YG            +
Sbjct: 342 EHKDFEDRVEFGT-------DLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAV 394

Query: 413 RSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA 472
              GS  +S +++ +EY                K    NMSLG      ++ AV +A+  
Sbjct: 395 SLTGSTQLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 473 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLN 528
           G+ F VAAGN N DAC +SP S+  AITVGA    DDR    A FSN+G+CVD+FA G+ 
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVE 506

Query: 529 ILSTYIGSDEATATLSGTSMASPHVAGLLTYFLS--LQPGSDSEFFEMGQDSLTPQQLKK 586
           + S            SGTSMASP V G ++  LS  ++P    E  EM + S      ++
Sbjct: 507 VKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLSQGVKPNDVQE--EMVKLSTKGDFTRR 564

Query: 587 KLIH--YSTKDILF---DIPDDTPNALIYNGGGQD 616
            LI   +++  ILF   D  D   N  + N  G+D
Sbjct: 565 SLIFKPFTSNRILFNGMDPRDSYENDEMENDCGED 599

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 156/340 (45%), Gaps = 52/340 (15%)

Query: 312 TQNSAPWGLARVSHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362
           TQ+ AP  LAR+S R +L             FN Y Y    GR V +YV+D+GV ++H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 422
           FE RA +G     +    D NGHGTH AG I SK YG            L S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 423 VLKGVEYXXXXXXXXXXXXXXGF------------------KGSTANMSLGGGKSPALDL 464
           V+ G+E+              G                   K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 465 AVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCV 520
           A+   ++ GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSN+G CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 521 DVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLT 580
           D+FAPG+ + S            +GTSMA+P V GL+   L                 + 
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL--------------DSGIK 441

Query: 581 PQQLKKKLIHYSTKDIL----FDIPDDTPNALIYNGGGQD 616
           P Q+KK+L   +T +I           TPN + +NG  +D
Sbjct: 442 PTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 161/316 (50%), Gaps = 40/316 (12%)

Query: 313 QNSAPWGLARVSHR-------ERLNLGSFN-KYLYDDD-AGRGVTSYVIDTGVNVNHKDF 363
           Q  AP  LAR+S R       E +++ + N  Y YDD+ +G  V +YVIDTG+   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 364 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 423
           E RA +G  + + +   D NGHGTH AG I S+ +G            L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 424 LKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 483
           +  +E+                +G  AN+SLG  ++  L+ AV AA+EAG+   VAAGN 
Sbjct: 254 ISAIEFTVNHCRKSR-------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 484 NQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSDEA 539
           N +AC +SPAS+  AITVGA    DDR    A FSN+G CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 540 TATLSGTSMASPHVAGLLTYFL--SLQP-GSDSEFFEMGQDSLTPQQLKKKLIHYSTKDI 596
               SGTSMASP V+G++   L   + P    +E  ++  DS+           +  + +
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLDSGIHPFDIKTELIDLATDSV-----------FHKRTL 412

Query: 597 LFDIPDDTPNALIYNG 612
           LF     TPN + + G
Sbjct: 413 LFK--PGTPNRVAFTG 426

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 135/395 (34%), Positives = 190/395 (48%), Gaps = 72/395 (18%)

Query: 263 GGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFD----------- 311
           G I  +F+  S F G     T+++V  I++NPLV  V  +  + A D+D           
Sbjct: 54  GKISKTFSFGS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 312 ---------------TQNSAPWGLARVSHRERLNLGSFNKYLYDDD---------AGRGV 347
                           QN AP  LAR+S R  L     +K  Y+D           G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 348 TSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXX 406
            +Y+ID+G+++N ++FE RA  G  + L  E   D NGHGTH AG + SK YG       
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHG--LDLTGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 407 XXXXXLRSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAV 466
                L   GSG++  V+  +E+                K   AN+SLG    P L+ A+
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVNHCGKSKS------KKCVANLSLGAFMMPLLNEAI 284

Query: 467 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDV 522
            A V++G+   VAAGN N DAC  SPAS   AITVGA    DDR    A FSN+G CVD+
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDI 341

Query: 523 FAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFEMGQD 577
           FAPG+ I S  I  ++ +   SGTSMASP VAG+++  + L  G ++E      FE+  D
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENEDIRDYLFELATD 399

Query: 578 SLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNG 612
            +     +K+ + +  +         TPN + +NG
Sbjct: 400 DV----FQKRTLLFKPR---------TPNRITFNG 421

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  163 bits (412), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 159/322 (49%), Gaps = 37/322 (11%)

Query: 313 QNSAPWGLARVSHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEK 365
           Q+ AP  LAR   R  L   +       FN Y   +  G  V  Y++D+G++ +H +FE 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 366 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLK 425
           RA++G     N+   D NGHGTH AG + SK YG            +  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 426 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFAVAAGN 482
           GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSG-------KKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 483 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA 541
             + AC  SPA    AITVGA    SD  A FSNYGKCVD+FAPG+ + S          
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 542 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFD-- 599
            L+GTSM++P  AG++   L                 +  + +K++LI  STK +     
Sbjct: 501 VLNGTSMSAPITAGVVAVLL--------------DQGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 600 -IPDDTPNALIYNGGGQDLSAF 620
            +   TP+  ++NG  Q+   F
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  158 bits (399), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 153/319 (47%), Gaps = 38/319 (11%)

Query: 311 DTQNSAPWGLARVSHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 361
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTGV   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 362 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 421
           +F  R  +G    + +   D NGHGTH AG I SK +G            L   G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 422 DVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 481
            VL+G+E+                K    NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMG---KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 482 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIGSD 537
           N N  AC TSPAS++ AITVGA    DDR    A FSN+G+CVD+FAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 538 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDIL 597
           E     SGTSMASP VAGL+   +      D              ++K+KLI  S+K I 
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD--------------EIKQKLIDDSSKSIF 426

Query: 598 FDI----PDDTPNALIYNG 612
             +       TPN +IYNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  158 bits (399), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 157/325 (48%), Gaps = 37/325 (11%)

Query: 310 FDTQNSAPWGLARVSHRERLNLG-------SFNKYLYDDDAGRGVTSYVIDTGVNVNHKD 362
           +  Q  AP  LAR   R  L          +FN Y  ++  G GV  YV+D+G+  +H +
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 363 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 422
           F+ RA +G      +   D NGHGTH AG + S+ +G            +  +G G+ S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 423 VLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFAVA 479
           ++ GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F VA
Sbjct: 544 IIAGVEFAVKHCQQSG-------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 595

Query: 480 AGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDE 538
           AGN  + AC  SPA    AITVGA    SD  A FSNYGKCVD+FAPG+ + S       
Sbjct: 596 AGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPSN 655

Query: 539 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILF 598
               L+GTSM++P  AG++   L                 + P ++K  L+  STK +  
Sbjct: 656 TMRVLNGTSMSAPITAGVVAVLL--------------DQGIEPHEVKDHLLSISTKGLFH 701

Query: 599 D---IPDDTPNALIYNGGGQDLSAF 620
               +   TP+  ++ G  ++  +F
Sbjct: 702 KRRLVSSRTPDRALFTGVKREDDSF 726

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  149 bits (375), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/326 (36%), Positives = 162/326 (49%), Gaps = 46/326 (14%)

Query: 306 EATDFDTQNSAPWGLARVSHRERLNLGSFN--------KYLYDDD-AGRGVTSYVIDTGV 356
           E  DF  Q +AP  LAR+S R  L     N         Y YDD   G  V +YVIDTG+
Sbjct: 126 EFPDFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGI 185

Query: 357 NVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNG 416
              H+ F+ RA +G  + + +   D NGHGTH AG I S+ YG            L + G
Sbjct: 186 FKEHRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKG 244

Query: 417 SGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHF 476
            G ++ V+  +E+                +G  AN+SLG  ++  L+ AV AA+EAG+  
Sbjct: 245 QGNLTSVISAIEFTVNHCRKSK-------RGCVANLSLGSFRNSVLNQAVEAALEAGVVV 297

Query: 477 AVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILST 532
            VAAGN N +AC +SPAS+  AI+VGA    DDR    A FSN+G CVD+FAPG+ I S 
Sbjct: 298 VVAAGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASL 354

Query: 533 YIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYS 592
                  +   SGTSMASP V G++   L                 + P  +K++LI+ +
Sbjct: 355 SNIPPFKSVAYSGTSMASPLVTGMVAVLL--------------DSGIHPFDIKEELINTA 400

Query: 593 T------KDILFDIPDDTPNALIYNG 612
           T      + +LF     TPN + + G
Sbjct: 401 TDSVFHKRALLFK--PGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 162/321 (50%), Gaps = 36/321 (11%)

Query: 309 DFDTQNSAPWGLARVSHRERLNL------GSFNKYLYDDD-AGRGVTSYVIDTGVNVNHK 361
           DF +Q+ AP  LAR+S R +L +       S  KY Y ++  G GV  YV+D+GVN +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 362 DFEKRAIWG-KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 420
           DFE RA+ G  T      DL   GHGTH AG I SK YG            L S G GT+
Sbjct: 210 DFEGRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 421 SDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG-GKSPALDLAVNAAVEAGIHFAVA 479
           +++++G+EY                +    NMSLG  G    LD AV+A +E G+   VA
Sbjct: 268 TNIIEGLEYVVNQCIGKK-------RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 480 AGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNYGKCVDVFAPGLNILSTYIG 535
            GN   +AC  SPA   KAITV A    DDR    A FSN+G C+D++APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 536 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKD 595
               T  LSGTSMASP VAG    +L  Q    +E  ++   + T    KK+ I    + 
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYLD-QGADPAEVRKILSKTATRGVFKKRAIAVRPR- 434

Query: 596 ILFDIPDDTPNALIYNGGGQD 616
                   TPN ++Y G  Q+
Sbjct: 435 --------TPNKVLYTGNNQE 447

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  128 bits (321), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 154/310 (49%), Gaps = 17/310 (5%)

Query: 260 SEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWG 319
           S+ GG+  + ++ + F    G F Q +++ +  +  +  +  D ++   ++  Q  AP  
Sbjct: 41  SDNGGV-GAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAH 99

Query: 320 LARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED 379
           LAR+S +  L  GS   Y+Y  + G GV  Y++DTG++  H + E R    K   L    
Sbjct: 100 LARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRV--QKIADLTSNP 156

Query: 380 L---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXXXXXXX 436
           +   D +GHGT  AG I S  +G              S G+ T+  V++ +E+       
Sbjct: 157 VSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASV 216

Query: 437 XXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-EAGIHFAVAAGNENQDACNTSPASA 495
                    + S   +     K+  L+ A+ A + +  +   VA GN NQ+AC++SPASA
Sbjct: 217 TQ-------RPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASA 269

Query: 496 DKAITVGA--STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 553
             A+T+G+   T  D  A F+NYG C+D FA G+NI S   G  E+    SGTS+++   
Sbjct: 270 YGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIA 329

Query: 554 AGLLTYFLSL 563
           +G++ Y++SL
Sbjct: 330 SGVVAYYMSL 339

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  119 bits (299), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/312 (30%), Positives = 152/312 (48%), Gaps = 24/312 (7%)

Query: 267 DSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSH- 325
           D   I S F G+ G F  E++  +  +P V  +  D ++   ++  QN AP  LAR+S+ 
Sbjct: 53  DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNG 112

Query: 326 --RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL--- 380
               R++  + N +++   AG GV  Y++D+G++  H  F  R I  K I L D  +   
Sbjct: 113 VSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVG 171

Query: 381 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGT-MSDVLKGVEYXXXXXXXXXX 439
           D +GHGT  AG + S  +G            + +  +G  +S +LK +E+          
Sbjct: 172 DPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRAT-- 229

Query: 440 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 499
                 + S A +     K+  L+ A+  ++   I   V AGN++  ACN SPASA  + 
Sbjct: 230 -----MRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQ 283

Query: 500 TVGASTLSDDR-----AYFSNYGKCVDVFAPGLNI--LSTYIGSDE-ATATLSGTSMASP 551
           ++ +    D R     A FSNYG+CVDVF  G+ +  L     SDE   + +SGTSM+  
Sbjct: 284 SILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCA 343

Query: 552 HVAGLLTYFLSL 563
             AG + Y++SL
Sbjct: 344 IAAGTVGYYMSL 355

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 122/258 (47%), Gaps = 13/258 (5%)

Query: 310 FDTQNSAPWGLARVSHRERLNLGS---FNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKR 366
           + TQ +AP  L+R S   +L   S   +N Y   D  G  VT YV+D+G+ ++H +FE R
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 367 AIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLK 425
            +  +     D  + D  GHGT  AG I SK YG            L + G G +  +L+
Sbjct: 202 IL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 426 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 485
           G+++                     N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFITKHCEENTNG------NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 486 DACNTSPASADKAITVGASTLSDDR-AYFSNYGKCVDVFAPGLNILSTYIGSDEATATLS 544
           +AC  +PA +    TVG+    DD  A FSN+G+CVD+ APG+ + +    + + +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 545 GTSMASPHVAGLLTYFLS 562
           GTS+++P V GL    LS
Sbjct: 374 GTSVSTPIVTGLAAILLS 391

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  118 bits (295), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 160/316 (50%), Gaps = 21/316 (6%)

Query: 258 SSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAP 317
           +++ AGG   +  + + F    G F Q++++   ++  +  +  D  +   ++  Q  AP
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 318 WGLARVSHRERLNLGSFN---KYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIP 374
             LAR+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  FE R    K   
Sbjct: 98  NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRV--QKAAD 155

Query: 375 LNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVEYXX 431
            + + +   D +GHGT  AG I S  +G              S G  ++  VL+ +E+  
Sbjct: 156 FSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHAS 215

Query: 432 XXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-EAGIHFAVAAGNENQDACNT 490
                         + S   + L   ++  L+ AV A V +  I   VAAGNEN+ AC+ 
Sbjct: 216 KLAAVTK-------RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSV 268

Query: 491 SPASADKAITVGASTLS--DDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATA-TLSGTS 547
           SPA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   LSGTS
Sbjct: 269 SPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTS 326

Query: 548 MASPHVAGLLTYFLSL 563
           +++   +GL+ Y++S+
Sbjct: 327 ISAGVASGLVAYYMSI 342

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 148/326 (45%), Gaps = 31/326 (9%)

Query: 256 ALSSSEAGG-IQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQN 314
           ALSS + G  I D F + S F  + G F+  I+  +  +P V  + +D  ++  +   QN
Sbjct: 35  ALSSDQQGPEITDIFELGS-FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQN 93

Query: 315 SAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIW----- 369
           +AP  L  +S    L   S   ++Y  + G GV  Y++DTG+++ H +  K  I      
Sbjct: 94  NAPSHLVGLSSISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADL 150

Query: 370 -GKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVLKGVE 428
               +P   +  D  GHGT  AG IAS+ +G              SNG   +S +L+ + 
Sbjct: 151 TQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALT 207

Query: 429 YXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 488
                                  + +  G +P L  A+ A+ +  +   + AGN  QDA 
Sbjct: 208 LTQRHIEGTKRPSVVVIP-----LEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDAL 261

Query: 489 NTSPASAD----KAITVGASTLSDDRAYFSNYGKCVDVFAPGLNI-------LSTYIGSD 537
           N SPA+ +      I VG+  ++++   F+NYG  VDVF  G  I       L +   S+
Sbjct: 262 NFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSN 321

Query: 538 EATATLSGTSMASPHVAGLLTYFLSL 563
             T  +SGTS +S   AG++ Y++SL
Sbjct: 322 SLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 91/356 (25%), Positives = 156/356 (43%), Gaps = 35/356 (9%)

Query: 226 FHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQE 285
           F      Q  +Q VEN       F+   D  +  S    I+    I + F  + G  ++E
Sbjct: 16  FDNVICTQYIIQLVENTQVNA--FLKKHDIDVMDSNILPIE----IGNSFIAFSGDLSKE 69

Query: 286 IVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSF----NKYLYDD 341
            V  + ++     +  +  +E   +  Q  AP  L R++ ++ +    +    N+Y++ D
Sbjct: 70  QVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSD 128

Query: 342 DAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDL---DGNGHGTHCAGTIASKHY 398
            +G GV  Y++DTG+++ H  + +  I  K I L    +   D NGHGT  AG I S  +
Sbjct: 129 TSGNGVDIYIVDTGIDIQHPIYLQNNIH-KLIDLTTSPIPSGDFNGHGTAMAGIINSDPF 187

Query: 399 GXXXXXXXXXXXXLRSNGS-GTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGG 457
           G            + +N    TMS VL  +                  + S   +     
Sbjct: 188 GVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHEQKT-------MRPSIIVLPFQTE 240

Query: 458 KSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK---AITVGASTLSDDRAY-- 512
           K+  L+ A+   +   I   + AGN++Q+AC  SP    K    + VG+   S+++ Y  
Sbjct: 241 KNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLD 299

Query: 513 ---FSNYGKCVDVFAPGLNILSTYIGSD---EATATLSGTSMASPHVAGLLTYFLS 562
              FSNYG CVD++  G++I +    S+   E    ++GTS +   VAG++ Y++S
Sbjct: 300 IAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 145/334 (43%), Gaps = 27/334 (8%)

Query: 239 VENLAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDF 298
           V  LA++ +    +RD + S        +   +   F    G F+ E ++ +  +  V  
Sbjct: 17  VVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGDQFKALAGEFSVEDLEYLYHDERVVA 76

Query: 299 VEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 358
           + +D  ++  ++  Q  +P  L+++S       GSF    +D  +G  V  YV DTG++ 
Sbjct: 77  ISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT---FDPVSGNLVDVYVFDTGIDF 128

Query: 359 NHKDFE-----KRAIWGKT-IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 412
            H   +     K A +  + +P      D +GHGT  AG IAS+ +G             
Sbjct: 129 KHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVA 185

Query: 413 RSNGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA 472
             +G   +S ++KG+                  + S   + +  GK   +      A+  
Sbjct: 186 DKDGEVKLSTLMKGISASVAHARFTK-------RPSVFVLPMTIGKKNHILDNFLQAIPK 238

Query: 473 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL-- 530
            I   + AGN+  DAC+ SP +    + +G+    +  A FSNYG CVDV+  G +IL  
Sbjct: 239 DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYTSGTDILTL 298

Query: 531 -STYIGSDEATATLSGTSMASPHVAGLLTYFLSL 563
            ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 299 RSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 118/280 (42%), Gaps = 30/280 (10%)

Query: 299 VEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 358
           +  D  +E  +   Q  AP  L ++   E  +    N+++YD  AG GV  Y+ DTG+  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 359 NHKDFEKRAIWGKT----IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 414
           N        I         P+ D+++    HGT  +G I S  +G               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNVGDE 196

Query: 415 NGSGTMSDVLKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 474
           NG   MS VLKG+                  + S  N S    K+  L+ A +      +
Sbjct: 197 NGKVFMSKVLKGLNLVQQHVKHTN-------RPSVINFSYCTLKNAILNSAFD-NFPRDV 248

Query: 475 HFAVAAGNENQDACNTSPASADK---AITVGASTLSDD---RAYFSNYGKCVDVFAPGLN 528
             AVAAGN  Q  C+ SP    +    +  G+  ++DD    + FSNYG CV  +APG  
Sbjct: 249 PIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEG 308

Query: 529 ILSTYI------GSDEATATLSGTSMASPHVAGLLTYFLS 562
           +L+  I       S +    +SGTS +S   AG++ Y+++
Sbjct: 309 LLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 336 KYLYDDDAGRGVTSYVIDTGV---NVNHKD-FEKRAIW--GKTIPLNDEDLDGNGHGTHC 389
           +  Y++  G G+ + ++D GV   N N KD F +   W      PL    L  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 390 AGTIAS 395
           AG IA+
Sbjct: 243 AGEIAA 248

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 392
           Y++  G GV + ++D G++  ++D    F     W      PL    L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 393 IAS 395
           IA+
Sbjct: 245 IAA 247

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 529 ILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKL 588
           +L  Y   D +      +S  S      L+Y+ +L+PG  ++F+++ Q SL P +   KL
Sbjct: 24  LLMVYYSVDLSVPVQHSSSDRSNSCDRCLSYYETLEPGWSNDFYDVNQKSLAPAEDVIKL 83

Query: 589 IHYSTKDILF 598
           +   T+ I+F
Sbjct: 84  V---TRIIIF 90

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 392
           Y++  G GV + ++D G++   +D    F K   W       L    LD + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 393 IAS 395
           IA+
Sbjct: 214 IAA 216

>NDAI0E01630 Chr5 complement(324500..325870) [1371 bp, 456 aa] {ON}
           Anc_8.608 YOR197W
          Length = 456

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 51/115 (44%), Gaps = 5/115 (4%)

Query: 207 IPNRYIIVFKKDVPPEEA-AFHRETVQ-QAQLQSVENLAAEDAFFISTRDAALSSSEAGG 264
           +P+ Y+       PP++  +FH    Q Q   Q  +      A  I       S++  G 
Sbjct: 120 VPSNYVQPQNISRPPQQPQSFHLNNQQTQPSFQYSQCTGKRKALIIGINYIGSSNALRGC 179

Query: 265 IQDSFNIDSLFSGYIGYFTQEIVDLI--RQNPLVDFVEKDSVVEATDFDTQNSAP 317
           I D+ NI +  S   GY  Q+IV L   +Q+P V    K +++ A  +  +++ P
Sbjct: 180 INDAHNIFNFLSQRYGYSPQDIVILTDDQQDP-VRQPTKANIIRAMQWLVRDAQP 233

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 336 KYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHC 389
           K  Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 390 AGTIASK 396
           AG IA+K
Sbjct: 218 AGEIAAK 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 392
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 393 IASK 396
           IA+K
Sbjct: 221 IAAK 224

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 343 AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGTIAS 395
            G+ VT  ++D GV+  ++D + +  +  +   ND        L  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 343 AGRGVTSYVIDTGVNVNHKD----FEKRAIW----GKTIPLNDEDLDGNGHGTHCAGTIA 394
            G+GV + +ID GV+    D    F K   W     + +P+    L  + HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIA 226

Query: 395 S 395
           +
Sbjct: 227 A 227

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 392
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 393 IASK 396
           IA+K
Sbjct: 221 IAAK 224

>Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar to
            Ashbya gossypii AER067C
          Length = 1274

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 604  TPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKT-DLIFEQVRDVLDKLN 662
            TP A I NG  +   AF+  T K  + +   +ELN++++I  K    + EQ + V D LN
Sbjct: 976  TPLANIINGDPEAKEAFYKKTLKLTAKAHTLRELNIEKYINLKIQQYLMEQRKTVHDFLN 1035

Query: 663  I 663
            +
Sbjct: 1036 L 1036

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 392
           Y +  G+GV + V+D G++  + D    F K   W       L    L  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 393 IAS 395
           IA+
Sbjct: 212 IAA 214

>Kwal_56.23320 s56 complement(491440..493254) [1815 bp, 604 aa] {ON}
           YLR286C (CTS1) - Endochitinase [contig 181] FULL
          Length = 604

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 302 DSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLY 339
           D+VV+  DFD ++S P G A ++ R R N  S +K  Y
Sbjct: 143 DAVVDGFDFDIEDSQPEGYAALAKRLRKNFDSASKEYY 180

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 339 YDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 392
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 393 IASK 396
           IA+K
Sbjct: 221 IAAK 224

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 340 DDDAGRGVTSYVIDTGVNVNH-KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKH 397
           D+++     S ++ +GVNV+H K+F +   + K +PL  +D + N H T+  G + S +
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTKEFHR--FFNKDLPLGSDDDEFNEHDTNADGDLRSDY 746

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,625,581
Number of extensions: 2501587
Number of successful extensions: 5173
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5093
Number of HSP's successfully gapped: 87
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)