Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.66.16ON99999944180.0
Skud_5.286.16ON998100140320.0
YEL061C (CIN8)6.16ON1000100040050.0
Smik_5.266.16ON1002100239860.0
TDEL0G045306.16ON95893923290.0
ZYRO0C07898g6.16ON97493922650.0
NCAS0H008806.16ON100490921920.0
CAGL0B03641g6.16ON98893621280.0
NDAI0D008706.16ON106963715390.0
Kpol_1032.66.16ON100470215270.0
SAKL0E01078g6.16ON94869415200.0
KLLA0D01045g6.16ON96567614930.0
KAFR0L003706.16ON96368014840.0
Kwal_56.224036.16ON94367614290.0
KNAG0M011306.16ON95055713701e-173
TBLA0A072306.16ON109758613801e-173
TPHA0M002406.16ON93968413551e-171
KLTH0C11330g6.16ON94167813411e-169
Ecym_30206.16ON94464213391e-168
ACR010C6.16ON94563913151e-165
Kpol_1045.736.16ON96271011801e-145
TPHA0J003006.16ON98295511801e-145
Skud_2.417.387ON11107037276e-80
Smik_2.537.387ON11137367181e-78
Suva_2.547.387ON11106147126e-78
YBL063W (KIP1)7.387ON11116036993e-76
ACR228C7.387ON11297126731e-72
TPHA0E008907.387ON12326306741e-72
Ecym_46887.387ON11345956552e-70
NCAS0E026407.387ON11025936402e-68
NDAI0E043007.387ON11867106394e-68
SAKL0F12298g7.387ON11127326358e-68
ZYRO0B03234g7.387ON11385816304e-67
KAFR0L017107.387ON11516446252e-66
TDEL0C016007.387ON11056826135e-65
TBLA0D006407.387ON11427315763e-60
Kwal_56.22407singletonOFF1081083576e-39
SAKL0G18920g2.633ON6493493771e-36
KLTH0G03850g5.531ON4732243541e-34
Kwal_47.186085.531ON4791753433e-33
KLLA0B00759g5.531ON4562383414e-33
SAKL0G05016g5.531ON5041753364e-32
ADR145C2.633ON6353803404e-32
NDAI0I029603.528ON8684903292e-30
Ecym_34152.633ON6621823228e-30
SAKL0F01760g3.528ON8094353221e-29
TPHA0D034803.528ON8475993185e-29
Skud_7.533.528ON8055533176e-29
Smik_7.483.528ON8055253132e-28
Suva_7.443.528ON8054473113e-28
YGL216W (KIP3)3.528ON8054553104e-28
CAGL0I07029g3.528ON7051803077e-28
Kpol_423.83.528ON8065813087e-28
KAFR0F042103.528ON6721783068e-28
TDEL0D059603.528ON7333943051e-27
Ecym_40665.531ON4781722982e-27
KNAG0B005203.528ON7231793032e-27
TBLA0C049603.528ON8012473033e-27
TBLA0C039403.479ON7391823023e-27
NCAS0E005503.528ON7844333006e-27
ZYRO0E08668g3.528ON7782442998e-27
Kwal_47.190933.528ON8191792981e-26
KLLA0A01606g3.528ON7691822962e-26
KLTH0G01606g3.528ON8191792953e-26
CAGL0D04994g3.479ON6921662908e-26
ZYRO0D12650g5.531ON4782112841e-25
TDEL0A062408.678ON6373762881e-25
Kpol_1004.255.531ON5062222822e-25
TPHA0D032003.479ON7241672863e-25
KAFR0B065903.479ON7061752853e-25
KAFR0H024108.678ON6583952835e-25
Kpol_1050.1033.479ON6971512835e-25
KNAG0A078803.479ON7641422837e-25
AER441C3.528ON8184092837e-25
NCAS0F034703.479ON6981762811e-24
Ecym_12003.528ON8331782821e-24
AGR253W3.479ON7091722773e-24
NCAS0C013508.678ON6551832738e-24
NDAI0B057703.479ON7631562748e-24
TDEL0F036403.479ON7041732739e-24
ZYRO0B04290g3.479ON7311732731e-23
SAKL0F03168g3.479ON7061742721e-23
KLLA0D05951g8.678ON6682502711e-23
Kpol_1013.78.678ON6202122683e-23
Kwal_26.88068.678ON7153582693e-23
Ecym_44073.479ON7111662684e-23
ZYRO0F07414g8.678ON6542282674e-23
TBLA0C053103.479ON6761812674e-23
YPR141C (KAR3)3.479ON7291482659e-23
Kpol_505.393.479ON6921502641e-22
SAKL0H06490g8.678ON6572512631e-22
Skud_16.4353.479ON7291482632e-22
Smik_16.3883.479ON7291482632e-22
Suva_16.4693.479ON7311482632e-22
KLTH0F14498g3.479ON7021742603e-22
KLLA0B10956g3.479ON6901632561e-21
NDAI0E02090singletonON6851962532e-21
CAGL0M02189g8.678ON6721942497e-21
TDEL0B072702.633ON6444172471e-20
TPHA0D012708.678ON6962192462e-20
Ecym_23958.678ON6872112443e-20
ACR145W8.678ON6852092425e-20
KLTH0D11286g8.678ON6781882416e-20
YPL155C (KIP2)8.678ON7062002353e-19
Kpol_1019.112.633ON6473752327e-19
Skud_16.1278.678ON7062002311e-18
Suva_16.1558.678ON7042002292e-18
Smik_6.3528.678ON7152062292e-18
KNAG0J017208.678ON6251842221e-17
TPHA0D041903.479ON6721612183e-17
TBLA0C018808.678ON4681502129e-17
TPHA0N016502.633ON6823432061e-15
TBLA0A008202.633ON8034691934e-14
Skud_11.1482.633ON6563751891e-13
NCAS0H031802.633ON6603591891e-13
Smik_11.1602.633ON6563751881e-13
YKL079W (SMY1)2.633ON6563291872e-13
TPHA0H016805.414ON9894511872e-13
Suva_11.1452.633ON6571681773e-12
Kwal_55.21164singletonOFF5881641746e-12
Kwal_YGOB_55.211643.479ON6571641746e-12
Kwal_56.22402singletonOFF93481452e-10
NDAI0C004802.633ON5983951541e-09
YLR309C (IMH1)4.46ON9116111542e-09
CAGL0L05104g2.633ON6754051513e-09
Kpol_483.114.238ON25467241524e-09
Kpol_1065.363.330ON12193351506e-09
Kpol_1043.705.702ON13216161443e-08
NDAI0D044204.238ON19146201434e-08
CAGL0D00924g4.238ON19805581434e-08
Skud_9.195.702ON16805051417e-08
TPHA0B008304.238ON25366221417e-08
TPHA0D017505.296ON8815151408e-08
ZYRO0E01078g2.633ON6681121372e-07
Suva_4.1914.238ON17825501382e-07
TBLA0C008002.633ON6931301372e-07
NDAI0B055205.414ON10094611372e-07
Ecym_83744.46ON9145211344e-07
KNAG0M025402.633ON5221081334e-07
TBLA0H012408.331ON17953371345e-07
SAKL0H03300g4.238ON17075161328e-07
KLLA0E05281g4.238ON17554181328e-07
CAGL0G02497g5.702ON17806161301e-06
TDEL0A058208.636ON4763291282e-06
NDAI0D029304.46ON9605161282e-06
NCAS0A024504.238ON19286011282e-06
YDR285W (ZIP1)5.296ON8754951273e-06
Suva_2.5285.414ON9445961273e-06
NCAS0A032005.702ON17887361273e-06
CAGL0H01144g5.296ON8205021264e-06
NCAS0F032205.414ON9625971264e-06
Suva_11.3315.702ON18983981255e-06
TBLA0B051606.188ON6523891246e-06
KAFR0D013307.101ON10803241247e-06
KLLA0C02915g1.110ON12964251247e-06
YKR095W (MLP1)5.702ON18754721247e-06
TPHA0F032208.636ON4783381228e-06
Skud_4.1964.238ON17924111239e-06
TBLA0E017305.702ON18206611239e-06
TBLA0A104705.267ON19993711239e-06
TBLA0B099704.46ON10655371221e-05
ZYRO0B12144g4.238ON20056391221e-05
TPHA0H029807.21ON8074471211e-05
YNL225C (CNM67)2.16ON5812831202e-05
YNL250W (RAD50)1.110ON13125551202e-05
NCAS0G002305.702ON17353221202e-05
CAGL0L02695g8.636ON4593071182e-05
SAKL0H24200g4.46ON9635361183e-05
Kpol_1063.77.204ON5921661174e-05
Kpol_1051.255.267ON19683891175e-05
KAFR0F030204.46ON8244611165e-05
TBLA0G031503.149ON5112841156e-05
Suva_14.921.110ON13126041166e-05
YDR356W (SPC110)5.414ON9445091157e-05
TPHA0D046105.702ON11834021158e-05
Skud_14.881.110ON13165451158e-05
NCAS0A067605.267ON18764661158e-05
TPHA0B042101.110ON13033751141e-04
Ecym_82315.267ON18544221141e-04
TBLA0I01170singletonON22392981141e-04
Skud_9.245.696ON6903891131e-04
KLLA0C10879g5.296ON7556161131e-04
Smik_4.4108.357ON9882701131e-04
KNAG0F006501.110ON13064161131e-04
KNAG0L021405.702ON16085711131e-04
NCAS0B036308.331ON24472691131e-04
Skud_10.3574.364ON7055081122e-04
Kpol_1055.275.296ON8295491122e-04
Suva_8.2698.636ON4852421112e-04
KAFR0C040202.633ON667911112e-04
ABL193C2.16ON8625151112e-04
AER045C4.238ON12923121112e-04
KAFR0J023606.289ON4974351093e-04
Smik_11.3585.702ON18783011103e-04
TPHA0E023205.267ON19154511094e-04
KNAG0H003602.633ON6811251084e-04
Skud_16.1068.704ON8712751085e-04
CAGL0A02596g5.414ON8722991085e-04
KNAG0C050605.414ON10405591085e-04
SAKL0H17094g8.259ON14223791085e-04
KAFR0E043404.364ON6163981076e-04
TBLA0A056201.99ON7963631076e-04
TPHA0A011508.604ON8183831076e-04
TPHA0E036801.46ON4381991066e-04
NDAI0G058701.334ON4632821066e-04
TDEL0E013304.238ON16574481077e-04
Smik_15.4578.726ON6582861068e-04
Skud_4.4248.357ON9722471068e-04
CAGL0D05258g7.186ON11702541069e-04
TBLA0B018102.199ON15041631060.001
TBLA0C010202.666ON6233651050.001
KLTH0D14784g4.268ON6633351050.001
NCAS0J022004.364ON7073881050.001
KLLA0A03509g7.21ON7764081050.001
CAGL0I10901g8.604ON8163341050.001
KLTH0D14102g4.238ON17126751050.001
KLLA0A00594g5.702ON17483161050.001
Kwal_23.55345.267ON19074611050.001
NCAS0C052002.633ON5723411040.001
Kwal_55.197335.696ON6762431040.001
ADL037W4.46ON8873051040.001
KAFR0E040105.414ON9054011040.001
Suva_15.3575.88ON11724101040.002
NDAI0F040001.110ON13053421040.002
TBLA0F027507.488ON14143171040.002
Smik_4.1764.238ON17956541040.002
KAFR0C022506.209ON6133491030.002
NDAI0G05680singletonON6263891030.002
Smik_9.255.696ON6923891030.002
TBLA0A102505.296ON9505831030.002
TBLA0A036205.414ON9703941030.002
TBLA0C056701.162ON6274211020.002
NDAI0B013802.591ON7094531020.002
KNAG0A022808.484ON8603091020.002
Smik_4.5345.296ON8763091020.002
Kpol_1059.308.636ON4572151010.003
Smik_10.4274.364ON7064971010.003
Kpol_269.28.443ON8653171010.003
Suva_2.4515.296ON8775501010.003
Kpol_1031.155.414ON9294951010.003
TBLA0D004507.413ON10056411010.003
CAGL0H08558g3.330ON11103171010.003
Suva_10.1708.259ON14161371010.004
NDAI0H025907.68ON14824321010.004
Ecym_32504.268ON6832631000.004
NDAI0C058808.604ON8462981000.004
YLR166C (SEC10)8.384ON8713261000.004
Skud_4.5485.296ON8772411000.004
ZYRO0F15378g2.16ON9284571000.004
NCAS0A007701.110ON13043421000.005
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Suva_5.6
         (3000 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1706   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1557   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1547   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1540   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   901   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   877   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   848   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   824   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   597   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   592   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   590   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   579   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   576   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   555   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   532   e-173
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   536   e-173
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   526   e-171
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   521   e-169
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   520   e-168
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   511   e-165
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   459   e-145
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   459   e-145
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   284   6e-80
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   281   1e-78
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   278   6e-78
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   273   3e-76
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   263   1e-72
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   264   1e-72
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   256   2e-70
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   251   2e-68
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   250   4e-68
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   249   8e-68
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   247   4e-67
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   245   2e-66
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   240   5e-65
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   226   3e-60
Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {O...   142   6e-39
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   149   1e-36
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   1e-34
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   136   3e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   135   4e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   134   4e-32
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   135   4e-32
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   131   2e-30
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   128   8e-30
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   128   1e-29
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   127   5e-29
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   126   6e-29
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   125   2e-28
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   124   3e-28
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   124   4e-28
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   122   7e-28
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   123   7e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   122   8e-28
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   122   1e-27
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   119   2e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   121   2e-27
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   121   3e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   3e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   120   6e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   8e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   119   1e-26
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   118   2e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   118   3e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   116   8e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   1e-25
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   115   1e-25
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   113   2e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   114   3e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   114   3e-25
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   113   5e-25
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   113   5e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   113   7e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   113   7e-25
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   112   1e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   113   1e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   111   3e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   109   8e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   110   8e-24
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   109   9e-24
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   109   1e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   109   1e-23
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   108   1e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   3e-23
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   108   3e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   107   4e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   107   4e-23
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   107   4e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   106   9e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   106   1e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   105   1e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   105   2e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   105   2e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   105   2e-22
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   104   3e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   1e-21
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   102   2e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   100   7e-21
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   100   1e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    99   2e-20
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    99   3e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    98   5e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    97   6e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    95   3e-19
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    94   7e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    94   1e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    93   2e-18
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    93   2e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    90   1e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    89   3e-17
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    86   9e-17
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    84   1e-15
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    79   4e-14
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    77   1e-13
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     77   1e-13
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    77   1e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    77   2e-13
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    77   2e-13
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    73   3e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    72   6e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    72   6e-12
Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OF...    60   2e-10
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    64   1e-09
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    64   2e-09
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    63   3e-09
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    63   4e-09
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    62   6e-09
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    60   3e-08
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    60   4e-08
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    60   4e-08
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    59   7e-08
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    59   7e-08
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    59   8e-08
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    57   2e-07
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    58   2e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    57   2e-07
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    57   2e-07
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    56   4e-07
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    56   4e-07
TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {...    56   5e-07
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    55   8e-07
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    55   8e-07
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    55   1e-06
TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] ...    54   2e-06
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    54   2e-06
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    54   2e-06
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    54   3e-06
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    54   3e-06
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    54   3e-06
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    53   4e-06
NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.4...    53   4e-06
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...    53   5e-06
TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] ...    52   6e-06
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    52   7e-06
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    52   7e-06
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    52   7e-06
TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {O...    52   8e-06
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    52   9e-06
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    52   9e-06
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    52   9e-06
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    52   1e-05
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    52   1e-05
TPHA0H02980 Chr8 (712882..715305) [2424 bp, 807 aa] {ON} Anc_7.2...    51   1e-05
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    51   2e-05
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    51   2e-05
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    51   2e-05
CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} simil...    50   2e-05
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    50   3e-05
Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON} (19685.....    50   4e-05
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...    50   5e-05
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    49   5e-05
TBLA0G03150 Chr7 (832779..834314) [1536 bp, 511 aa] {ON} Anc_3.1...    49   6e-05
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    49   6e-05
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    49   7e-05
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    49   8e-05
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    49   8e-05
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    49   8e-05
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    49   1e-04
Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON...    49   1e-04
TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON}              49   1e-04
Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)    48   1e-04
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    48   1e-04
Smik_4.410 Chr4 complement(744262..747228) [2967 bp, 988 aa] {ON...    48   1e-04
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    48   1e-04
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    48   1e-04
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    48   1e-04
Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {...    48   2e-04
Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON} (70806....    48   2e-04
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    47   2e-04
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    47   2e-04
ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syn...    47   2e-04
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    47   2e-04
KAFR0J02360 Chr10 (448781..450274) [1494 bp, 497 aa] {ON} Anc_6....    47   3e-04
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    47   3e-04
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    47   4e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    46   4e-04
Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {...    46   5e-04
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    46   5e-04
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    46   5e-04
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    46   5e-04
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    46   6e-04
TBLA0A05620 Chr1 complement(1394838..1397228) [2391 bp, 796 aa] ...    46   6e-04
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    46   6e-04
TPHA0E03680 Chr5 (779557..780873) [1317 bp, 438 aa] {ON} Anc_1.4...    45   6e-04
NDAI0G05870 Chr7 (1456354..1457745) [1392 bp, 463 aa] {ON} Anc_1...    45   6e-04
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    46   7e-04
Smik_15.457 Chr15 complement(788706..790682) [1977 bp, 658 aa] {...    45   8e-04
Skud_4.424 Chr4 complement(755616..758534) [2919 bp, 972 aa] {ON...    45   8e-04
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    45   9e-04
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    45   0.001
TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {O...    45   0.001
KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} simi...    45   0.001
NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {...    45   0.001
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    45   0.001
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    45   0.001
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    45   0.001
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    45   0.001
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    45   0.001
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    45   0.001
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    45   0.001
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    45   0.001
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    45   0.001
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    45   0.002
NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {...    45   0.002
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    45   0.002
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    45   0.002
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    44   0.002
NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] ...    44   0.002
Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)    44   0.002
TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5...    44   0.002
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    44   0.002
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    44   0.002
NDAI0B01380 Chr2 complement(318357..320486) [2130 bp, 709 aa] {O...    44   0.002
KNAG0A02280 Chr1 complement(208088..210670) [2583 bp, 860 aa] {O...    44   0.002
Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W ...    44   0.002
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    44   0.003
Smik_10.427 Chr10 complement(662836..664956) [2121 bp, 706 aa] {...    44   0.003
Kpol_269.2 s269 (2702..5299) [2598 bp, 865 aa] {ON} (2702..5299)...    44   0.003
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    44   0.003
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    44   0.003
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    44   0.003
CAGL0H08558g Chr8 (837576..840908) [3333 bp, 1110 aa] {ON} simil...    44   0.003
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...    44   0.004
NDAI0H02590 Chr8 (635376..639824) [4449 bp, 1482 aa] {ON}              44   0.004
Ecym_3250 Chr3 complement(473064..475115) [2052 bp, 683 aa] {ON}...    43   0.004
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    43   0.004
YLR166C Chr12 complement(495429..498044) [2616 bp, 871 aa] {ON} ...    43   0.004
Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W ...    43   0.004
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    43   0.004
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    43   0.005
YDR460W Chr4 (1383811..1384776) [966 bp, 321 aa] {ON}  TFB3Subun...    42   0.005
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    43   0.005
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    43   0.005
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    43   0.005
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    43   0.005
KLLA0C10967g Chr3 (943312..944514) [1203 bp, 400 aa] {ON} simila...    42   0.005
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    43   0.006
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    43   0.006
NDAI0A02600 Chr1 complement(580677..584039) [3363 bp, 1120 aa] {...    43   0.006
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    43   0.006
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    43   0.006
Smik_4.738 Chr4 (1305057..1306022) [966 bp, 321 aa] {ON} YDR460W...    42   0.006
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    43   0.006
Smik_13.427 Chr13 (691248..696173) [4926 bp, 1641 aa] {ON} YMR21...    43   0.006
TBLA0A04410 Chr1 complement(1085213..1087411) [2199 bp, 732 aa] ...    42   0.007
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    42   0.007
TBLA0D02880 Chr4 complement(710009..713326) [3318 bp, 1105 aa] {...    42   0.008
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    42   0.008
Kpol_269.8 s269 (14433..15854) [1422 bp, 473 aa] {ON} (14433..15...    42   0.008
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)    42   0.008
Kpol_1023.62 s1023 complement(138899..143422) [4524 bp, 1507 aa]...    42   0.008
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    42   0.008
TPHA0J02580 Chr10 (572213..574462) [2250 bp, 749 aa] {ON} Anc_6....    42   0.009
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    42   0.009
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    42   0.010
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    42   0.010
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    42   0.010
TPHA0F00360 Chr6 (80013..83468) [3456 bp, 1151 aa] {ON} Anc_4.39...    42   0.010
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    42   0.010
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    42   0.010
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    42   0.010
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    42   0.010
NDAI0C00550 Chr3 complement(100689..101738) [1050 bp, 349 aa] {O...    41   0.011
TBLA0C04260 Chr3 complement(1023407..1026055) [2649 bp, 882 aa] ...    42   0.013
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    41   0.016
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    41   0.017
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    41   0.018
TDEL0C05910 Chr3 complement(1063668..1067585) [3918 bp, 1305 aa]...    41   0.018
TBLA0A05960 Chr1 (1469108..1470688) [1581 bp, 526 aa] {ON}             41   0.019
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    41   0.019
KLTH0F01452g Chr6 complement(109643..110863) [1221 bp, 406 aa] {...    40   0.022
CAGL0I05412g Chr9 (512839..515919) [3081 bp, 1026 aa] {ON} simil...    41   0.022
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}              41   0.023
NDAI0H02440 Chr8 (591740..592633) [894 bp, 297 aa] {ON} Anc_7.92...    40   0.023
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    41   0.024
TBLA0B04530 Chr2 (1042985..1050010) [7026 bp, 2341 aa] {ON} Anc_...    41   0.024
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    40   0.027
Ecym_2368 Chr2 (715575..717851) [2277 bp, 758 aa] {ON} similar t...    40   0.027
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    40   0.028
TPHA0C04540 Chr3 (977635..980451) [2817 bp, 938 aa] {ON}               40   0.029
NCAS0E00730 Chr5 complement(132088..135330) [3243 bp, 1080 aa] {...    40   0.029
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...    40   0.030
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    40   0.030
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    40   0.031
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    40   0.032
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    40   0.034
NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON...    40   0.034
YJR134C Chr10 complement(673729..675852) [2124 bp, 707 aa] {ON} ...    40   0.035
NCAS0A04070 Chr1 (819753..821891) [2139 bp, 712 aa] {ON} Anc_2.405     40   0.036
NDAI0D04320 Chr4 complement(1015358..1017577) [2220 bp, 739 aa] ...    40   0.036
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    40   0.037
TPHA0F00340 Chr6 (70646..73366) [2721 bp, 906 aa] {ON} Anc_4.32 ...    40   0.037
TBLA0H03270 Chr8 complement(798333..799568) [1236 bp, 411 aa] {O...    40   0.038
Suva_4.378 Chr4 complement(664404..665681) [1278 bp, 425 aa] {ON...    40   0.039
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    40   0.039
TPHA0G01360 Chr7 complement(271772..276250) [4479 bp, 1492 aa] {...    40   0.040
NDAI0A08650 Chr1 (1993764..1998506) [4743 bp, 1580 aa] {ON} Anc_...    40   0.040
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    40   0.041
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    40   0.045
TPHA0I02320 Chr9 (512963..514018) [1056 bp, 351 aa] {ON} Anc_7.1...    39   0.046
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    40   0.048
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    40   0.049
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    40   0.050
Suva_2.330 Chr2 complement(580324..583236) [2913 bp, 970 aa] {ON...    40   0.050
KLLA0C01474g Chr3 complement(111545..112765) [1221 bp, 406 aa] {...    39   0.050
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    40   0.050
TPHA0B01870 Chr2 (417669..418922) [1254 bp, 417 aa] {ON} Anc_4.3...    39   0.051
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...    40   0.051
Smik_13.217 Chr13 complement(351673..354999) [3327 bp, 1108 aa] ...    40   0.051
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    40   0.051
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    40   0.052
KAFR0C03560 Chr3 complement(727092..730946) [3855 bp, 1284 aa] {...    40   0.052
SAKL0H16720g Chr8 (1472129..1472144,1472210..1472880) [687 bp, 2...    39   0.053
NCAS0B01760 Chr2 (290690..292162) [1473 bp, 490 aa] {ON} Anc_8.6...    39   0.054
CAGL0J07348g Chr10 (711496..713091) [1596 bp, 531 aa] {ON} weakl...    39   0.056
TBLA0B00220 Chr2 complement(37191..38792) [1602 bp, 533 aa] {ON}...    39   0.056
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    39   0.063
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    39   0.063
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    39   0.063
TBLA0J00960 Chr10 complement(215541..218597) [3057 bp, 1018 aa] ...    39   0.066
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    39   0.070
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    39   0.071
KLTH0B04598g Chr2 complement(373616..375145) [1530 bp, 509 aa] {...    39   0.073
Suva_15.75 Chr15 (118591..120414) [1824 bp, 607 aa] {ON} YOL091W...    39   0.077
YPL253C Chr16 complement(71063..73006) [1944 bp, 647 aa] {ON}  V...    39   0.078
SAKL0E14740g Chr5 complement(1216985..1219024) [2040 bp, 679 aa]...    39   0.079
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    39   0.080
TPHA0M01780 Chr13 (368492..371146) [2655 bp, 884 aa] {ON} Anc_3....    39   0.084
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    39   0.087
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...    39   0.088
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    39   0.088
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    39   0.089
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    39   0.089
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    39   0.089
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    39   0.090
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    39   0.091
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    39   0.093
TBLA0A00800 Chr1 complement(174131..175567) [1437 bp, 478 aa] {O...    39   0.093
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    39   0.097
Kpol_1013.36 s1013 (86548..88500) [1953 bp, 650 aa] {ON} (86548....    39   0.10 
Kwal_27.11183 s27 (675668..677650) [1983 bp, 660 aa] {ON} YGL086...    39   0.10 
TBLA0B04890 Chr2 complement(1152059..1154065) [2007 bp, 668 aa] ...    39   0.10 
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    39   0.11 
CAGL0E00957g Chr5 (86682..89627) [2946 bp, 981 aa] {ON} similar ...    39   0.11 
NDAI0F02790 Chr6 (685315..688629) [3315 bp, 1104 aa] {ON} Anc_2....    39   0.11 
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    39   0.12 
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    39   0.12 
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    39   0.12 
Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635...    39   0.12 
YPL120W Chr16 (322071..323744) [1674 bp, 557 aa] {ON}  VPS30Subu...    38   0.13 
TPHA0H02060 Chr8 (487254..489296) [2043 bp, 680 aa] {ON} Anc_6.2...    38   0.14 
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    38   0.14 
KNAG0F02120 Chr6 complement(403190..405319) [2130 bp, 709 aa] {O...    38   0.14 
TBLA0D03470 Chr4 (863767..866046) [2280 bp, 759 aa] {ON} Anc_6.1...    38   0.14 
NDAI0H03930 Chr8 complement(965729..968071) [2343 bp, 780 aa] {O...    38   0.14 
TDEL0D05180 Chr4 complement(940548..943061) [2514 bp, 837 aa] {O...    38   0.14 
Kpol_1029.20 s1029 complement(39953..42688) [2736 bp, 911 aa] {O...    38   0.15 
KLLA0C08723g Chr3 (762625..765501) [2877 bp, 958 aa] {ON} simila...    38   0.15 
YPR055W Chr16 (667676..670873) [3198 bp, 1065 aa] {ON}  SEC8Esse...    38   0.15 
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    38   0.15 
Suva_16.378 Chr16 complement(667893..671423) [3531 bp, 1176 aa] ...    38   0.15 
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    38   0.15 
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...    38   0.15 
TBLA0E03890 Chr5 complement(977425..981744) [4320 bp, 1439 aa] {...    38   0.16 
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    38   0.16 
Kpol_344.6 s344 (13142..19165) [6024 bp, 2007 aa] {ON} (13142..1...    38   0.16 
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    38   0.18 
Kpol_529.7 s529 complement(14735..16807) [2073 bp, 690 aa] {ON} ...    38   0.18 
Smik_7.197 Chr7 (341623..343776) [2154 bp, 717 aa] {ON} YGL086W ...    38   0.18 
TPHA0L00650 Chr12 complement(116502..118703) [2202 bp, 733 aa] {...    38   0.18 
Kpol_1045.30 s1045 (68925..71675) [2751 bp, 916 aa] {ON} (68927....    38   0.19 
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    38   0.19 
YDR166C Chr4 complement(786306..789221) [2916 bp, 971 aa] {ON}  ...    38   0.19 
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...    38   0.19 
NDAI0C06010 Chr3 (1378818..1381862) [3045 bp, 1014 aa] {ON} Anc_...    38   0.19 
KLTH0F03058g Chr6 (264710..268606) [3897 bp, 1298 aa] {ON} simil...    38   0.20 
Ecym_1108 Chr1 (226176..230072) [3897 bp, 1298 aa] {ON} similar ...    38   0.20 
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    38   0.20 
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    38   0.21 
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...    38   0.21 
NDAI0G02820 Chr7 (655932..657287) [1356 bp, 451 aa] {ON} Anc_3.1...    37   0.21 
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    38   0.21 
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    37   0.21 
Smik_6.457 Chr6 (751338..753281) [1944 bp, 647 aa] {ON} YPL253C ...    37   0.23 
TBLA0G02170 Chr7 complement(566212..568425) [2214 bp, 737 aa] {O...    37   0.24 
KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}...    37   0.24 
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    37   0.25 
YKL073W Chr11 (296430..299075) [2646 bp, 881 aa] {ON}  LHS1Molec...    37   0.25 
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    37   0.25 
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    37   0.26 
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    37   0.26 
CAGL0H09680g Chr8 (943940..947986) [4047 bp, 1348 aa] {ON} simil...    37   0.26 
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    37   0.27 
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    37   0.27 
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    37   0.27 
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...    37   0.28 
KNAG0A05130 Chr1 complement(748935..755969) [7035 bp, 2344 aa] {...    37   0.28 
YMR198W Chr13 (659745..661529) [1785 bp, 594 aa] {ON}  CIK1Kines...    37   0.30 
KLLA0F13002g Chr6 complement(1197689..1199593) [1905 bp, 634 aa]...    37   0.31 
AER074W Chr5 (775019..776950) [1932 bp, 643 aa] {ON} Syntenic ho...    37   0.31 
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    37   0.31 
TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {O...    37   0.32 
KAFR0K01370 Chr11 complement(281735..284068) [2334 bp, 777 aa] {...    37   0.32 
TBLA0C04200 Chr3 (1013461..1016016) [2556 bp, 851 aa] {ON} Anc_4...    37   0.33 
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    37   0.33 
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    37   0.33 
NCAS0E03950 Chr5 complement(773762..776764) [3003 bp, 1000 aa] {...    37   0.33 
TBLA0B07540 Chr2 complement(1792231..1795248) [3018 bp, 1005 aa]...    37   0.33 
TBLA0A00590 Chr1 complement(115712..116875) [1164 bp, 387 aa] {O...    37   0.34 
TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3....    37   0.34 
TBLA0E00340 Chr5 complement(57462..60764) [3303 bp, 1100 aa] {ON...    37   0.34 
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    37   0.34 
TBLA0D01950 Chr4 (484101..487634) [3534 bp, 1177 aa] {ON}              37   0.34 
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    37   0.34 
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    37   0.34 
NDAI0J00690 Chr10 (145016..148705) [3690 bp, 1229 aa] {ON} Anc_7...    37   0.34 
TBLA0I03420 Chr9 (824623..828363) [3741 bp, 1246 aa] {ON} Anc_3....    37   0.34 
NCAS0J01590 Chr10 (286539..287759) [1221 bp, 406 aa] {ON} Anc_4....    37   0.34 
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    37   0.35 
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    37   0.35 
KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] ...    37   0.35 
SAKL0H20174g Chr8 (1764879..1769282) [4404 bp, 1467 aa] {ON} wea...    37   0.35 
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...    37   0.36 
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    37   0.36 
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    37   0.36 
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    37   0.36 
TPHA0B03360 Chr2 (774118..780630) [6513 bp, 2170 aa] {ON} Anc_8....    37   0.36 
TPHA0L00620 Chr12 complement(108463..109866) [1404 bp, 467 aa] {...    37   0.36 
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    37   0.37 
KLLA0F02189g Chr6 (197699..198085) [387 bp, 128 aa] {ON} some si...    35   0.37 
KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some sim...    37   0.40 
NDAI0C03710 Chr3 complement(847460..848455,848555..848557) [999 ...    36   0.41 
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    37   0.41 
NCAS0B07320 Chr2 complement(1383781..1385949) [2169 bp, 722 aa] ...    37   0.41 
SAKL0D11990g Chr4 complement(994808..997408) [2601 bp, 866 aa] {...    37   0.43 
TPHA0H00930 Chr8 complement(192292..194943) [2652 bp, 883 aa] {O...    37   0.43 
TBLA0B08490 Chr2 complement(2030030..2032744) [2715 bp, 904 aa] ...    37   0.43 
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    37   0.43 
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    37   0.43 
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    37   0.44 
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    37   0.44 
TBLA0B07220 Chr2 complement(1707881..1710844) [2964 bp, 987 aa] ...    37   0.44 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    37   0.45 
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    37   0.46 
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....    37   0.46 
Smik_2.270 Chr2 complement(480391..481668) [1278 bp, 425 aa] {ON...    36   0.46 
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    36   0.48 
KAFR0A07440 Chr1 (1500683..1502215) [1533 bp, 510 aa] {ON} Anc_2...    36   0.50 
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    36   0.50 
TPHA0C01970 Chr3 complement(445831..447459) [1629 bp, 542 aa] {O...    36   0.50 
Kpol_228.1 s228 (611..2293) [1683 bp, 560 aa] {ON} (611..2293) [...    36   0.51 
YGL228W Chr7 (67598..69331) [1734 bp, 577 aa] {ON}  SHE10Putativ...    36   0.51 
Suva_7.183 Chr7 (340138..342027) [1890 bp, 629 aa] {ON} YGL086W ...    36   0.53 
NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa] {O...    36   0.54 
NDAI0A07430 Chr1 complement(1695336..1697537) [2202 bp, 733 aa] ...    36   0.54 
Smik_4.2 Chr4 complement(4408..6789) [2382 bp, 793 aa] {ON} YDL2...    36   0.55 
NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {O...    36   0.57 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    36   0.59 
NCAS0B03980 Chr2 (712826..716380) [3555 bp, 1184 aa] {ON} Anc_8....    36   0.59 
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    36   0.60 
TBLA0D02460 Chr4 (609615..613799) [4185 bp, 1394 aa] {ON} Anc_8....    36   0.60 
YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}  ...    36   0.61 
TPHA0A01520 Chr1 complement(296953..302685) [5733 bp, 1910 aa] {...    36   0.61 
NDAI0C00360 Chr3 complement(57247..58560) [1314 bp, 437 aa] {ON}...    36   0.62 
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}            36   0.62 
YFR039C Chr6 complement(232012..233544) [1533 bp, 510 aa] {ON} P...    36   0.65 
TPHA0D02200 Chr4 complement(454720..456270) [1551 bp, 516 aa] {O...    36   0.65 
TBLA0J01720 Chr10 complement(380082..381659) [1578 bp, 525 aa] {...    36   0.66 
TPHA0N00810 Chr14 complement(179351..180937) [1587 bp, 528 aa] {...    36   0.66 
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...    36   0.70 
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    36   0.71 
NDAI0A08740 Chr1 (2011619..2013790) [2172 bp, 723 aa] {ON} Anc_7...    36   0.71 
Skud_15.320 Chr15 complement(577103..579274) [2172 bp, 723 aa] {...    36   0.71 
TBLA0A00970 Chr1 complement(216127..216831) [705 bp, 234 aa] {ON...    35   0.72 
Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]...    36   0.72 
AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic ho...    36   0.74 
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    36   0.75 
TBLA0E00400 Chr5 complement(73944..76853) [2910 bp, 969 aa] {ON}...    36   0.75 
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    36   0.77 
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    36   0.77 
Kpol_1028.50 s1028 (119697..123386) [3690 bp, 1229 aa] {ON} (119...    36   0.77 
Kpol_1060.23 s1060 (57472..61314) [3843 bp, 1280 aa] {ON} (57472...    36   0.78 
CAGL0F00671g Chr6 complement(73893..78593) [4701 bp, 1566 aa] {O...    36   0.79 
TBLA0C05170 Chr3 complement(1250142..1255004) [4863 bp, 1620 aa]...    36   0.80 
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    36   0.80 
NCAS0A14220 Chr1 complement(2799630..2801111) [1482 bp, 493 aa] ...    35   0.85 
KLLA0B10329g Chr2 (902691..904532) [1842 bp, 613 aa] {ON} weakly...    35   0.90 
NCAS0A15180 Chr1 complement(2985713..2987644) [1932 bp, 643 aa] ...    35   0.91 
TPHA0D00690 Chr4 complement(136217..138151) [1935 bp, 644 aa] {O...    35   0.91 
Kpol_1071.4 s1071 (9071..9763) [693 bp, 230 aa] {ON} (9071..9763...    35   0.94 
TBLA0I01840 Chr9 (413998..416190) [2193 bp, 730 aa] {ON} Anc_3.2...    35   0.94 
TBLA0B01360 Chr2 (288233..290464) [2232 bp, 743 aa] {ON} Anc_2.1...    35   0.94 
Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W ...    35   0.94 
TBLA0I02150 Chr9 (496050..498299) [2250 bp, 749 aa] {ON} Anc_3.3...    35   0.94 
TBLA0D00920 Chr4 complement(237094..239409) [2316 bp, 771 aa] {O...    35   0.95 
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    35   0.95 
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    35   0.96 
Skud_11.153 Chr11 (281737..284382) [2646 bp, 881 aa] {ON} YKL073...    35   0.97 
Kwal_26.8312 s26 complement(735774..738464) [2691 bp, 896 aa] {O...    35   0.97 
Sklu_YGOB_Anc_5.296 Chr7 (891742..892812) [1071 bp, 356 aa] {ON}...    35   0.98 
TBLA0I01280 Chr9 complement(271364..274147) [2784 bp, 927 aa] {O...    35   0.98 
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    35   0.99 
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    35   0.99 
Kpol_1067.28 s1067 (63984..67145) [3162 bp, 1053 aa] {ON} (63984...    35   1.00 
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    35   1.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...    35   1.0  
Suva_2.322 Chr2 (565810..569739) [3930 bp, 1309 aa] {ON} YDR159W...    35   1.0  
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    35   1.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    35   1.0  
Suva_4.134 Chr4 (247333..251643) [4311 bp, 1436 aa] {ON} YDL112W...    35   1.0  
SAKL0E09350g Chr5 complement(778947..779414,779476..779493) [486...    34   1.0  
TBLA0A03310 Chr1 (787743..792512) [4770 bp, 1589 aa] {ON} Anc_5....    35   1.0  
Skud_5.293 Chr5 complement(467328..473804) [6477 bp, 2159 aa] {O...    35   1.1  
Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}...    35   1.1  
Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar...    35   1.1  
KNAG0K00940 Chr11 complement(184711..186111) [1401 bp, 466 aa] {...    35   1.1  
NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON}               35   1.1  
Kpol_1032.80 s1032 complement(173475..174347) [873 bp, 290 aa] {...    35   1.1  
Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)...    35   1.2  
Kpol_1066.8 s1066 (12763..14607) [1845 bp, 614 aa] {ON} (12763.....    35   1.2  
TPHA0A00660 Chr1 (118435..120429) [1995 bp, 664 aa] {ON} Anc_3.9...    35   1.2  
KNAG0C00940 Chr3 complement(178596..180593) [1998 bp, 665 aa] {O...    35   1.2  
Kwal_26.6909 s26 (119157..121283) [2127 bp, 708 aa] {ON} YOR353C...    35   1.2  
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    35   1.2  
TBLA0G00410 Chr7 complement(78647..80794) [2148 bp, 715 aa] {ON}...    35   1.2  
KLTH0F17886g Chr6 (1444721..1445704) [984 bp, 327 aa] {ON} simil...    35   1.2  
Kpol_1024.15 s1024 (57277..58317) [1041 bp, 346 aa] {ON} (57277....    35   1.3  
Smik_12.228 Chr12 complement(442563..445178) [2616 bp, 871 aa] {...    35   1.3  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     35   1.3  
KNAG0J00190 Chr10 complement(21137..23836) [2700 bp, 899 aa] {ON...    35   1.3  
NDAI0C03980 Chr3 complement(901982..904702) [2721 bp, 906 aa] {O...    35   1.3  
TBLA0F02310 Chr6 complement(569571..572306) [2736 bp, 911 aa] {O...    35   1.3  
Kpol_1037.10 s1037 complement(21480..22553) [1074 bp, 357 aa] {O...    35   1.3  
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    35   1.3  
Kpol_1018.105 s1018 complement(274868..278014) [3147 bp, 1048 aa...    35   1.3  
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    35   1.4  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    35   1.4  
NDAI0F01300 Chr6 complement(317724..322409) [4686 bp, 1561 aa] {...    35   1.4  
NDAI0J03020 Chr10 complement(753506..758383) [4878 bp, 1625 aa] ...    35   1.4  
NDAI0G01210 Chr7 (263427..268373) [4947 bp, 1648 aa] {ON} Anc_3....    35   1.4  
TPHA0A02490 Chr1 complement(531393..532715) [1323 bp, 440 aa] {O...    35   1.4  
TPHA0C02110 Chr3 (477769..479232) [1464 bp, 487 aa] {ON} Anc_8.4...    35   1.5  
Kpol_520.42 s520 (101479..102954) [1476 bp, 491 aa] {ON} (101479...    35   1.5  
KLLA0D10956g Chr4 complement(934074..935738) [1665 bp, 554 aa] {...    35   1.5  
TPHA0H00790 Chr8 (162043..163785) [1743 bp, 580 aa] {ON} Anc_3.1...    35   1.5  
NDAI0E03710 Chr5 complement(800263..802059) [1797 bp, 598 aa] {O...    35   1.5  
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    35   1.6  
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    35   1.6  
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    35   1.6  
NDAI0I02420 Chr9 complement(550464..552689) [2226 bp, 741 aa] {O...    35   1.6  
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    35   1.6  
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    35   1.7  
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    35   1.7  
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    35   1.7  
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    35   1.7  
TBLA0A02020 Chr1 (487911..490661) [2751 bp, 916 aa] {ON} Anc_6.2...    35   1.7  
TPHA0B01780 Chr2 (395221..396279) [1059 bp, 352 aa] {ON} Anc_4.3...    34   1.7  
TBLA0C06000 Chr3 (1455431..1458295) [2865 bp, 954 aa] {ON} Anc_1...    35   1.7  
Skud_11.172 Chr11 complement(310581..313694) [3114 bp, 1037 aa] ...    35   1.7  
Kpol_1053.45 s1053 (86005..89640) [3636 bp, 1211 aa] {ON} (86005...    35   1.7  
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    35   1.8  
TBLA0I02500 Chr9 complement(575195..579253) [4059 bp, 1352 aa] {...    35   1.8  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....    35   1.8  
NDAI0E00400 Chr5 complement(65678..71323) [5646 bp, 1881 aa] {ON...    35   1.8  
CAGL0E01265g Chr5 complement(113167..119454) [6288 bp, 2095 aa] ...    35   1.8  
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    35   1.8  
NDAI0A08140 Chr1 (1865702..1867156) [1455 bp, 484 aa] {ON}             34   1.9  
TBLA0H02620 Chr8 complement(619758..621266) [1509 bp, 502 aa] {O...    34   1.9  
CAGL0I05258g Chr9 (498808..500331) [1524 bp, 507 aa] {ON} simila...    34   1.9  
CAGL0J11110g Chr10 complement(1082062..1083588) [1527 bp, 508 aa...    34   1.9  
NDAI0I00860 Chr9 complement(197860..199491) [1632 bp, 543 aa] {O...    34   2.0  
KLLA0E08955g Chr5 (793287..794315) [1029 bp, 342 aa] {ON} simila...    34   2.2  
TDEL0A07200 Chr1 complement(1255540..1258209) [2670 bp, 889 aa] ...    34   2.2  
YER075C Chr5 complement(308413..311199) [2787 bp, 928 aa] {ON}  ...    34   2.2  
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    34   2.2  
Smik_4.121 Chr4 complement(230683..231405,231406..231663,231734....    34   2.2  
KAFR0H01100 Chr8 (199377..202412) [3036 bp, 1011 aa] {ON} Anc_3....    34   2.2  
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    34   2.3  
TBLA0B04300 Chr2 complement(994891..998943) [4053 bp, 1350 aa] {...    34   2.3  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    34   2.3  
YIR006C Chr9 complement(365466..369908) [4443 bp, 1480 aa] {ON} ...    34   2.3  
NDAI0E04100 Chr5 (920291..921496) [1206 bp, 401 aa] {ON}               34   2.4  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    34   2.4  
Kpol_1055.35 s1055 complement(85381..91668) [6288 bp, 2095 aa] {...    34   2.4  
NCAS0B04610 Chr2 complement(839465..840733) [1269 bp, 422 aa] {O...    34   2.4  
NCAS0B06280 Chr2 complement(1185096..1186547) [1452 bp, 483 aa] ...    34   2.5  
TPHA0D03910 Chr4 (819917..821374) [1458 bp, 485 aa] {ON} Anc_6.3...    34   2.5  
CAGL0I02112g Chr9 (181404..182873) [1470 bp, 489 aa] {ON} weakly...    34   2.5  
Skud_4.229 Chr4 complement(408207..409820) [1614 bp, 537 aa] {ON...    34   2.6  
NDAI0F03970 Chr6 complement(942365..943208,943342..943379) [882 ...    33   2.7  
Suva_15.42 Chr15 (75198..77126) [1929 bp, 642 aa] {ON} YOL117W (...    34   2.7  
KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} simi...    34   2.7  
Kwal_47.17756 s47 (542403..543068) [666 bp, 221 aa] {OFF} YLR031...    33   2.8  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    34   2.8  
Suva_2.110 Chr2 complement(193029..195728) [2700 bp, 899 aa] {ON...    34   2.9  
TPHA0M00980 Chr13 complement(189859..192741) [2883 bp, 960 aa] {...    34   2.9  
Kpol_460.24 s460 complement(49620..50705) [1086 bp, 361 aa] {ON}...    33   3.0  
Smik_11.345 Chr11 (582757..586236) [3480 bp, 1159 aa] {ON} YKR08...    34   3.0  
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    34   3.0  
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    34   3.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    34   3.0  
TBLA0A06140 Chr1 complement(1508271..1512644) [4374 bp, 1457 aa]...    34   3.0  
Kthe_YGOB_Anc_5.296 Chr7 (520932..522119) [1188 bp, 395 aa] {ON}...    33   3.1  
Ecym_8356 Chr8 (713086..718521) [5436 bp, 1811 aa] {ON} similar ...    34   3.1  
Kpol_1048.51 s1048 (142686..148853) [6168 bp, 2055 aa] {ON} (142...    34   3.1  
KLLA0E08031g Chr5 complement(722953..724179) [1227 bp, 408 aa] {...    33   3.1  
Kpol_1036.37 s1036 (92633..100114) [7482 bp, 2493 aa] {ON} (9263...    34   3.2  
CAGL0I10967g Chr9 complement(1081047..1082474) [1428 bp, 475 aa]...    33   3.3  
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    33   3.3  
Kpol_1062.51 s1062 complement(109003..110553) [1551 bp, 516 aa] ...    33   3.4  
Skud_4.60 Chr4 complement(102282..103841) [1560 bp, 519 aa] {ON}...    33   3.4  
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    33   3.4  
TPHA0H01250 Chr8 (278379..280088) [1710 bp, 569 aa] {ON} Anc_5.5...    33   3.5  
TPHA0C03580 Chr3 complement(773805..775688) [1884 bp, 627 aa] {O...    33   3.5  
Kpol_1013.29 s1013 (68692..70596) [1905 bp, 634 aa] {ON} (68692....    33   3.6  
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    33   3.6  
SAKL0G18414g Chr7 complement(1588834..1590873) [2040 bp, 679 aa]...    33   3.6  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...    33   3.6  
TBLA0C03320 Chr3 complement(803654..805771) [2118 bp, 705 aa] {O...    33   3.6  
Kpol_1016.22 s1016 complement(57438..57950) [513 bp, 170 aa] {ON...    32   3.7  
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    33   3.7  
Kpol_1004.36 s1004 (75313..76536,76540..76929,76936..77592) [227...    33   3.7  
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    33   3.7  
KAFR0C04490 Chr3 complement(896409..898709) [2301 bp, 766 aa] {O...    33   3.7  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    33   3.7  
KAFR0F01520 Chr6 (298731..301094) [2364 bp, 787 aa] {ON} Anc_1.1...    33   3.7  
CAGL0L01001g Chr12 complement(115884..118295) [2412 bp, 803 aa] ...    33   3.7  
CAGL0J01111g Chr10 complement(105760..108195) [2436 bp, 811 aa] ...    33   3.7  
YPL174C Chr16 complement(220167..222773) [2607 bp, 868 aa] {ON} ...    33   3.8  
TPHA0F01490 Chr6 complement(342923..345628) [2706 bp, 901 aa] {O...    33   3.8  
Kpol_460.7 s460 (13886..16705) [2820 bp, 939 aa] {ON} (13886..16...    33   3.8  
TBLA0D02280 Chr4 (572905..575760) [2856 bp, 951 aa] {ON} Anc_8.1...    33   3.8  
TPHA0D02160 Chr4 (444306..447380) [3075 bp, 1024 aa] {ON} Anc_5....    33   3.9  
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...    33   3.9  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    33   3.9  
Smik_10.381 Chr10 complement(593414..594508) [1095 bp, 364 aa] {...    33   3.9  
Kwal_23.3059 s23 complement(138649..139194) [546 bp, 181 aa] {ON...    32   4.0  
TBLA0D00520 Chr4 (137592..142034) [4443 bp, 1480 aa] {ON} Anc_7....    33   4.0  
TPHA0L02220 Chr12 (463956..465104) [1149 bp, 382 aa] {ON} Anc_5....    33   4.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    33   4.1  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    33   4.1  
NDAI0B03910 Chr2 complement(983740..984948) [1209 bp, 402 aa] {O...    33   4.1  
Kpol_1003.20 s1003 (51990..53225) [1236 bp, 411 aa] {ON} (51990....    33   4.1  
TBLA0C02850 Chr3 (682683..690260) [7578 bp, 2525 aa] {ON} Anc_1....    33   4.1  
ZYRO0A10912g Chr1 complement(878270..879523) [1254 bp, 417 aa] {...    33   4.2  
TBLA0E01410 Chr5 complement(307768..316959) [9192 bp, 3063 aa] {...    33   4.2  
Suva_10.265 Chr10 complement(469397..470167) [771 bp, 256 aa] {O...    33   4.2  
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    33   4.3  
Smik_12.527 Chr12 complement(929323..930687) [1365 bp, 454 aa] {...    33   4.3  
Kpol_1058.27 s1058 (80407..81861) [1455 bp, 484 aa] {ON} (80407....    33   4.4  
Suva_16.448 Chr16 (778841..780310) [1470 bp, 489 aa] {ON} YPR119...    33   4.4  
Ecym_7381 Chr7 complement(791950..792500,792594..792849) [807 bp...    33   4.4  
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    33   4.4  
TBLA0A09700 Chr1 complement(2385365..2386963) [1599 bp, 532 aa] ...    33   4.5  
KLLA0D02310g Chr4 complement(196687..198294) [1608 bp, 535 aa] {...    33   4.5  
Suva_11.248 Chr11 (453665..455284) [1620 bp, 539 aa] {ON} YKR016...    33   4.5  
TBLA0I02990 Chr9 (710633..712255) [1623 bp, 540 aa] {ON} Anc_4.2...    33   4.5  
Ecym_5410 Chr5 (846228..847079) [852 bp, 283 aa] {ON} similar to...    33   4.5  
KLLA0F16819g Chr6 (1548402..1550327) [1926 bp, 641 aa] {ON} unip...    33   4.7  
Kpol_1033.60 s1033 complement(153369..155303) [1935 bp, 644 aa] ...    33   4.7  
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    33   4.7  
TPHA0D01850 Chr4 complement(386116..388167) [2052 bp, 683 aa] {O...    33   4.7  
Ecym_4691 Chr4 (1353076..1355187) [2112 bp, 703 aa] {ON} similar...    33   4.8  
NDAI0C05820 Chr3 (1336776..1338902) [2127 bp, 708 aa] {ON} Anc_8...    33   4.8  
TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7....    33   4.8  
Kpol_1054.20 s1054 (47968..50184) [2217 bp, 738 aa] {ON} (47968....    33   4.8  
Kpol_1062.46 s1062 complement(96444..98741) [2298 bp, 765 aa] {O...    33   4.8  
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    33   4.8  
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     33   4.9  
TBLA0B03520 Chr2 (819266..821713) [2448 bp, 815 aa] {ON} Anc_8.7...    33   4.9  
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     33   4.9  
KAFR0B06260 Chr2 (1285976..1288621) [2646 bp, 881 aa] {ON} Anc_8...    33   5.0  
CAGL0G02959g Chr7 (272520..275276) [2757 bp, 918 aa] {ON} simila...    33   5.0  
AGL300C Chr7 complement(138683..141502) [2820 bp, 939 aa] {ON} S...    33   5.0  
Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {O...    33   5.0  
SAKL0C03652g Chr3 (344282..347464) [3183 bp, 1060 aa] {ON} weakl...    33   5.1  
NDAI0C02430 Chr3 complement(556233..559415) [3183 bp, 1060 aa] {...    33   5.1  
Kwal_27.12530 s27 complement(1261137..1264400) [3264 bp, 1087 aa...    33   5.1  
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    33   5.2  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...    33   5.2  
Kpol_1050.21 s1050 complement(53377..54489) [1113 bp, 370 aa] {O...    33   5.2  
NDAI0D02980 Chr4 complement(704549..709024) [4476 bp, 1491 aa] {...    33   5.2  
Smik_14.187 Chr14 complement(340387..345168) [4782 bp, 1593 aa] ...    33   5.3  
KAFR0C03390 Chr3 (690243..690953) [711 bp, 236 aa] {ON} Anc_8.53...    32   5.3  
Smik_10.434 Chr10 complement(679807..684753) [4947 bp, 1648 aa] ...    33   5.3  
Kwal_23.5662 s23 complement(1259373..1260641) [1269 bp, 422 aa] ...    33   5.5  
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    33   5.7  
TPHA0A04070 Chr1 (913518..915056) [1539 bp, 512 aa] {ON} Anc_3.2...    33   5.8  
TPHA0C03120 Chr3 complement(689473..691068) [1596 bp, 531 aa] {O...    33   5.9  
NDAI0B01230 Chr2 (290612..292261) [1650 bp, 549 aa] {ON} Anc_1.484     33   5.9  
NDAI0G05660 Chr7 (1403469..1405160) [1692 bp, 563 aa] {ON}             33   6.0  
TPHA0G01400 Chr7 complement(283961..285838) [1878 bp, 625 aa] {O...    33   6.1  
NDAI0H02420 Chr8 complement(586713..588605) [1893 bp, 630 aa] {O...    33   6.1  
TPHA0J01860 Chr10 complement(425287..427182) [1896 bp, 631 aa] {...    33   6.1  
TBLA0A07620 Chr1 complement(1890451..1892346) [1896 bp, 631 aa] ...    33   6.1  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    33   6.1  
NCAS0C02670 Chr3 complement(498144..500051) [1908 bp, 635 aa] {O...    33   6.1  
TPHA0A00250 Chr1 complement(32695..34626) [1932 bp, 643 aa] {ON}...    33   6.2  
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    33   6.2  
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...    33   6.2  
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    33   6.2  
TPHA0A04300 Chr1 (967312..968208) [897 bp, 298 aa] {ON}                32   6.2  
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...    33   6.3  
TPHA0D01330 Chr4 (275319..277601) [2283 bp, 760 aa] {ON} Anc_8.6...    33   6.3  
Kpol_483.6 s483 complement(10699..13068) [2370 bp, 789 aa] {ON} ...    33   6.4  
TPHA0A04440 Chr1 (996689..999121) [2433 bp, 810 aa] {ON} Anc_3.1...    33   6.4  
TDEL0G03150 Chr7 complement(589489..590448) [960 bp, 319 aa] {ON...    32   6.4  
Ecym_2309 Chr2 (599775..602249) [2475 bp, 824 aa] {ON} similar t...    33   6.4  
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...    33   6.4  
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    33   6.4  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    33   6.5  
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    33   6.5  
TPHA0A04630 Chr1 complement(1047671..1050622) [2952 bp, 983 aa] ...    33   6.6  
NDAI0C00830 Chr3 (159881..162859) [2979 bp, 992 aa] {ON} Anc_5.5...    33   6.6  
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    33   6.6  
KNAG0J01220 Chr10 complement(218285..221452) [3168 bp, 1055 aa] ...    33   6.6  
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    32   6.7  
Smik_4.560 Chr4 complement(1012650..1015841) [3192 bp, 1063 aa] ...    33   6.7  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    33   6.7  
KLTH0D12628g Chr4 complement(1031332..1034637) [3306 bp, 1101 aa...    33   6.7  
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              33   6.7  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    33   6.8  
TBLA0C04650 Chr3 complement(1128825..1132646) [3822 bp, 1273 aa]...    33   6.8  
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    33   6.8  
YKL016C Chr11 complement(407465..407989) [525 bp, 174 aa] {ON}  ...    32   6.8  
TBLA0B07270 Chr2 (1724404..1728537) [4134 bp, 1377 aa] {ON} Anc_...    33   6.8  
NCAS0B08730 Chr2 (1682303..1682992) [690 bp, 229 aa] {ON} Anc_1....    32   6.8  
KAFR0J01230 Chr10 complement(224955..229232) [4278 bp, 1425 aa] ...    33   6.8  
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    33   6.9  
YNL139C Chr14 complement(360924..365717) [4794 bp, 1597 aa] {ON}...    33   6.9  
Skud_12.47 Chr12 (92122..96921) [4800 bp, 1599 aa] {ON} YLL021W ...    33   6.9  
YJR140C Chr10 complement(690750..695696) [4947 bp, 1648 aa] {ON}...    33   6.9  
TBLA0B03460 Chr2 complement(801699..808766) [7068 bp, 2355 aa] {...    33   7.1  
NDAI0H00600 Chr8 (140144..141340) [1197 bp, 398 aa] {ON} Anc_5.663     32   7.1  
Ecym_7020 Chr7 complement(37877..39115) [1239 bp, 412 aa] {ON} s...    32   7.2  
KNAG0K00880 Chr11 (166836..168098) [1263 bp, 420 aa] {ON} Anc_3....    32   7.2  
TBLA0H01850 Chr8 (438346..439689) [1344 bp, 447 aa] {ON} Anc_5.3...    32   7.4  
Kpol_1002.70 s1002 complement(188416..189762) [1347 bp, 448 aa] ...    32   7.4  
TPHA0G03220 Chr7 complement(690888..691649) [762 bp, 253 aa] {ON...    32   7.4  
CAGL0I02134g Chr9 complement(183081..183860) [780 bp, 259 aa] {O...    32   7.5  
TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {O...    32   7.7  
TPHA0L00990 Chr12 complement(199458..201017) [1560 bp, 519 aa] {...    32   7.7  
NCAS0E01770 Chr5 (344556..346253) [1698 bp, 565 aa] {ON} Anc_7.204     32   7.9  
TBLA0J00340 Chr10 complement(61497..63329) [1833 bp, 610 aa] {ON...    32   8.0  
YPR179C Chr16 complement(893797..895764) [1968 bp, 655 aa] {ON} ...    32   8.1  
KLTH0D17688g Chr4 (1470627..1472669) [2043 bp, 680 aa] {ON} weak...    32   8.2  
KLLA0C18359g Chr3 (1622747..1624840) [2094 bp, 697 aa] {ON} simi...    32   8.2  
KAFR0D02270 Chr4 (459308..461437) [2130 bp, 709 aa] {ON} Anc_5.6...    32   8.2  
TBLA0E03490 Chr5 complement(868330..870579) [2250 bp, 749 aa] {O...    32   8.3  
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    32   8.4  
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    32   8.5  
Skud_2.305 Chr2 complement(553986..556553) [2568 bp, 855 aa] {ON...    32   8.5  
Skud_12.458 Chr12 complement(808174..810870) [2697 bp, 898 aa] {...    32   8.5  
TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {O...    32   8.5  
KAFR0G00210 Chr7 (72892..75666) [2775 bp, 924 aa] {ON} Anc_1.136...    32   8.6  
NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {O...    32   8.6  
TPHA0M01410 Chr13 complement(302438..305335) [2898 bp, 965 aa] {...    32   8.6  
Skud_11.16 Chr11 (33522..36821) [3300 bp, 1099 aa] {ON} YKL205W ...    32   8.8  
Suva_7.112 Chr7 (212350..213378) [1029 bp, 342 aa] {ON} YGL153W ...    32   8.8  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    32   8.8  
TDEL0D01030 Chr4 (187325..190846) [3522 bp, 1173 aa] {ON} Anc_4....    32   8.8  
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    32   8.9  
KLLA0B05082g Chr2 complement(460262..461326) [1065 bp, 354 aa] {...    32   8.9  
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717      32   8.9  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    32   8.9  
SAKL0A07546g Chr1 complement(665410..670134) [4725 bp, 1574 aa] ...    32   9.0  
TBLA0H03160 Chr8 (768219..772982) [4764 bp, 1587 aa] {ON} Anc_8....    32   9.0  
ZYRO0C12672g Chr3 complement(1001096..1005883) [4788 bp, 1595 aa...    32   9.1  
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    32   9.1  
TBLA0J01910 Chr10 (448704..454556) [5853 bp, 1950 aa] {ON} Anc_7...    32   9.2  
TDEL0A01570 Chr1 (280257..286448) [6192 bp, 2063 aa] {ON} Anc_8....    32   9.2  
ZYRO0D06358g Chr4 complement(539347..540546) [1200 bp, 399 aa] {...    32   9.3  
TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {...    32   9.4  
TPHA0A02930 Chr1 complement(635681..636922) [1242 bp, 413 aa] {O...    32   9.4  
Kpol_2002.43 s2002 (87607..88866) [1260 bp, 419 aa] {ON} (87607....    32   9.5  
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...    32   9.6  
Kpol_197.2 s197 complement(5389..6837) [1449 bp, 482 aa] {ON} co...    32   9.9  

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YEL061C
            (REAL)
          Length = 999

 Score = 1706 bits (4418), Expect = 0.0
 Identities = 891/999 (89%), Positives = 891/999 (89%)
 Frame = +1

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 180
            MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN
Sbjct: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60

Query: 181  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 360
            VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 361  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 540
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 541  IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 720
            IELYNEELKDLLD         GFEGPFMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240

Query: 721  XXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
              LNDLTPKAALLRKRLRTKSL                                      
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300

Query: 901  XXRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 1080
              RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF
Sbjct: 301  SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360

Query: 1081 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA
Sbjct: 361  TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420

Query: 1261 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
            DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP
Sbjct: 421  DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 1620
            QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK
Sbjct: 481  QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540

Query: 1621 RDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 1800
            RDIE                  TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN
Sbjct: 541  RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600

Query: 1801 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
            KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI
Sbjct: 601  KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660

Query: 1981 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 2160
            QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN
Sbjct: 661  QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720

Query: 2161 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 2340
            NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN
Sbjct: 721  NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 780

Query: 2341 DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 2520
            DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT
Sbjct: 781  DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 840

Query: 2521 LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNI 2700
            LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVS               VNKHTILKDNI
Sbjct: 841  LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNI 900

Query: 2701 ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 2880
            ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN
Sbjct: 901  ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 960

Query: 2881 TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
            TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE
Sbjct: 961  TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
            YEL061C (REAL)
          Length = 998

 Score = 1557 bits (4032), Expect = 0.0
 Identities = 809/1001 (80%), Positives = 856/1001 (85%), Gaps = 2/1001 (0%)
 Frame = +1

Query: 1    MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVV 174
            MPAE+QNTIQERSSN+IS+N N   Q+GCH VPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1    MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 175  VNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 354
            VNVPDITGS+EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 355  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 534
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 535  SFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 714
            SFIELYNEELKDLLD         GF+G FMKKLRIFD                      
Sbjct: 181  SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 715  XXXXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 894
                LNDLTPKAALLRKRLRTKSL                                    
Sbjct: 241  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNG 300

Query: 895  XXXXRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 1074
                RS M  NDQSNGIYIQNLQEFHITNA+EGLNLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 301  Q---RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHT 357

Query: 1075 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 1254
            IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA
Sbjct: 358  IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 417

Query: 1255 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1434
            L D+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN
Sbjct: 418  LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477

Query: 1435 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 1614
            KPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQE
Sbjct: 478  KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 537

Query: 1615 CKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 1794
            CKR+IE                  TIQSQNSQMESLK TIN LKAQLDKQHK ELEISGF
Sbjct: 538  CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 597

Query: 1795 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 1974
            NNKLQK+TE+MQ+ALQDYK+RELDLNKKFETHISKEIKSLKT LF QL  M+Q NI QET
Sbjct: 598  NNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQET 657

Query: 1975 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 2154
            +IQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR++FQ F
Sbjct: 658  DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 717

Query: 2155 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 2334
            Y NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE+IEKKT++FVENFK T
Sbjct: 718  YKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMT 777

Query: 2335 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 2514
            LNDHLEENKKLIMQN+TNATSAVI+QEMDLFEP+R KWENSFDLINKCDSMNNEFYNNMA
Sbjct: 778  LNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 837

Query: 2515 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKD 2694
             TLSQIK TVDTSSNSMN+SISVMKGQVEESENA+S               ++KH ILKD
Sbjct: 838  ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKD 897

Query: 2695 NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRL 2874
            NIE+SITSTHSHITN+DDIY+TIE+IM N+GNKENA K+EMIDNILKEIP+LSKR+PLR+
Sbjct: 898  NIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 957

Query: 2875 SNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
            SN NG S Q+I+SPKKH I+DENPS+E  D E SRKI KTE
Sbjct: 958  SNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1547 bits (4005), Expect = 0.0
 Identities = 798/1000 (79%), Positives = 853/1000 (85%), Gaps = 1/1000 (0%)
 Frame = +1

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 180
            MPAENQNT Q+RSSN+IS N N+Q+GCH VPNEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 181  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 360
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 361  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 540
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 541  IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 720
            IELYNEELKDLLD         GF+G FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSP 240

Query: 721  XXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
              LNDLTPKAALLRKRLRTKSL                                      
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTN 300

Query: 901  XX-RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 1077
               RSSMAPNDQ+NGIYIQNLQEFHITNAMEGLNLLQ+GLKHRQVASTKMNDFSSRSHTI
Sbjct: 301  NGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360

Query: 1078 FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1257
            FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL
Sbjct: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420

Query: 1258 ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
             DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK
Sbjct: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480

Query: 1438 PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 1617
            PQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC
Sbjct: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540

Query: 1618 KRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFN 1797
            KR+IE                  TIQSQN Q+ESLK TI+ L+AQLDKQHKTE+EIS FN
Sbjct: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600

Query: 1798 NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETN 1977
            NKLQKLTE+MQ+AL DYK+RELDLN+KFE HI+KEIK LK+TLF QL+ M+Q +I QETN
Sbjct: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660

Query: 1978 IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFY 2157
            IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIRVDFQ+FY
Sbjct: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720

Query: 2158 NNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL 2337
             NIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYE+IEK+T+EFVENFK  L
Sbjct: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780

Query: 2338 NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 2517
            NDHL+ENKKLIMQNLT ATSAVI+QEMDLFEPKRVKWENSFDLIN CDSMNNEFYN+MA 
Sbjct: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840

Query: 2518 TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDN 2697
            TLSQIK+TVDTSSNSMN+SISVMKGQVEESENA+S               +NKH +LKDN
Sbjct: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900

Query: 2698 IENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLS 2877
            I+NSITSTHSHITN+DDIY+TIENIMKNYGNKENA K+EMI+NILKEIP+LSK++PLRLS
Sbjct: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLS 960

Query: 2878 NTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
            N N NS Q+++SPKKHAI+DEN S+E  D E SRK+ K E
Sbjct: 961  NINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1540 bits (3986), Expect = 0.0
 Identities = 799/1002 (79%), Positives = 849/1002 (84%), Gaps = 3/1002 (0%)
 Frame = +1

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 180
            MP ENQN+ QER+SNNIS N N+QIGCH V NEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 181  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 360
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120

Query: 361  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 540
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 541  IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 720
            IELYNEELKDLLD         GF+G FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNSSP 240

Query: 721  XXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 900
              LNDLTPKAALLR+RLRTKSL                                      
Sbjct: 241  RSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTN 300

Query: 901  XX---RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 1071
                 R+S+APNDQSNGIYIQNLQEFHITNAMEGL LLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 301  NNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360

Query: 1072 TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1251
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420

Query: 1252 ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            AL DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 1611
            NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
            ECKR+IE                  TIQSQNSQ+ESLK TI+ L+ QLDKQHKTELEISG
Sbjct: 541  ECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 1971
            FN+KLQKLTE+MQ+ALQDYKRRELDLNKKFETHI+ EIK++KTTLFSQLS ++Q NI QE
Sbjct: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 2151
            T+IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII VDF+R
Sbjct: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720

Query: 2152 FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 2331
            FY NIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKT++FVENFK 
Sbjct: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780

Query: 2332 TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 2511
             LNDHLEENKKLIM+NLT  TSAVI+QEM LFEPKRVKWE+SFDLIN+CDSMNNEFYN+M
Sbjct: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840

Query: 2512 ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILK 2691
            ATTLSQIK+TVDTSSNSMNKSISVMKGQVEESENA+S               +NKHTILK
Sbjct: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900

Query: 2692 DNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLR 2871
            DNIE+SITST+SHITNIDDIY+TIE IM NYGNKENA K+EMI+N+L EIP+LSKR+PLR
Sbjct: 901  DNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960

Query: 2872 LSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
            +SNTN NS QNI+SPKKHAI+DEN SN   D E SRKI KTE
Sbjct: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
            Anc_6.16 YEL061C
          Length = 958

 Score =  901 bits (2329), Expect = 0.0
 Identities = 482/939 (51%), Positives = 625/939 (66%), Gaps = 4/939 (0%)
 Frame = +1

Query: 97   EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
            EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 13   EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 277  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
            +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 73   EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 457  AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
            AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL            E    +KL
Sbjct: 133  AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQ--------EIASSRKL 184

Query: 637  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXXXXXXXXXX 816
            RIFD                           +   P A  LRKR +T             
Sbjct: 185  RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP----------- 233

Query: 817  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 996
                                          +S     DQ+ GIYIQNLQ+FHITNA EG+
Sbjct: 234  ---------------------------SVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGI 266

Query: 997  NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 1176
             LLQ+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RS
Sbjct: 267  KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRS 326

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 1356
            GA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 327  GAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIAT 386

Query: 1357 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 1536
            ISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILVKNIT ELAKIK+DLLSTKSK
Sbjct: 387  ISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSK 446

Query: 1537 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQME 1716
            EGIYMSQD+YK L +DLESYK EV+ECKR IE                      Q  +++
Sbjct: 447  EGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQ 506

Query: 1717 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 1896
            +++  ++ L ++ +KQ+K E  +    + L+     MQ  +++++RRE D+  K     +
Sbjct: 507  NMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFN 566

Query: 1897 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK 2076
             E   +K T+ S +  +EQ    +   +Q N+D I+ E+  L+E  Q++ + MYKDCV+K
Sbjct: 567  NEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEK 626

Query: 2077 ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 2256
            IL+E+P  F +  EK+  +       + ++ ENLSD+SEE NNL+QYL +HFFKNNH+E+
Sbjct: 627  ILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEI 686

Query: 2257 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 2436
            L  HID TY  I+    +  + FK  +++HLE+NK L++++L  AT  VI +EM LFEP+
Sbjct: 687  LVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQ 746

Query: 2437 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 2616
            + KWE+SF  INKCDS+N  F N + + L  IK+T+ +S  ++NK+I+ +K Q++E E+ 
Sbjct: 747  KKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESP 806

Query: 2617 VSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE 2796
             S               +NK ++L ++++ S+  T  H   +D + + I++++   G+  
Sbjct: 807  ASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSM 866

Query: 2797 NAVKNEMIDNILKEIPSLS----KRVPLRLSNTNGNSAQ 2901
               + E +D IL+ +   +     R PLR +N   N ++
Sbjct: 867  EGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSE 905

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
            some similarities with uniprot|P27895 Saccharomyces
            cerevisiae YEL061C CIN8 Kinesin motor protein involved in
            mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  877 bits (2265), Expect = 0.0
 Identities = 472/939 (50%), Positives = 621/939 (66%), Gaps = 10/939 (1%)
 Frame = +1

Query: 85   GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 264
            G   EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K 
Sbjct: 9    GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68

Query: 265  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
            Y VDKVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 69   YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128

Query: 445  LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPF 624
            LSD+AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD           E   
Sbjct: 129  LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDD--------SVENSS 180

Query: 625  MKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXXXXXX 804
            M+KLRI+D                             L     + R+R+RT  L      
Sbjct: 181  MRKLRIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAK 232

Query: 805  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEFHITNA 984
                                              R      D  +G+YIQNLQ+FHIT+A
Sbjct: 233  QQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQ--QDSPSGVYIQNLQDFHITSA 290

Query: 985  MEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSEN 1164
             +GL LLQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSEN
Sbjct: 291  RDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSEN 350

Query: 1165 INRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTA 1344
            I+RSGA +QRAKEAGSINQSLLTLGRVIN+LADKS H+PFRESKLTRLLQDSLGGNTKTA
Sbjct: 351  ISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTA 410

Query: 1345 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLS 1524
            LIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKDILVKNIT ELAK+KSDLLS
Sbjct: 411  LIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLS 470

Query: 1525 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQN 1704
            TK +EG+YMSQD+YK + +DLESYK E+QE KR IE                    + Q 
Sbjct: 471  TKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQR 530

Query: 1705 SQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFE 1884
             +++++K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ +
Sbjct: 531  IKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQ 590

Query: 1885 THISKEIKSLKTTLFSQLSGMEQNNI-------SQETNIQPNLDIIKNEVLTLMETMQEK 2043
              + +E    +  L + +  +  N+         ++  IQ NL++++ EV+ L+   Q++
Sbjct: 591  MILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKR 650

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
            AE MYKD ++KIL E+P  F  I  K+D + V    ++  + ENLSDISE  NNLKQY  
Sbjct: 651  AEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFN 710

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
            +HFFKNNH+E+LN HID TY+ ++      ++ FK  ++DHL++NK L+M++L +AT+  
Sbjct: 711  DHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEA 770

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 2583
            I++EM LFEP+R KWE SFDLIN CDS++N F  +M + LS IK+T  +S++ +++S+S 
Sbjct: 771  IDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSK 830

Query: 2584 MKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTI 2763
            +K +V+  E+A +               +NK + L++ +  SI S+  HI+  D++ + I
Sbjct: 831  VKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERI 890

Query: 2764 ENIMKNYGNKENAVKNEMIDNILKEIPSL---SKRVPLR 2871
             N + +    EN+  ++   N +   P L   S+R PL+
Sbjct: 891  RNTIAS----ENSTLHQ---NKIATTPPLGQNSERSPLK 922

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
            Anc_6.16
          Length = 1004

 Score =  848 bits (2192), Expect = 0.0
 Identities = 468/909 (51%), Positives = 606/909 (66%), Gaps = 15/909 (1%)
 Frame = +1

Query: 100  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDK 279
            ELNITVAVRCRGRNEREI  KS VVV VPDITG++E+SINTTG+TGITAQMN+K YTVDK
Sbjct: 28   ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 280  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LSD 453
            VFGP A QDLIF EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  LSD
Sbjct: 88   VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 454  AAGIIPRVLLKLFDTLELQQN--------DYVVKCSFIELYNEELKDLLDXXXXXXXXXG 609
            AAGIIPR+L KLFDTL+  ++        D+VVKCSF+ELYNE+LKDLL+          
Sbjct: 148  AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 610  FEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLX 789
             +    +KLRIFD                           ++ + +A+      RT S+ 
Sbjct: 208  -QQLGSRKLRIFDSTNNNNNNSN-----------------SNASSRASSRNNSPRTSSIL 249

Query: 790  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEF 969
                                                    S   P++ +NGIYIQNLQEF
Sbjct: 250  PNANATNLAMRKKSIRYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEF 309

Query: 970  HITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDL 1149
            HITNA EGL+LLQ+GLKHRQVASTKMNDFSSRSHTIFTITLYK+H+D LFR+SKMNLVDL
Sbjct: 310  HITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDL 369

Query: 1150 AGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGG 1329
            AGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LADKS H+PFRESKLTRLLQDSLGG
Sbjct: 370  AGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGG 429

Query: 1330 NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIK 1509
            NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I+KDIL+KNIT ELAK+K
Sbjct: 430  NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVK 489

Query: 1510 SDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXT 1689
            SDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR IE                   
Sbjct: 490  SDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEV 549

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
             + Q  ++ +LK +++ L  +L+ Q+  E ++     +L+K  E +   +++Y+ ++  L
Sbjct: 550  NELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQL 609

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAE 2049
              +    +++ +  LK  L S    + Q+      +++ NL +IK+E+ +++E  Q K E
Sbjct: 610  KTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIKDEITSMLEKTQHKTE 667

Query: 2050 LMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNH 2229
            +MYK+ +++ L ++P     I E +  +      +YN I ENLSDISEE NNLKQYL N 
Sbjct: 668  MMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDND 727

Query: 2230 FFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVIN 2409
            FF+NNH++LLN HI++T + + + ++E    FK  ++ HL ENKKL++ N   AT+ VI 
Sbjct: 728  FFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVIT 787

Query: 2410 QEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK 2589
            +EM+LF+PKR KWE S +LIN+CDS+NN F++NM   +S+IK  + +SS+S++ +I+ +K
Sbjct: 788  KEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIK 847

Query: 2590 GQV-----EESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY 2754
             QV      +  +  +               + K+ IL+ N +N+I  T   + NID++ 
Sbjct: 848  SQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELS 907

Query: 2755 DTIENIMKN 2781
            +T++  + N
Sbjct: 908  ETVKIALNN 916

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
            Kinesin-like protein
          Length = 988

 Score =  824 bits (2128), Expect = 0.0
 Identities = 459/936 (49%), Positives = 602/936 (64%), Gaps = 8/936 (0%)
 Frame = +1

Query: 97   EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
            EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K YTVD
Sbjct: 30   EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 277  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
            KVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL DA
Sbjct: 90   KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 457  AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
            AGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD                KKL
Sbjct: 150  AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------KKL 203

Query: 637  RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXXXXXXXXXX 816
            RIFD                           N    +A +LR++L   +           
Sbjct: 204  RIFDSNVNGTSASGSSSRSSSRNNSPRSAPDNS---RAQMLRRKLGRHNTTGNSKISNNN 260

Query: 817  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQ------SNGIYIQNLQEFHIT 978
                                           +S   N Q      S  IYIQNL+EFHIT
Sbjct: 261  HNKFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHIT 320

Query: 979  NAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGS 1158
            +AMEGL LLQ+GLK RQVASTKMNDFSSRSH+IFTITLYK+   ELFR+SKMNLVDLAGS
Sbjct: 321  SAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGS 380

Query: 1159 ENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTK 1338
            ENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKLTRLLQDSLGGNTK
Sbjct: 381  ENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTK 440

Query: 1339 TALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDL 1518
            TALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV++IT ELAKIKSDL
Sbjct: 441  TALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDL 500

Query: 1519 LSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS 1698
            LSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IE                      
Sbjct: 501  LSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNAC 560

Query: 1699 QNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKK 1878
              + + SLK  +  L++ L +Q   E  I      +Q   E M+  +  ++ ++ +L + 
Sbjct: 561  YKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQS 620

Query: 1879 FETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMY 2058
              T IS EI +++ TL   +  ++ N   ++T I  NL  ++ EV+ +++  +E+A   Y
Sbjct: 621  ISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSY 680

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
             +CVK +L E+P+ F  +  ++D I    +  ++ IAE LSD+SEE NNLKQYL N+FFK
Sbjct: 681  GECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFK 740

Query: 2239 NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEM 2418
            NNH+ELL+HH+ +TY  +E+ +++ ++NF   L+ H++ENK+ +++N+   T  VIN E+
Sbjct: 741  NNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNEL 800

Query: 2419 DLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQV 2598
             +F  +R KWE S  LIN+CDS+N+ F+  + + L +I++ V +S +++  +IS ++ + 
Sbjct: 801  QMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRT 860

Query: 2599 EESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMK 2778
               ++                    K+  L    E+S  +  + I +++ +   ++ IM 
Sbjct: 861  RNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATTSIGSVNKVEGNLKVIMD 920

Query: 2779 NYGN--KENAVKNEMIDNILKEIPSLSKRVPLRLSN 2880
               N  + +  K E+ D  L  +    +++PL ++N
Sbjct: 921  KVLNDPQLSRGKAEVPDEELHRL----EKIPLGITN 952

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  597 bits (1539), Expect = 0.0
 Identities = 315/637 (49%), Positives = 431/637 (67%), Gaps = 6/637 (0%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 341  DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 1284
            Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LAD++ HIPF
Sbjct: 401  QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
            RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I K
Sbjct: 461  RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 1644
            DIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE    
Sbjct: 521  DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580

Query: 1645 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 1824
                            + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   + 
Sbjct: 581  QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 2004
             +  +++Y+ +++D+  K E  +  ++ SL+  L    + ++  N   + +I  NLD+I+
Sbjct: 641  FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQ 700

Query: 2005 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 2184
            NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  Q  +  +A+NLSD
Sbjct: 701  NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760

Query: 2185 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
            ISEE NNLKQYL  + F+NNH++L+N HI+ST + +          FK+ +N HLE N+ 
Sbjct: 761  ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            L++ +   AT  VIN+EM+LF P++ KWE S DLIN+CDS+NN F   +   LS  ++ +
Sbjct: 821  LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880

Query: 2545 DTSSNSMNKSISVMKGQVE------ESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIEN 2706
              S N M  + + +K ++        S N  +                 K++I +DN+EN
Sbjct: 881  TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940

Query: 2707 SITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM 2817
            S+    + + N++ + D+I+  +++   K    + E+
Sbjct: 941  SLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEV 977

 Score =  280 bits (717), Expect = 9e-79
 Identities = 143/184 (77%), Positives = 154/184 (83%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           EELNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVD
Sbjct: 50  EELNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVD 109

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++
Sbjct: 110 KVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSES 169

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+LKDLL+               + KL
Sbjct: 170 AGIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSN---INKL 226

Query: 637 RIFD 648
           RIFD
Sbjct: 227 RIFD 230

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..12123)
            [3015 nt, 1005 aa]
          Length = 1004

 Score =  592 bits (1527), Expect = 0.0
 Identities = 315/702 (44%), Positives = 463/702 (65%), Gaps = 6/702 (0%)
 Frame = +1

Query: 910  SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 1089
            SS    D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI 
Sbjct: 292  SSTVSPDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTIN 351

Query: 1090 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
            LYK+H  ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+
Sbjct: 352  LYKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 411

Query: 1270 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1449
             HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG
Sbjct: 412  IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLG 471

Query: 1450 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 1629
            + I KDILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECKR I
Sbjct: 472  SIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVI 531

Query: 1630 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 1809
            +                      Q  +++S+K +I+ L   ++KQH+ E  +     KL+
Sbjct: 532  DGLTTQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLK 591

Query: 1810 KLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPN 1989
              +  MQ  ++ +  RE     K +   ++E+  LK+ L   L  + +  +   T++  N
Sbjct: 592  SKSIEMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMN 651

Query: 1990 LDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIA 2169
            ++ IK+EV ++++T Q +A  +YKDC+++++ ESP     + + I  ++     +   ++
Sbjct: 652  IEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLS 711

Query: 2170 ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHL 2349
             ++S+++ E+N+LKQYL   FFK++H+E+LN HI+ TY++I + ++  VE  K  L  +L
Sbjct: 712  ISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYL 771

Query: 2350 EENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQ 2529
            EE++ +I+ +L N TS ++  EM+LF PK+ KWE+SF++INKCDS+NN+++ +++  LS 
Sbjct: 772  EESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSN 831

Query: 2530 IKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENS 2709
            +K +V ++S+ ++  +S M+   + +  +                 + K++ L+ ++  S
Sbjct: 832  MKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNES 891

Query: 2710 ITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIP----SLSK--RVPLR 2871
            IT   S I   D + ++I +  + Y       + +   N++K+      SL +   +PL 
Sbjct: 892  ITMNESSINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQNKDGDISLDRVEMLPLS 951

Query: 2872 LSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
                + N   ++LSP K  ++  + + +I   +  +++  TE
Sbjct: 952  PIFFSENKNNHVLSPSKVVVN--SSAKKIQASKYQKRLNSTE 991

 Score =  270 bits (689), Expect = 2e-75
 Identities = 135/184 (73%), Positives = 150/184 (81%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD                KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAI-------NSTAKKL 183

Query: 637 RIFD 648
           RIFD
Sbjct: 184 RIFD 187

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 948

 Score =  590 bits (1520), Expect = 0.0
 Identities = 325/694 (46%), Positives = 444/694 (63%), Gaps = 3/694 (0%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255  SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 1284
              E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 315  NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
            RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 375  RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 1644
            DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE+YK EVQECKR+IE    
Sbjct: 435  DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 1645 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 1824
                            + Q  +++ L   I  L  ++DKQHK E ++    + L+     
Sbjct: 495  QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 2004
            +Q +L++ +  +L    + E  +   + S K ++  QL+ M+ ++ S+   I  N+DII+
Sbjct: 555  VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 2005 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 2184
             E+  ++E++   +  + + CV+KIL  +PK F  I   +  I      + N + +NL D
Sbjct: 615  EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 2185 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
            ISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   E    FK  ++ HLEENK 
Sbjct: 675  ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            L++++L  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + +   L +++  +
Sbjct: 735  LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 2545 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 2724
            + S      +   +K  +++ +                     KHT L+D +E     T 
Sbjct: 795  EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVER----TS 850

Query: 2725 SHITNIDDIYDTIENIMKNYGNKE---NAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNS 2895
            S+I   ++ ++ I+  ++   +K+   + V N  + N++ E   L K     + + +   
Sbjct: 851  SYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLE--QLGKTHLKPIGSASRTP 908

Query: 2896 AQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 2997
            +   +SP K    D N  N I+  +  RK+ +TE
Sbjct: 909  SSRSVSPMKTL--DNNIFNGISPSK--RKVDETE 938

 Score =  276 bits (706), Expect = 6e-78
 Identities = 140/184 (76%), Positives = 153/184 (83%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           E   +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186

Query: 637 RIFD 648
           RIFD
Sbjct: 187 RIFD 190

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
            uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
            protein CIN8 and some similarites with YEL061C
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 965

 Score =  579 bits (1493), Expect = 0.0
 Identities = 312/676 (46%), Positives = 438/676 (64%), Gaps = 10/676 (1%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263  NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 1284
              E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 323  NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
            RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 383  RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 1644
            DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R+IE    
Sbjct: 443  DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 1645 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 1824
                          TI+SQ  Q+ +L+ +++ L  ++D +HK E+E++    KL+     
Sbjct: 503  QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 2004
            MQ AL+ ++  E  L    +  +   I   +  + ++L  ++Q  + Q   I  +++ +K
Sbjct: 563  MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 2005 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 2184
            + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +        + + E LS 
Sbjct: 623  DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 2185 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
            I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +    N ++DH+E+N+ 
Sbjct: 683  ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            L+M  L  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K+ +
Sbjct: 743  LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 2545 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 2724
            +++    +     +K  +   ++                   NKH++L+D +E +++  H
Sbjct: 803  ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862

Query: 2725 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPS-------LSKRVPLR---L 2874
            +       I  +++ IM N+   E   +  + D+++K I S        S + PLR    
Sbjct: 863  ASSEGFKAIDSSLKRIM-NFRMPEGKTET-LADDLIKHIDSSSVAPVASSGKTPLRPLLK 920

Query: 2875 SNTNGNSAQNILSPKK 2922
            S T   S    +SP K
Sbjct: 921  SETKQRSLSKSVSPAK 936

 Score =  273 bits (699), Expect = 7e-77
 Identities = 136/184 (73%), Positives = 155/184 (84%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+MN+K YTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS+A
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD            G   +KL
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG------GNNSRKL 184

Query: 637 RIFD 648
           RI+D
Sbjct: 185 RIYD 188

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
            YEL061C
          Length = 963

 Score =  576 bits (1484), Expect = 0.0
 Identities = 312/680 (45%), Positives = 448/680 (65%), Gaps = 16/680 (2%)
 Frame = +1

Query: 913  SMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1092
            S   +DQ+ GIYIQNLQEFHIT A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL
Sbjct: 280  STIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL 339

Query: 1093 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 1272
            +K+ + E+FR+SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+LADK+ 
Sbjct: 340  FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV 399

Query: 1273 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 1452
            H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+
Sbjct: 400  HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGS 459

Query: 1453 FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIE 1632
            FIMKDIL+KNIT EL KIKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IE
Sbjct: 460  FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE 519

Query: 1633 XXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG----FNN 1800
                                + Q  +++++  ++ +L A++++Q   E E+ G    F  
Sbjct: 520  SLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTK 579

Query: 1801 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
               KLT+I    + + K RE  +N KF+T +   +  +   L  Q+   +   I+Q   +
Sbjct: 580  TNSKLTKI----IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTV 635

Query: 1981 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 2160
              NL +IK+E+  L+ T ++  E  Y++C+ K L+++P  F+ I + +  ++     +Y+
Sbjct: 636  DENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYS 695

Query: 2161 NIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 2331
             IAENLSD+SEE NN KQ++ + F+   K +  ELLN +I++T   IE  +++ +   +N
Sbjct: 696  QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQN 755

Query: 2332 TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 2511
             LN+HL  NK+LI+ +L+N T+ +++ E+D  +PK  KWE S +LIN+ D++NNEF +N+
Sbjct: 756  LLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNV 815

Query: 2512 ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVN---KHT 2682
             ++++ + + +  +++S+N +I  +    + ++ A S                +   K++
Sbjct: 816  ESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNS 875

Query: 2683 ILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE------NAVKNEMIDNILKEIP 2844
             L + ++     T+  +  ++++  +I  ++K+   ++      + +K     +    IP
Sbjct: 876  RLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIP 935

Query: 2845 SLSKRVPLRLSNTNGNSAQN 2904
              + +    L+N N N  QN
Sbjct: 936  LDNDKKRSFLNNANDNEMQN 955

 Score =  266 bits (680), Expect = 2e-74
 Identities = 137/184 (74%), Positives = 151/184 (82%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GS+EV+INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL             G F KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 188

Query: 637 RIFD 648
           RIFD
Sbjct: 189 RIFD 192

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
            (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  555 bits (1429), Expect = 0.0
 Identities = 300/676 (44%), Positives = 425/676 (62%), Gaps = 7/676 (1%)
 Frame = +1

Query: 916  MAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 1095
            ++P + S+ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LY
Sbjct: 229  VSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288

Query: 1096 KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH 1275
            KK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS H
Sbjct: 289  KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348

Query: 1276 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAF 1455
            IPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+F
Sbjct: 349  IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408

Query: 1456 IMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEX 1635
            IMKD+L+K++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE+YK EV+ECKR +E 
Sbjct: 409  IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468

Query: 1636 XXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKL 1815
                               +SQ  ++  L   I  L  ++D+QHK E E+S    +L + 
Sbjct: 469  VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528

Query: 1816 TEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLD 1995
               MQ +L+ Y+ +    + + E  +   I S K +L  ++  ++ N      +++ N+D
Sbjct: 529  LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVD 588

Query: 1996 IIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAEN 2175
             +  E+  + + M      ++++ +KK+ +++P +F  I  +++ I      + +N+  +
Sbjct: 589  AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIH 648

Query: 2176 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEE 2355
            LS ISEE NNLK YL  HFFKNN QE L+ H+D TY  ++   +      +  LN+ L+ 
Sbjct: 649  LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708

Query: 2356 NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIK 2535
            NK+ +MQ+L +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I 
Sbjct: 709  NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768

Query: 2536 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSIT 2715
             T+D    +   +    K ++     A S                 KH +LK  +++S  
Sbjct: 769  KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828

Query: 2716 STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSL-------SKRVPLRL 2874
               +      +I ++I++++      +   +N  ID +L+++          S + P+R 
Sbjct: 829  YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENP-IDGLLEQLNDKSLKPLGPSGKTPMRT 887

Query: 2875 SNTNGNSAQNILSPKK 2922
               +  +   +L P+K
Sbjct: 888  VQRSVTNTDQLLPPQK 903

 Score =  271 bits (693), Expect = 3e-76
 Identities = 137/185 (74%), Positives = 153/185 (82%)
 Frame = +1

Query: 94  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 454 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKK 633
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           +    KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175

Query: 634 LRIFD 648
           LRIFD
Sbjct: 176 LRIFD 180

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
            YEL061C
          Length = 950

 Score =  532 bits (1370), Expect = e-173
 Identities = 268/557 (48%), Positives = 387/557 (69%)
 Frame = +1

Query: 940  GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 1119
            GIYIQNL++FHI+ A EGL LLQRGL+ RQVA+TK+ND SSRSHTIFTITLYKK +D+L+
Sbjct: 269  GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328

Query: 1120 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 1299
            R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+LADKS HIPFRESKL
Sbjct: 329  RLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKL 388

Query: 1300 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 1479
            TRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+FI+KDIL+K
Sbjct: 389  TRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLK 448

Query: 1480 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXX 1659
            +++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K E+ E KR  +         
Sbjct: 449  DVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELL 508

Query: 1660 XXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLAL 1839
                        S  S++++L+  +  +  +L + +    ++S     + ++   ++  +
Sbjct: 509  GKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLI 568

Query: 1840 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT 2019
            + Y+++      KF+  +  E+ +L   + SQ   ++  N S    I  ++D I+ EV+ 
Sbjct: 569  EVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGEVMN 627

Query: 2020 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEEN 2199
            L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  +A N SD+SEE 
Sbjct: 628  LLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEF 687

Query: 2200 NNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQN 2379
            N  KQYL   FF+NNH E++  H D    +++K + + +++ +N++ ++L  N +++  +
Sbjct: 688  NTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNS 747

Query: 2380 LTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSN 2559
            + +    VIN+EMDLF PK+ KWE S DLIN+ DS++N+F NNM  ++  I + +  S+ 
Sbjct: 748  INDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNE 807

Query: 2560 SMNKSISVMKGQVEESE 2610
            SM++SIS +K  + E++
Sbjct: 808  SMDRSISTIKKHIIEND 824

 Score =  219 bits (559), Expect = 2e-58
 Identities = 117/213 (54%), Positives = 152/213 (71%), Gaps = 10/213 (4%)
 Frame = +1

Query: 40  SNNISNNLNAQIG-CHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSI 216
           +  + N+   +IG    +  +++NITVAVRCRGRN+REI  KS +VV VPD+T + EVSI
Sbjct: 3   TTGLGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSI 62

Query: 217 NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 396
           NT+G +GI AQ+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTST
Sbjct: 63  NTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTST 122

Query: 397 GKTYTMTGDEKL-YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDL 573
           GKTYTMTGD ++   G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DL
Sbjct: 123 GKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDL 179

Query: 574 LDXXXXXXXXXGFEGP--------FMKKLRIFD 648
           L          G E            KKLRIFD
Sbjct: 180 LS-EGQDDFSNGTENSSKQPESLNASKKLRIFD 211

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_6.16
            YEL061C
          Length = 1097

 Score =  536 bits (1380), Expect = e-173
 Identities = 291/586 (49%), Positives = 388/586 (66%), Gaps = 19/586 (3%)
 Frame = +1

Query: 910  SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 1089
            S  AP D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 324  SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382

Query: 1090 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
            LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+LADKS
Sbjct: 383  LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442

Query: 1270 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1449
             HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 443  IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502

Query: 1450 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 1629
            +FIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 503  SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562

Query: 1630 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 1809
            E                    + Q  Q+E     I +L   LD+ +K E  +     +L+
Sbjct: 563  ERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLK 622

Query: 1810 KLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS-------- 1965
             +   MQ  +++Y+ R+L++ +  +  +  E K LK  L   LS +  N I         
Sbjct: 623  NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIIS 682

Query: 1966 --------QETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 2121
                      +N Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 683  NNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740

Query: 2122 IDIIRVDFQ--RFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 2295
            I+I  +DFQ    +N I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE
Sbjct: 741  IEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIE 800

Query: 2296 KKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK 2475
              ++  + N    +N+    N KL  + L N  + ++ +E +  +P + KW  S ++IN 
Sbjct: 801  SFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINS 860

Query: 2476 CDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK-GQVEESE 2610
             D +NN F+N+M   + QI N +  S N +N SI+ +K  ++ E+E
Sbjct: 861  TDKINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENE 906

 Score =  267 bits (682), Expect = 5e-74
 Identities = 133/184 (72%), Positives = 152/184 (82%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSD+
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD                KKL
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT---------YKKL 179

Query: 637 RIFD 648
           RIFD
Sbjct: 180 RIFD 183

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 54/247 (21%), Positives = 107/247 (43%), Gaps = 12/247 (4%)
 Frame = +1

Query: 2176 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEE 2355
            L +I+ E N +K  L +   K+       H+         K+ +  +E++K  + +    
Sbjct: 511  LKNITTELNKIKSDLMSTRLKDGVYMSQQHY---------KELNNDLESYKTEVQESKRA 561

Query: 2356 NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNN---MATTLS 2526
            N++LI QN +       + E++  E +R++ E   + I +   + +E Y     +   + 
Sbjct: 562  NERLISQNGSLLKDKKASNELN--ELQRIQIEKKNEKIKELYEILDEHYKREDILVELIR 619

Query: 2527 QIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIEN 2706
            Q+KN V TS  S  ++      ++EES   +                 N +  + DN+++
Sbjct: 620  QLKN-VGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKS 678

Query: 2707 SITSTHSHIT---------NIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKR 2859
            SI S +S I          NID I +T   I+K    K   + +  I+ IL +IP++  +
Sbjct: 679  SIISNNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNK 738

Query: 2860 VPLRLSN 2880
              + +++
Sbjct: 739  FKIEINS 745

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
            YEL061C
          Length = 939

 Score =  526 bits (1355), Expect = e-171
 Identities = 282/684 (41%), Positives = 432/684 (63%), Gaps = 5/684 (0%)
 Frame = +1

Query: 943  IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR 1122
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F+
Sbjct: 238  IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFK 297

Query: 1123 ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLT 1302
            ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ADK+ HIPFRESKLT
Sbjct: 298  ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLT 357

Query: 1303 RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKN 1482
            RLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K+
Sbjct: 358  RLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKD 417

Query: 1483 ITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXX 1662
            +  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++          
Sbjct: 418  LNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLL 477

Query: 1663 XXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTEL----EISGFNNKLQKLTEIMQ 1830
                      + Q   +  +  T++ ++  L+ QHK E     E++    K  K    M+
Sbjct: 478  KDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK----MK 533

Query: 1831 LALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNE 2010
              +++Y  +E  +    ++  + E+  LK  L   L+G+ + N+  +TN++ N+ +IK++
Sbjct: 534  TVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDD 593

Query: 2011 VLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS 2190
            V++++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I 
Sbjct: 594  VISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIK 653

Query: 2191 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
            ++ + L +Y  N FFK+NH  ++N H+++T   IEK  S+  + F+  +    E+N+KLI
Sbjct: 654  QQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLI 713

Query: 2371 MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 2550
            ++NL   +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + +
Sbjct: 714  LENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQS 773

Query: 2551 SSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSH 2730
            S   + K ++ +K  V+   +                  ++K   L D+++ S+ ST + 
Sbjct: 774  SDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNS 833

Query: 2731 ITNIDDIYDTIENIMKNYGNKENAVKNEMI-DNILKEIPSLSKRVPLRLSNTNGNSAQNI 2907
            +   D+I  +I+    NY +K N  ++ ++   +  +I          L++TN N  +++
Sbjct: 834  LLVFDEICKSIQFAFANY-SKTNLQESALLKGRLFADIDP--------LNDTNLNKQESL 884

Query: 2908 LSPKKHAIDDENPSNEITDGEESR 2979
               K  A   +  + +++  +E++
Sbjct: 885  TFDKGDAKLTKENNEDMSSKDENK 908

 Score =  257 bits (656), Expect = 3e-71
 Identities = 128/186 (68%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGD--TGITAQMNAKRYT 270
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 271 VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 450
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 451 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMK 630
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL                +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---------IDSNNTKLK 183

Query: 631 KLRIFD 648
           KLRIFD
Sbjct: 184 KLRIFD 189

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
            similar to uniprot|P27895 Saccharomyces cerevisiae
            YEL061C CIN8 Kinesin motor protein involved in mitotic
            spindle assembly and chromosome segregation
          Length = 941

 Score =  521 bits (1341), Expect = e-169
 Identities = 287/678 (42%), Positives = 421/678 (62%), Gaps = 10/678 (1%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            ++ ++ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LY+K 
Sbjct: 231  SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKC 290

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 1284
              E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 291  NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 350

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
            RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMK
Sbjct: 351  RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMK 410

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 1644
            D+LVKN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE+YK EVQECKR IE    
Sbjct: 411  DVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLST 470

Query: 1645 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 1824
                            +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +    
Sbjct: 471  QNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRT 530

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQ---LSGMEQNNISQETNIQPNLD 1995
            MQ +L+ Y+ +      + E  + + I S K +L ++   L G E++      ++  N+D
Sbjct: 531  MQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF----DVDANID 586

Query: 1996 IIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAEN 2175
             +  E+  + + +      + +  + KI  ++P +   I  +++ I      + +++  +
Sbjct: 587  TLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMH 646

Query: 2176 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEE 2355
            LS ISEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   +      +  +N+ LE 
Sbjct: 647  LSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELET 706

Query: 2356 NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIK 2535
            NK+++MQ+L NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + +  + 
Sbjct: 707  NKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVF 766

Query: 2536 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSIT 2715
              ++        ++      +   ++A                   KH +LK  +++S +
Sbjct: 767  EKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSAS 826

Query: 2716 STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSL-------SKRVPLRL 2874
               +      +I D+I+ ++ +    +   +N  I+ +L+++          S + P+R+
Sbjct: 827  YMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRI 885

Query: 2875 SNTNGNSAQNILSPKKHA 2928
            +     S+  +  P+K +
Sbjct: 886  TQGCIASSDQLSLPRKRS 903

 Score =  269 bits (688), Expect = 2e-75
 Identities = 135/184 (73%), Positives = 152/184 (82%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           +    +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176

Query: 637 RIFD 648
           RIFD
Sbjct: 177 RIFD 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
            Ashbya gossypii ACR010C
          Length = 944

 Score =  520 bits (1339), Expect = e-168
 Identities = 275/642 (42%), Positives = 415/642 (64%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242  EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 1108 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 1287
             ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFR
Sbjct: 302  GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 1467
            ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 362  ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 1468 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 1647
            ILVK+I+ EL+K+KSD LSTK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR +E     
Sbjct: 422  ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 1648 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 1827
                           + Q+ ++  L+ TI  L  ++++QH+ E+++    +KL++    M
Sbjct: 482  NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 1828 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 2007
            + +LQ+Y+  EL L    +  + + I S + ++   L  ++   + +  +I  N+D I+ 
Sbjct: 542  KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 2008 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
                 +++++     M  + VK + ++    +    E +  +    Q +   +   L+++
Sbjct: 602  IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 2188 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
            +EENNN+K+YL  HF KNN+QE+L+  ++  Y   +  +   + +  + +  H+EE++ L
Sbjct: 662  TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 2368 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 2547
            ++ ++ +A S +I++E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K   D
Sbjct: 722  MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 2548 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 2727
             S  + +     ++  V   E  V                 +KH +L+D+ EN+I     
Sbjct: 782  NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKE 841

Query: 2728 HITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLS 2853
                 +++  +I+ I++    +   +K   I+ +L+ + S S
Sbjct: 842  SSKGFEEMDCSIKKIIREMSPEVGDIK--QIEALLERVNSRS 881

 Score =  269 bits (688), Expect = 2e-75
 Identities = 135/185 (72%), Positives = 152/185 (82%)
 Frame = +1

Query: 94  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 454 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKK 633
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD              + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTP----------DYSKR 187

Query: 634 LRIFD 648
           LRIFD
Sbjct: 188 LRIFD 192

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL061C
            (CIN8)
          Length = 945

 Score =  511 bits (1315), Expect = e-165
 Identities = 272/639 (42%), Positives = 406/639 (63%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 242  SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 1284
              ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPF
Sbjct: 302  DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
            RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MK
Sbjct: 362  RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 1644
            DILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR IE    
Sbjct: 422  DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481

Query: 1645 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 1824
                            + QNS+++ L+ TI  L  ++++QH  E E++   +KL++    
Sbjct: 482  QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 2004
            MQ +L+ Y+  EL L    +  + + I S + ++   L  ++ + + +  +I+ N++ I 
Sbjct: 542  MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601

Query: 2005 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 2184
                  +++++     M    VK I      +     E +  ++ +   + N +   L++
Sbjct: 602  TIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTE 661

Query: 2185 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
            ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  + + +    + +  H+EE++ 
Sbjct: 662  ISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRT 721

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            L++ ++ +  + +I+ E  LF+P R +W  S D IN+CD+ +  F     + L ++K   
Sbjct: 722  LMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELS 781

Query: 2545 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 2724
            D S  S   +++  K + +   + V                 +KH +L+D+ ++++    
Sbjct: 782  DASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFK 841

Query: 2725 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEI 2841
                  +D+  +I+ I+     +   +K+  ++ +++ I
Sbjct: 842  ESSKGFEDMDCSIKKIIHEMSPEVGDIKS--VETLMERI 878

 Score =  263 bits (673), Expect = 2e-73
 Identities = 132/184 (71%), Positives = 149/184 (80%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 457 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 636
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD                K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS----------SKRL 188

Query: 637 RIFD 648
           RIFD
Sbjct: 189 RIFD 192

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] {ON}
            complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  459 bits (1180), Expect = e-145
 Identities = 242/710 (34%), Positives = 414/710 (58%), Gaps = 22/710 (3%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            +++   YIQNL+EFHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ +
Sbjct: 252  EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311

Query: 1108 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 1287
             E+FR+SK N VDLAG+E+ ++    NQR K+   INQ +  L +++N+L +K   IPF+
Sbjct: 312  GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK 371

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 1467
            +SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+
Sbjct: 372  DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431

Query: 1468 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 1647
             L+K+I+ ELAK+KSDLLSTKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+     
Sbjct: 432  TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491

Query: 1648 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 1827
                           + Q  +++S++ +++ +   ++KQ + E ++    +KL++    M
Sbjct: 492  STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551

Query: 1828 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 2007
             + +  Y  RE  +  + +T  ++E+  LK+ L   L   E+N +     I+ NL+    
Sbjct: 552  NVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHE 611

Query: 2008 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
            E+  +++  + + + ++ DC+KK+  ESPK F+  ++ +  +       YNN+AE LSD+
Sbjct: 612  EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDV 671

Query: 2188 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
            SEE NNLKQY+   FFKNNH+ELL  +++ TY  ++K + +F+  F + L  +LE NK +
Sbjct: 672  SEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSV 731

Query: 2368 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 2547
            ++QN+ +ATS VI  EM+ F P++ KWE S +LI K    +NEF       + ++++T+ 
Sbjct: 732  LLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLK 791

Query: 2548 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 2727
             +S S+  ++S MK ++ E + A +               + K+ ILKD +  ++TST  
Sbjct: 792  GTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEE 851

Query: 2728 HITNIDDIYDTIENIMKNYGNKE----NAVKNEMIDNILKE--IPSL-SKRVPLRLSNTN 2886
             I   D + D+I N+ KN  +       ++  E+ D + ++   P++ +++ P+R S + 
Sbjct: 852  SIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVSP 911

Query: 2887 GNSAQNILS---------------PKKHAIDDENPSNEITDGEESRKIQK 2991
              ++  I S                 KH++D  +  ++I +G   +++ +
Sbjct: 912  SRTSPQIQSLMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVHR 961

 Score =  115 bits (289), Expect = 2e-25
 Identities = 71/187 (37%), Positives = 103/187 (55%), Gaps = 4/187 (2%)
 Frame = +1

Query: 100 ELNITVAVRCRGRNEREIG--MKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           E NI V  R +G+ + E G  ++  +++  P +       I   G          + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAVK----REFGM 60

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYNGELS 450
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L + E S
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 451 D-AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFM 627
             + G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL                +
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLL-----VDQHNSLLSASI 175

Query: 628 KKLRIFD 648
           KKLRI D
Sbjct: 176 KKLRIVD 182

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
            YEL061C
          Length = 982

 Score =  459 bits (1180), Expect = e-145
 Identities = 300/955 (31%), Positives = 491/955 (51%), Gaps = 16/955 (1%)
 Frame = +1

Query: 106  NITVAVRCRGRNEREIGMKSSVVVNVPDIT-GSEEVSINTTGDTGITAQMNAKRYTVDKV 282
            NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 9    NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 283  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELS 450
            +G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 64   YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 451  DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DXXXXXXXXXGFEGP 621
            +  G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL             G  G 
Sbjct: 123  ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 622  FMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXXXXX 801
              KKLRI D                           N      A++RKR+  +SL     
Sbjct: 183  TGKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPNNS 238

Query: 802  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEFHITN 981
                                                S  + +++ N IYIQNLQE  IT 
Sbjct: 239  ISNNTANNNRLSLSRTNSFSDY--------------SLQSSHERLNSIYIQNLQEITITE 284

Query: 982  AMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMNLVD 1146
              EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++ V+
Sbjct: 285  IEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVN 344

Query: 1147 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLG 1326
             AGSE  + + + N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  
Sbjct: 345  FAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFD 398

Query: 1327 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKI 1506
            G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L+K ++ EL K 
Sbjct: 399  GITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKT 458

Query: 1507 KSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXX 1683
            KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I                  
Sbjct: 459  KSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFE 518

Query: 1684 XTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRREL 1863
               + Q  ++++L+ TI+ L   L+KQ K E E+     KL  +   MQ +++ Y  +E+
Sbjct: 519  EINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEI 578

Query: 1864 DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEK 2043
             L  K +    KE+  LK +L S  + ++        N+  N+D IK E+L +    Q K
Sbjct: 579  HLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSK 638

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
             + +  +   ++L+ SPK+F  +   +  +    +  +N  +E LSDISEE NNL  Y+ 
Sbjct: 639  VKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYIN 698

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
            ++F K++H+EL++ +I+ TY +++  + EF ENFK  L+ ++E+N K + +++T+ TS +
Sbjct: 699  DNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEI 758

Query: 2404 INQEMDLFEPKRVKWE-NSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSIS 2580
            +  E+  F P++ KWE  S ++I   +    +  N  +  L+++ +   ++S     ++S
Sbjct: 759  VENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLLSESTSTSELFINNMS 818

Query: 2581 VMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDT 2760
             +K  VE  E                   +NK+  LKD I ++  S+ + I + D++ + 
Sbjct: 819  SIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEA 878

Query: 2761 IENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSA-QNILSPKK 2922
            ++N+ KN    + +  N+ ++  LKEI    ++  L +++++   A +  LSP K
Sbjct: 879  MQNVFKN--EMKESYSNDTLN--LKEIFEQMEQQKLGVNSSSKKKAYKQNLSPSK 929

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  284 bits (727), Expect = 6e-80
 Identities = 204/703 (29%), Positives = 357/703 (50%), Gaps = 46/703 (6%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 1105 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 294  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 1261 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
            D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQ 1611
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 414  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 473

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I+                    +   + + +  +  +   +++ K H T LE+  
Sbjct: 474  NLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHTNLELM- 532

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ--NNIS 1965
              N++    ++ Q   Q+      +L  K    + + + +L+++L +  S   Q  N ++
Sbjct: 533  --NEITLQRDLSQETSQEQYTTSQELQTKITQQVLQTLSTLQSSLMNYNSKFSQVINGVT 590

Query: 1966 QETNIQPNLDIIKNE--VLTLMETMQEKAELMYKDCV-------KKILNESPKFFNVIVE 2118
            +E +   N   +K++  + +L +T   +  +   + V       K   ++S   +N  + 
Sbjct: 591  EELSRNVNFHKLKHDSALESLFDTSANQLTIKLNELVNGISHSLKHFRDDSVSHYNKDLN 650

Query: 2119 KIDIIRVDFQRFYNNIAENLSD-----ISEENNNLKQYLKN-----HFFKNNHQELLNHH 2268
            ++ +    F +   N  +N  D     I    N + Q         +   +NHQ ++   
Sbjct: 651  EVYLSHKQFLKDLENDIKNCLDSIGSLIVASINEISQTCTTSLDSVNSLTSNHQFVVTEL 710

Query: 2269 IDSTYEDIEKKTSEFV--ENFKNTLNDHLEENKKLIMQNLTNATSAV---INQEMDLFEP 2433
            ++    +I+K   + +      N  +  L   KK   ++++     +    N+ ++  + 
Sbjct: 711  VEKQDLEIKKLKKDLITERRISNQFSQQLTRLKKYFQEHVSKTRVELYDEFNEFINNLKE 770

Query: 2434 KRVK-----WENSFDLINKCDSMNNEFYNNMATTLSQ----IKNTVDTSSNSMNKSISVM 2586
            K+ K     W  +  + N+ D+  NE Y +  T+L+Q        V  +S +++K ++ +
Sbjct: 771  KQSKLDQDIWHKTAAIFNETDNEVNEIYTDSITSLTQSAKATLQVVSQNSATLHKDLTCL 830

Query: 2587 KGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 2766
              ++     +++                   TI +   +N++++ +  + +I+   + I 
Sbjct: 831  SQKM-----SLNISSKLKSLPIETFLSKISQTICQSCGDNNMSTANPILVSIEKFQNMIF 885

Query: 2767 NIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNS 2895
            + ++    K  ++  E+I  I  EI S    + L L N N NS
Sbjct: 886  SDIELTNEKVMSLIGEIISQI--EIVSNKNNIDLTLINENFNS 926

 Score =  129 bits (324), Expect = 1e-29
 Identities = 73/164 (44%), Positives = 98/164 (59%), Gaps = 7/164 (4%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI V VRCR RN+REI  KSSVV++     G E +  N +  +  +++   K Y  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 107

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-------EKLYNGE 444
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 445 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
           L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE LKDLL
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLL 211

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (REAL)
          Length = 1113

 Score =  281 bits (718), Expect = 1e-78
 Identities = 217/736 (29%), Positives = 371/736 (50%), Gaps = 58/736 (7%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 1105 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1261 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
            D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQ 1611
            Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I+                    +   + +    +  +   +++ + H T LE+  
Sbjct: 475  NLREQIKKFKEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYSHFYSKIQQIHYTNLEL-- 532

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTL------FSQL----- 1938
             N   Q+     +   + Y   + ++  K    + + + SL+ +L      FSQ+     
Sbjct: 533  INQVTQQRDSSHENCQKQYTANQ-NMQLKISQQVLQTLNSLQNSLRNYNSKFSQVINGVT 591

Query: 1939 ----SGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2106
                + +  + ++ ++  +  ++   N ++  M  +       +KD      +   K  N
Sbjct: 592  EELTNSVNSHKVNHDSTFKSLMNTTANLLMIKMNELVLSISNSFKDFQSDFASHCNKDLN 651

Query: 2107 VIVEKIDI----IRVDFQRFYNNIAEN-LSDISEENNNLKQYLKNHFFKNNHQELLNHHI 2271
             I +   +    ++ D ++  ++I  + L+ I+E +++    L      N+   L+N H 
Sbjct: 652  DIYQSHKLLLRNLQSDIKKCLDSIGRSVLASINEISDSCSTNL------NSMNVLINKHE 705

Query: 2272 DSTYEDIEKKTSEFVENFKNTL-------NDHLEE--NKKLIMQNLTNATSAVINQEMDL 2424
                + IEKK SE ++  KN L       N+  E+    K   QN  + T   ++ E+D 
Sbjct: 706  SEVLKVIEKKDSE-IKKLKNDLVNERKISNEFSEQLTQLKWYFQNHVSRTRNELHDELDG 764

Query: 2425 F----EPKRVK-----WENSFDLINKCDSMNNEFYNNMATTLSQ-IKNTVDTSSNSMNKS 2574
            F    + K++K     W  +  + N+ D   N+ Y+    +L+Q ++  ++T S++    
Sbjct: 765  FINKLKDKQLKLDQDIWHKTTSVFNQTDIAVNKIYSESILSLTQDVEGALETVSHNNAAF 824

Query: 2575 ISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY 2754
               M G   E +  +S                  H I K++ +N     ++++   + + 
Sbjct: 825  TKNMTGLSHEMDVNISSKLKSLPIDRFLNEI--SHKICKNSGDN-----NNNVPESNPVL 877

Query: 2755 DTIENIMKNYGNKENAVKNE----MIDNILKEIPSLS--KRVPLRLSNTNGNSAQNIL-- 2910
            D+I+   +N    +NA+ NE    + D +   I +++    + L + N N NS  + +  
Sbjct: 878  DSIKK-FQNTICSDNALTNEKMMTLTDAVTSHIETIANENNINLTVMNENFNSLCSFILT 936

Query: 2911 SPKKHAIDDENPSNEI 2958
              +K+ I      NE+
Sbjct: 937  DYEKNIIQISKTQNEV 952

 Score =  132 bits (331), Expect = 2e-30
 Identities = 79/197 (40%), Positives = 109/197 (55%), Gaps = 10/197 (5%)
 Frame = +1

Query: 16  QNTIQERSSNNISNNLNA---QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVP 186
           + TI    S  +SN ++     I  +     + NI V VRCR RN+REI  KSSVV++  
Sbjct: 19  RKTIAHAPSPGLSNGMHTVTPPICNNNSTTSDSNIHVYVRCRSRNKREIDEKSSVVISTL 78

Query: 187 DITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNC 366
              G E +  N +  +  +++   K Y  D+VFG  + Q+ +F+  A    ++ + GYNC
Sbjct: 79  GPQGKEIILSNGSHQSYSSSK---KTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNC 135

Query: 367 TVLVYGMTSTGKTYTMTGDEKLYNGE-------LSDAAGIIPRVLLKLFDTLELQQNDYV 525
           T+  YG T TGKTYTM+GD  +           L + AGIIPRVL+ LF  L     +Y 
Sbjct: 136 TIFAYGQTGTGKTYTMSGDINILGDVQSTDKLLLGEHAGIIPRVLVDLFKELSTLNREYS 195

Query: 526 VKCSFIELYNEELKDLL 576
           VK SF+ELYNE LKDLL
Sbjct: 196 VKISFLELYNENLKDLL 212

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (REAL)
          Length = 1110

 Score =  278 bits (712), Expect = 6e-78
 Identities = 194/614 (31%), Positives = 315/614 (51%), Gaps = 56/614 (9%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 1105 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295  QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1261 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
            D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQ 1611
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I+                    +   + + +  +  +    ++ K H++ LE+  
Sbjct: 475  NLREQIKKFKEKYLNQLDINNFLQSEKEKLINIIRNFHVDFSNFNLEIQKIHRSNLEV-- 532

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ------ 1953
                + ++T+   L+ Q   RR+   N+  +  IS ++     TL + L           
Sbjct: 533  ----MTEITQQRDLS-QVNSRRQYTTNQNLQLEISNQVLQTLDTLQNSLMNYNSKFSQVI 587

Query: 1954 NNISQETNIQPN---------LDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2106
            N +++E ++  N         L+ + N    L+     +        +  I N+S   +N
Sbjct: 588  NGVTEELSLNVNSHKVKHDSTLESLFNTTANLLTIKMNELVSSISQSLANIRNDSLSHYN 647

Query: 2107 VIVEKIDIIRVDFQRFYNNIAENL--------SDISEENNNLKQYLKNHFFKNNHQELLN 2262
               + ++ I    QRF + +  ++        S I    N + Q    +   N+  +L +
Sbjct: 648  ---KDLNEIYQSHQRFLSKLQNDIKSCLDSIGSSILNSINEISQTCTTNL--NSMNDLTS 702

Query: 2263 HHIDSTYEDIEKKTSEFVENFKN-TLNDHLEENK--------KLIMQNLTNATSAVINQE 2415
            HH     E IEK+  + +E  KN  LN+    N+        K   QN  + T   ++ E
Sbjct: 703  HHQSVATEMIEKQHLQ-IEKLKNELLNERKVSNQFHKQSTRLKEYFQNHVSRTRTELDDE 761

Query: 2416 MDLFEPKRVK---------WENSFDLINKCDSMNNEFYNNMATTLSQ----IKNTVDTSS 2556
             + F  K  +         W+ +  + N+     N  +++  +TL++    I  TV  +S
Sbjct: 762  FNEFISKLKEKQSKLDQEIWQETESIFNETGKEVNAIHSSSISTLTENAETILQTVSHNS 821

Query: 2557 NSMNKSISVMKGQV 2598
                K ++ +  ++
Sbjct: 822  TVFTKDLTCLSDEM 835

 Score =  134 bits (336), Expect = 5e-31
 Identities = 85/207 (41%), Positives = 110/207 (53%), Gaps = 7/207 (3%)
 Frame = +1

Query: 49  ISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTG 228
           I NN NA          E NI V VRCR RN REI  KSSVV++     G E +  N + 
Sbjct: 41  ICNNSNA--------TSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSH 92

Query: 229 DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 408
            +  +++   K Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTY
Sbjct: 93  QSYSSSK---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTY 149

Query: 409 TMTGD-------EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 567
           TM+GD       +   N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 150 TMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLK 209

Query: 568 DLLDXXXXXXXXXGFEGPFMKKLRIFD 648
           DLL                 K++RIFD
Sbjct: 210 DLLSDNEDDDPT---ANDSKKQIRIFD 233

 Score = 37.7 bits (86), Expect = 0.20
 Identities = 98/512 (19%), Positives = 191/512 (37%), Gaps = 54/512 (10%)
 Frame = +1

Query: 1051 DFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 1230
            DFS+     F + + K H+  L  ++++         N  R    NQ  +   S NQ L 
Sbjct: 514  DFSN-----FNLEIQKIHRSNLEVMTEITQQRDLSQVNSRRQYTTNQNLQLEIS-NQVLQ 567

Query: 1231 TLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 1410
            TL  + N+L + +       SK ++++           L   ++  KV  + T  +L   
Sbjct: 568  TLDTLQNSLMNYN-------SKFSQVIN-----GVTEELSLNVNSHKVKHDSTLESL--F 613

Query: 1411 SKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKE--GIYMSQDHY-----K 1569
            +   N+         I  + LV +I+  LA I++D LS  +K+   IY S   +      
Sbjct: 614  NTTANLLT-------IKMNELVSSISQSLANIRNDSLSHYNKDLNEIYQSHQRFLSKLQN 666

Query: 1570 NLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKA 1749
            ++ S L+S  + +     +I                   ++ ++   +E   L I +LK 
Sbjct: 667  DIKSCLDSIGSSILNSINEISQTCTTNLNSMNDLTSHHQSVATE--MIEKQHLQIEKLKN 724

Query: 1750 QLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLF 1929
            +L  + K   +   F+ +  +L E  Q       R   +L+ +F   ISK +K  ++ L 
Sbjct: 725  ELLNERKVSNQ---FHKQSTRLKEYFQ---NHVSRTRTELDDEFNEFISK-LKEKQSKLD 777

Query: 1930 SQLSGMEQNNISQETNIQPN------LDIIKNEVLTLMETMQEKAELMYKDC-------- 2067
             ++   E  +I  ET  + N      +  +     T+++T+   + +  KD         
Sbjct: 778  QEI-WQETESIFNETGKEVNAIHSSSISTLTENAETILQTVSHNSTVFTKDLTCLSDEMN 836

Query: 2068 -----------VKKILNESPK----------------------FFNVIVEKIDIIRVDFQ 2148
                       + K LN+  +                      F NVI+  I++      
Sbjct: 837  INISSKLKSLPIGKFLNKISQTICESCGNNSSTADPILVSIKNFQNVIISDIELTNEKTV 896

Query: 2149 RFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFK 2328
               N I      +S++ NN+   + N  F +    +LN        D ++   +  +   
Sbjct: 897  SLINEIVSQTKIVSDK-NNIDLTIVNDNFNSLCSFILN--------DYKENVMQISKTQD 947

Query: 2329 NTLNDHLEENKKLIMQNLTNATSAVINQEMDL 2424
            + L+ H E  + L  Q +   T+  I + +++
Sbjct: 948  DVLSVHCENLRSLHRQGVKTITTHNIEKPVNI 979

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
            KIP1Kinesin-related motor protein required for mitotic
            spindle assembly, chromosome segregation, and 2 micron
            plasmid partitioning; functionally redundant with Cin8p
            for chromosomal but not plasmid functions
          Length = 1111

 Score =  273 bits (699), Expect = 3e-76
 Identities = 190/603 (31%), Positives = 314/603 (52%), Gaps = 47/603 (7%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235  NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 1105 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295  QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 1261 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
            D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355  DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQ 1611
            Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD    Y++ +  ++    ++ 
Sbjct: 415  QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIH 474

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I+                    +   + +++  +  +   +++ K H T LE+  
Sbjct: 475  NLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFYSEIQKIHHTNLELMN 534

Query: 1792 ----------------FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 1923
                            +N       +I Q  LQ     +  LN  + +  S+ IK +   
Sbjct: 535  EVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTLNTLQGSLN-NYNSKCSEVIKGVTEE 593

Query: 1924 LFSQLS---GMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESP 2094
            L   ++       + +    NI  NL  + N++  L+ ++    E+   D       +  
Sbjct: 594  LTRNVNTHKAKHDSTLKSLLNITTNL--LMNQMNELVRSISTSLEIFQSDSTSHYRKDLN 651

Query: 2095 KFFNVIVEKIDIIRVDFQRFYNNIAEN-LSDISEENNNLKQYLKN-HFFKNNHQELLNHH 2268
            + +    + +  ++ D +   ++I  + L+ I+E + N    L + +    N Q   +  
Sbjct: 652  EIYQSHQQFLKNLQNDIKSCLDSIGSSILTSINEISQNCTTNLNSMNVLIENQQSGSSKL 711

Query: 2269 IDSTYEDIEKKTSEFV--ENFKNTLNDHLEENKKLIMQNLTNATSAV---INQEMDLFEP 2433
            I     +I+K  ++ +      N  N  L E K+    +++   S     +N+ +D  + 
Sbjct: 712  IKEQDLEIKKLKNDLINERRISNQFNQQLAEMKRYFQDHVSRTRSEFHDELNKCIDNLKD 771

Query: 2434 KRVK-----WENSFDLINKCDSMNNEFYNNMATTLS-QIKNTVDTSSNS----MNKSISV 2583
            K+ K     W+ +  + N+ D + N+ +++   +L+   +NT+ T S +     N  IS+
Sbjct: 772  KQSKLDQDIWQKTASIFNETDIVVNKIHSDSIASLAHNAENTLKTVSQNNESFTNDLISL 831

Query: 2584 MKG 2592
             +G
Sbjct: 832  SRG 834

 Score =  135 bits (340), Expect = 2e-31
 Identities = 82/200 (41%), Positives = 113/200 (56%), Gaps = 10/200 (5%)
 Frame = +1

Query: 7   AENQNTIQERSSNNISNNLNAQIG--CH-GVPNEELNITVAVRCRGRNEREIGMKSSVVV 177
           A  + TI    S ++SN ++      C+ G    + NI V VRCR RN+REI  KSSVV+
Sbjct: 16  ANKRRTIAHAPSPSLSNGMHTLTPPTCNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVI 75

Query: 178 NVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKG 357
           +     G E +  N +  +  +++   K Y  D+VFG  + Q+ +F+  A    ++ + G
Sbjct: 76  STLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVFGAESDQETVFNATAKNYIKEMLHG 132

Query: 358 YNCTVLVYGMTSTGKTYTMTGD-------EKLYNGELSDAAGIIPRVLLKLFDTLELQQN 516
           YNCT+  YG T TGKTYTM+GD       +   N  L + AGIIPRVL+ LF  L     
Sbjct: 133 YNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNK 192

Query: 517 DYVVKCSFIELYNEELKDLL 576
           +Y VK SF+ELYNE LKDLL
Sbjct: 193 EYSVKISFLELYNENLKDLL 212

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 62/306 (20%), Positives = 123/306 (40%), Gaps = 16/306 (5%)
 Frame = +1

Query: 2017 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 2196
            ++  T Q    L    C+K  + E  K  N +    +   +   +   ++ E+ S + +E
Sbjct: 409  SIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDE 468

Query: 2197 NN----NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
             N    NL++ +K   FK N+   L+  I++  +  ++K    ++NF    ++   E +K
Sbjct: 469  QNLKIHNLREQIKK--FKENYLNQLD--INNLLQSEKEKLIAIIQNFNVDFSNFYSEIQK 524

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            +   NL      +  ++  L        ENS    N   +M  +    +  TL    NT+
Sbjct: 525  IHHTNLELMNEVIQQRDFSL--------ENSQKQYNTNQNMQLKISQQVLQTL----NTL 572

Query: 2545 DTSSNSMNKSIS-VMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKD------NIE 2703
              S N+ N   S V+KG  EE    V+               +  + ++        +I 
Sbjct: 573  QGSLNNYNSKCSEVIKGVTEELTRNVNTHKAKHDSTLKSLLNITTNLLMNQMNELVRSIS 632

Query: 2704 NSIT-----STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPL 2868
             S+      ST  +  ++++IY + +  +KN  N   +  + +  +IL  I  +S+    
Sbjct: 633  TSLEIFQSDSTSHYRKDLNEIYQSHQQFLKNLQNDIKSCLDSIGSSILTSINEISQNCTT 692

Query: 2869 RLSNTN 2886
             L++ N
Sbjct: 693  NLNSMN 698

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBL063W
            (KIP1)
          Length = 1129

 Score =  263 bits (673), Expect = 1e-72
 Identities = 210/712 (29%), Positives = 344/712 (48%), Gaps = 38/712 (5%)
 Frame = +1

Query: 919  APNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT--- 1089
            +PN  S  I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT   
Sbjct: 245  SPNGYS--IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNV 302

Query: 1090 --LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 1263
              ++    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D
Sbjct: 303  TKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 362

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1443
             S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 363  HSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQ 422

Query: 1444 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD----------LES 1593
            +   + K+  +     E+ +++ +L ++ SKEGIY++Q+ ++   S+          +++
Sbjct: 423  VNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEEQQAKIDN 482

Query: 1594 YKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT 1773
             + +++  K                        +    Q + L + IN + ++L+    T
Sbjct: 483  LQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLEDYEHT 542

Query: 1774 ELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ 1953
             + I   N KL +     +  + +    ++D  +     IS+EI SL             
Sbjct: 543  MIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISREITSL------------- 589

Query: 1954 NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKI-DI 2130
              IS    +Q   D  K  +  + E +QEK   + +   +  L+    F +   E++ DI
Sbjct: 590  --ISIRNVLQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFEEVTDI 647

Query: 2131 IRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSE 2310
            I+   +     + E++S++  E  +L          ++   LL     + +  ++K    
Sbjct: 648  IKATCENLVRTMDEHVSNMKLETTDL---------TSSCASLLEKECQALHGKLQK---- 694

Query: 2311 FVENFKNTLNDHLEE------NKKLIMQNLTNAT-SAVINQEMDLFEPKRVKWENSFDLI 2469
            +VE+ K  LN  L+E       K   M N+   T   +I+ + +L      +    FD+ 
Sbjct: 695  YVESMKQELNSTLQEMVRDLDMKASSMLNVVQCTKDGLISHKKELEADLESQKREHFDIA 754

Query: 2470 NKCDSMNNEFYNNMATTLSQ---------IKNTVDTSSNSMN---KSISVMKGQVEESEN 2613
               +    +        + +         +K  V+T     N     +S +KG +  S N
Sbjct: 755  QTMEEQLQKIVGKERQNIQESMKASYDFLMKQMVETELRQKNFEESIVSKVKGLLSHSNN 814

Query: 2614 AVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITS-THSHITNIDDIYDTIENI--MKNY 2784
             +S                       ++IEN+++S T S   ++ +    I  I   + +
Sbjct: 815  GMSKMSSYAVGRLYDSAIGG-----VNSIENTVSSATFSMKNDLQEFQMDISPICDSRRF 869

Query: 2785 GNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDE 2940
            G++  AV+  + + I +E+    + +  +  N  G   Q+I        DD+
Sbjct: 870  GDEFTAVETRISEAIREELTPKLQDITSKACNLIGLGVQDINQKALGVSDDQ 921

 Score =  140 bits (354), Expect = 4e-33
 Identities = 82/167 (49%), Positives = 102/167 (61%), Gaps = 8/167 (4%)
 Frame = +1

Query: 100 ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDK 279
           E NI V VRCR RNEREI  KSSVV++     G E +  N    TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTNP--GTG-----SNKTYTFDR 104

Query: 280 VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 444
           VFG  + Q+ +F++VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 445 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
              LS+ AGIIPRVL++LF  L     DY VK SF+ELYNE+L+DLL
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLL 211

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
            YBL063W
          Length = 1232

 Score =  264 bits (674), Expect = 1e-72
 Identities = 192/630 (30%), Positives = 322/630 (51%), Gaps = 73/630 (11%)
 Frame = +1

Query: 907  RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 1086
            ++  A N   + I ++ ++E +I +A EGL LL  G   R+VASTK+ND SSRSHTIFTI
Sbjct: 328  QNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTI 387

Query: 1087 TLYKKHQDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1251
                   D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN
Sbjct: 388  ITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVIN 447

Query: 1252 ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            AL D+S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IK
Sbjct: 448  ALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIK 507

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKN 1602
            N PQ+   + KD  +     E+ +++++L   ++KEGIY++QD    Y++ +  +   K 
Sbjct: 508  NTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQKA 567

Query: 1603 EVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELE 1782
            ++   +  I+                   ++      + L     ++   L K+++   +
Sbjct: 568  KIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLS-EKTKVIISLFKRYQENFK 626

Query: 1783 ISGFN-NKLQKLTEIMQLALQDYKRRELDLNKK-----------FETHISKEIKSLKTTL 1926
            I   N N++      +  +LQ++K + LDL  K            E   ++++ +LK +L
Sbjct: 627  IFNSNINQIHSSNLEVFDSLQNHKDK-LDLCSKKNIKTLKEIYIAEEKYTEQLNTLKASL 685

Query: 1927 FSQ-----------LSGMEQNNISQETNIQP-----NLDIIKNEVLTLMETMQ------- 2037
             S               ME N+I  E N++      +L ++  E+  + ET++       
Sbjct: 686  SSYSDRFMLVFSSVFDEMENNSIEFERNVKSKLSSLDLTMVVEEIKNMKETVEMICNNIL 745

Query: 2038 ---EKAELMYKDCVKKILNESPKFFNVIVEKI----DIIRVDFQRFYNNI---AENLSDI 2187
               +  +  YK+     L      FN++  K      ++  +F +F N+I     N  ++
Sbjct: 746  IASDTWDSSYKEVYNSHLMTLKNCFNMVEHKCANINQLMDENFSKFQNDIKSGVHNYKNV 805

Query: 2188 SEENNN---------------LKQYL-----KNHFFKNNHQELLNHHIDSTYEDIEKKTS 2307
            S ++ N               LK+ +      +   ++   +++++  D   +   K T+
Sbjct: 806  SSDHTNDMKHTIYEQSLEIEKLKEKIIIEQQNSKSVESRLNKVIDYFEDEILKSRRKITT 865

Query: 2308 EFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSM 2487
            + ++  K +  DHLE +K+++ + L+   +    ++ DL +            IN   S 
Sbjct: 866  DLIDTLKQSEKDHLELDKQILNRTLSGLRNFENEKQSDLQKS-----------INALTSK 914

Query: 2488 NNEFYNNMATTLSQIKNTVDTSSNSMNKSI 2577
             ++ + N++    Q+  T+D +S ++  +I
Sbjct: 915  FSDVFKNVSLVAEQLPLTIDLTSENLLTTI 944

 Score =  114 bits (285), Expect = 6e-25
 Identities = 76/220 (34%), Positives = 103/220 (46%), Gaps = 63/220 (28%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEV----------------SINTTGDTG 237
           NI V VRCR R +REI  KSSVV++     G++ +                S  T  +T 
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 238 ITAQM-----------NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 384
           +   +           N + YT DKVFG  + Q+ +F+ VA     + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 385 MTSTGKTYTMTGDEKLYNG-------ELSDAAGIIPRVLLKLF----------------- 492
            T TGKTYTM+GD  +           L + AGIIPRVL+ LF                 
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 493 ------------DTLELQQNDYVVKCSFIELYNEELKDLL 576
                       + + L+  +Y VK SF+ELYNE+L DLL
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar to
            Ashbya gossypii ACR228C
          Length = 1134

 Score =  256 bits (655), Expect = 2e-70
 Identities = 189/595 (31%), Positives = 305/595 (51%), Gaps = 33/595 (5%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT----- 1089
            N   + I ++ ++E +I +A EGL LL  G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249  NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 1090 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
            ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 309  IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 1270 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1449
             HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369  QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 1450 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 1629
              + K+  +     E+ K++ +L +  +KEGIY++++ Y+   S+       V+E +  I
Sbjct: 429  QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNCIL----VEEQQAKI 484

Query: 1630 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 1809
            +                   ++ +++Q++ +K +IN+              I+ +N KL 
Sbjct: 485  DNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIK-SINE-------------RITMYNKKLT 530

Query: 1810 KLTEIMQLALQDYKRRELDL---NKKFETHISKEIKSLKTTLFSQLSGMEQNN--ISQET 1974
               + ++  ++DY+ +  D+   N K   +++   +S+  +L S+   +E +N  + +E 
Sbjct: 531  DYLDKLRFRVEDYEIKVNDIHNNNMKLLLNLNNNRESIYDSLISKTKHIEMSNELLLKEV 590

Query: 1975 N----IQPNL--------DIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVE 2118
            N    I+  L         +I      L E MQ    L +++ +   L      F  I++
Sbjct: 591  NGLILIRDTLKSYNERFKTVITGVFHELQEKMQHVLHLSHQNNLNLDLGYVDAKFGEIIK 650

Query: 2119 KIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEK 2298
               ++    Q    N+ ++L+ +  E       ++N  +       L    D+ YE    
Sbjct: 651  ---VVEECSQSLLLNLDQSLAGMKSET------IQNAAYSTVE---LQRESDTLYE---- 694

Query: 2299 KTSEFVENFKNTLNDHLEENKK-----------LIMQNLTNATSAVINQEMDLFEPKRVK 2445
            +  EF+E  K  ++  L+   K           L+        S  +  + DL E K+  
Sbjct: 695  RLKEFIEKIKCEVDFSLQNVVKGIHTRGVDVIDLVRSTKDELVSGKLKLQSDLEEQKQKH 754

Query: 2446 WENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESE 2610
             E + D+ +  + +              I+     +S++M  S   +K Q+EE+E
Sbjct: 755  SEEAMDIQSCINQL--------------IEQERRRTSDTMKASYEFLKKQMEETE 795

 Score =  144 bits (362), Expect = 4e-34
 Identities = 83/172 (48%), Positives = 104/172 (60%), Gaps = 8/172 (4%)
 Frame = +1

Query: 85  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 264
           G   +  NI V VRCR RN REI  KSSVVV+     G E +  N +  TG     N K 
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKT 101

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           YT D+VFG  + Q+ +FD+VA     + ++GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 102 YTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGAS 161

Query: 445 LSDA--------AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
           L D         AGIIPRVL++LF  L+ +  DY VK SF+ELYNE+L+DLL
Sbjct: 162 LEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  251 bits (640), Expect = 2e-68
 Identities = 179/593 (30%), Positives = 304/593 (51%), Gaps = 48/593 (8%)
 Frame = +1

Query: 934  SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 1098
            S+ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239  SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 1099 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 1278
               ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D + HI
Sbjct: 299  VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 1279 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 1458
            P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359  PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 1459 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESYKNEVQECKRDI 1629
             KD  +     E+ +++ +L +++ K+GI ++QD +    S+   ++  K ++Q  +  I
Sbjct: 419  SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 1630 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 1809
            +                   ++    Q   LK    QL + L+         S  N+ ++
Sbjct: 479  QRFKDKYVKQTELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQ------SNSNHYIE 532

Query: 1810 KLTEIMQL---ALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
            ++T+I       +Q   ++  +L+    T++    +++      Q    E  N+ Q  N 
Sbjct: 533  RVTKIHDSNTHLIQQLAQQRSELHNGSITYVKSVTEAMSGISDQQKELSELRNVLQSYN- 591

Query: 1981 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNVIVEKIDIIRVDFQRFY 2157
                D  K+ +  +   +++K +   K  ++ + + + +   ++I E  D I   F+   
Sbjct: 592  ----DKFKHVITGIFTELEDKVKDTRKSTLEPLTSMNLRLILDMIGELRDDISTRFEMLK 647

Query: 2158 NNIAENLSDISEENNNLKQYLKNHF--FKNNHQELLN--------HHIDSTYEDIEKKTS 2307
                E+ + I + + ++ +   +H   + ++ +++L         H + S+++  + KT 
Sbjct: 648  KPRTEDTTKIFKAHQDIIETCFSHINEYCDSMEKVLTTSINQFQAHSLPSSFDIFQDKTK 707

Query: 2308 EFVENFKN------------------------TLNDHLEENKKLIMQNLTNATSAVINQE 2415
            + ++   N                         LN H++E +    + +T     +    
Sbjct: 708  KELDELMNIIKTQKQYAMNLEQQIIEEKKRSKRLNIHIKELQSYFEEFVTPQRQTMFQTI 767

Query: 2416 MDLFEPKRVK-WENSFDLINKCDS-MNNEFYNNMATTLSQIKNTVDTSSNSMN 2568
            +D+ E  R K  E    ++NK  + ++N    + AT    ++     SSNS+N
Sbjct: 768  IDMIENSRQKQHEVDMTILNKSQAILSNMDMESNATNEKNLQKLQIQSSNSLN 820

 Score =  131 bits (329), Expect = 3e-30
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 9/166 (5%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR-YTVDKV 282
           NI V VRCR RNEREI  KSSVV++      S ++ ++      +     AKR YT D+V
Sbjct: 60  NIKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNP----LLPLAYAKRTYTFDRV 115

Query: 283 FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------ 444
           FG  + Q+ +F++ A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+      
Sbjct: 116 FGAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTM 175

Query: 445 --LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
             L + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE LKDLL
Sbjct: 176 VLLGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLL 220

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
            Anc_7.387
          Length = 1186

 Score =  250 bits (639), Expect = 4e-68
 Identities = 205/710 (28%), Positives = 336/710 (47%), Gaps = 33/710 (4%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+ S+ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283  NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 1105 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
             D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 343  IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 1270 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1449
             HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403  QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 1450 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQECK 1620
              + KD  +     E+ +++ +L +++ K+GI ++QD    Y++    ++  K ++   +
Sbjct: 463  QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNME 522

Query: 1621 RDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 1800
              I+                   ++      + L+    QL   +D     ++  + F  
Sbjct: 523  EQIQKFKEKYVRQTELNKNLESNLKENEQVTKQLRSEKYQL---MDLLENYQINSNSFVQ 579

Query: 1801 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
            ++ ++ E     +Q+     LD  +    H S +  +     F+QLS      +  + ++
Sbjct: 580  RVLQIHESNIALIQN-----LDKERNRIHHNSTQYMNNMEETFNQLSIQRDELLRLKNSL 634

Query: 1981 QP---NLDIIKNEVLTLMET-----MQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR 2136
            Q    N + +   V   +ET      +E +  +    + K           + + ++++ 
Sbjct: 635  QSYNINFNDVMQSVFNELETNVVANQKETSNKLGSISLMKTFELLQNLELTLAKDLNLLN 694

Query: 2137 VDFQRFYNNIAENLSDISEE-NNNLKQYLKN-HFFKNNHQELLNHHIDSTYEDIEKKTSE 2310
              + R  N+   +   I EE  NN+    K+     +     LN ++ S+++D+E +T E
Sbjct: 695  EPYLRDTNHFLISHKTILEECYNNVHSCTKSMEGLISTQLTDLNGYLSSSFKDLEDQTIE 754

Query: 2311 FVENFKNTLNDHLEENKKLIMQNL-----TNATSAVINQEMDLFEPKRVKWENSF----- 2460
              E+ K  +    ++ + L  Q +     TN+ +  +      F+    K  ++      
Sbjct: 755  ETEDLKQVIISQQKKIQTLEHQFMKEKESTNSLNENLQSLKSYFQDHVSKERSNIFKDIK 814

Query: 2461 DLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXX 2640
            ++IN+ +    +               VD    S N      KG  E  +  +S      
Sbjct: 815  NIINQAEKKQTDL-------------DVDILQRSENVLTQFNKGLQERQDKQMS---SLL 858

Query: 2641 XXXXXXXXXVNKHT-----ILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV 2805
                     +N+HT      LK++ + + TS  + +  I  I  +   I+    ++ N  
Sbjct: 859  METIASLLSINEHTEKLPFTLKESFDRNKTSLETRVKEI-PIQKSFNEIITTVKDRTNI- 916

Query: 2806 KNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNE 2955
              E+ +N+ K I   +  +   L++    S QN        I +EN  NE
Sbjct: 917  --EVSNNLEKLITKFNTELTSGLTSKQ-ISIQNAFKTLHDTITEENQFNE 963

 Score =  134 bits (337), Expect = 4e-31
 Identities = 79/190 (41%), Positives = 105/190 (55%), Gaps = 7/190 (3%)
 Frame = +1

Query: 25  IQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSE 204
           I    SN+ +++    I          NI V VRCR R+EREI  KSSVV++     G++
Sbjct: 81  INSSPSNSTTSSSETNILSSSSSPSSTNIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQ 140

Query: 205 EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 384
            +  N +           K Y+ D+VFG  + Q+ +F++ A     + + GYNCTV  YG
Sbjct: 141 VILSNPSSPLSYPK----KSYSFDRVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYG 196

Query: 385 MTSTGKTYTMTGDEKLYNG-------ELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFI 543
            T TGKTYTM+GD  +           L + AGIIPRVL+ LF  L L +NDY VK SF+
Sbjct: 197 QTGTGKTYTMSGDLNILGNLESKDMILLGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFL 255

Query: 544 ELYNEELKDL 573
           ELYNE LKDL
Sbjct: 256 ELYNERLKDL 265

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1112

 Score =  249 bits (635), Expect = 8e-68
 Identities = 201/732 (27%), Positives = 352/732 (48%), Gaps = 53/732 (7%)
 Frame = +1

Query: 934  SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD- 1110
            S+ I ++ ++E +I +A EGL LL  G   RQVASTK ND SSRSHT+FTIT      D 
Sbjct: 249  SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 1111 ----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 1278
                E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S HI
Sbjct: 309  LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 1279 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 1458
            P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369  PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 1459 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY-----------------KNLNSDL 1587
             KD  +     E+ +++ +L +T++K+GIY++Q+ Y                  NL   +
Sbjct: 429  TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKYDLYESNCILVGEQKARIDNLEEQI 488

Query: 1588 ESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQH 1767
            + +K +  +     +                    Q   S ++ L+   N  + ++ + H
Sbjct: 489  KRFKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQLLESSLDYLQQKCNSFEHEITEIH 548

Query: 1768 KTELEISGFNNKLQKLTEIMQLALQDYK---------RRELDLNKKFETHISKEIKSLKT 1920
               L+I   ++ + +   I +  +Q Y+          +EL   K  +  ++   KS K 
Sbjct: 549  HKNLKI--LDSIVDERDTISEDLVQKYRYITETDHCITKELTTLKNVKKTLNNYNKSFKG 606

Query: 1921 TLFSQLSGMEQNNISQETNIQPNLDIIKNE-VLTLMETMQE---------KAELMYKDCV 2070
             L S    ++   I+     +  + ++  E ++   E +           K ++ +KD +
Sbjct: 607  VLKSVFQELQDKVINLSAVTEEQVRVVDTEGIINSFEDLNTSITKCIGKLKVKIDFKDLL 666

Query: 2071 KKILNES-PKFFNVIVEKIDIIRVDFQRFYNNIAENLS---DISEENNNLKQYLKNHFFK 2238
                +E+   + + + ++ + ++ +  R    +   +S   + +E  +     L     +
Sbjct: 667  LDETSEAVQSWISDLTKQHEALQDNLVRSIGELQREISARFEFTETTSKKSAELNLEVLE 726

Query: 2239 NNHQELLNHHIDSTYEDIEKKTSE-FVENFKNTLNDHLEENKKLIMQNLTNATSAVINQE 2415
                ++ N   +     I+K+ S+  ++  +    D +   ++ I +++TNA +     E
Sbjct: 727  AEKIKVKNLENNLQRARIDKENSDNLLQTLQTYFQDEVTRTRREIFKDITNAVNF---GE 783

Query: 2416 MDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQ 2595
              L E +    +NS  L++     +N  + N   +LSQ+  T  ++   + K+      +
Sbjct: 784  DRLKELELNILQNSTKLVSDSQKDSNLKHEN---SLSQLGKTASSAFEEVCKATEKSNAE 840

Query: 2596 VEESENAVSXXXXXXXXXXXXXXXVNKH-TILKDNIENSIT-STHSHITNIDDIYDTIEN 2769
              ++   +                 +K+  +L D  +N+++    S I  +    +   +
Sbjct: 841  YVDNLKILQTSVINSIVEIPVKQEFSKYQEVLSDGWKNNVSEKVSSKIYQVSKSLEESSS 900

Query: 2770 IMKNYGNKENAVKNEMIDNILKE----IPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDD 2937
            IM      E A    +I +++++    I ++  +V        GN ++ I +  K+ +D 
Sbjct: 901  IMYGSMLDETARSRRIISDLVEKQNHSIDTMKSQV--------GNLSKYIFNEYKNNVDQ 952

Query: 2938 -ENPSNEITDGE 2970
                 +EI +G+
Sbjct: 953  IATSQDEIVEGQ 964

 Score =  146 bits (368), Expect = 7e-35
 Identities = 78/167 (46%), Positives = 102/167 (61%), Gaps = 10/167 (5%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI V VRCR RN+REIG KSSVV++     G + +  N +  +  +     K YT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 444
           G  + Q+++F+ VA     + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 445 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
              LS+ AGIIPRVL+ LF  L+ +  DY VK SF+ELYNE LKDLL
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLL 220

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] {ON}
            similar to uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation
            functionally redundant with Cin8p
          Length = 1138

 Score =  247 bits (630), Expect = 4e-67
 Identities = 181/581 (31%), Positives = 294/581 (50%), Gaps = 34/581 (5%)
 Frame = +1

Query: 910  SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 1089
            SS + +  S+ I ++ ++E +I +A EGL LL +G   R+VA+TK ND SSRSHTIFTI 
Sbjct: 257  SSTSSSSSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIV 316

Query: 1090 LYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 1254
             +    D     +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINA
Sbjct: 317  THVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINA 376

Query: 1255 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1434
            L + S HIP+R SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN
Sbjct: 377  LVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKN 436

Query: 1435 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESYKNE 1605
             PQ+   + KD  +     E+ +++ +L +++ +EG+Y++Q+ Y    S+   +E  K  
Sbjct: 437  TPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKVV 496

Query: 1606 VQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT---- 1773
            +Q     I+                    Q      ++L++    +    +K H T    
Sbjct: 497  IQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKVCDTLRIQKKFMLETFEKYHTTCKEH 556

Query: 1774 ELEISGFNNKLQKLTEIMQLALQDYKRRELD---LNKKFETHI---SKEIKSLKTTLFSQ 1935
              +I   ++    L E +++   +     LD   L  K  T I   S+++ SLK  L  +
Sbjct: 557  AAQIDQIHSDNISLIESLRVERNEMSTSALDNAGLISKILTTIAERSEQLTSLKADLEVR 616

Query: 1936 LSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIV 2115
            +S  E+ + S        LD  +N +  +  +  +   L   D +++I        NV +
Sbjct: 617  ISDFERFSSSM------LLDFERNALSRINHSRDDLLSLEITDSLEQI-QAMHNSLNVTL 669

Query: 2116 EKI--------DIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL--LNH 2265
            + I        + I    +    N    L +  E+  N  + + N   K +  E+  L  
Sbjct: 670  QNIRKPWKKETEAIYYTHKNIIENCGNQLYEYVEKLENSLETIWNQLKKTSISEMGELRR 729

Query: 2266 HIDSTYEDI------EKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLF 2427
            + D   +D       E++  +F+EN     +  L+E+ + +    +     +I +  ++ 
Sbjct: 730  YGDQYTDDALALVHKERERLQFLENELLKKSQALKESNEQLESLQSYFKHHLIKERDEIL 789

Query: 2428 EPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 2550
            +       NS     +  S++++ +   +  L++ K  + T
Sbjct: 790  QETFKALRNS---ERRHKSLDDQMFEKSSVVLARTKEQMHT 827

 Score =  135 bits (339), Expect = 2e-31
 Identities = 77/164 (46%), Positives = 96/164 (58%), Gaps = 7/164 (4%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI V VRCR RN+REI  KSSVVV+     G   +  N +           K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPK----KTYMFDEVF 99

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 444
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++          
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 445 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
           L + AGIIPRVL+ LF  L  +  ++ VK SF+ELYNE LKDLL
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLL 203

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] {ON}
            Anc_7.387 YBL063W
          Length = 1151

 Score =  245 bits (625), Expect = 2e-66
 Identities = 203/644 (31%), Positives = 312/644 (48%), Gaps = 26/644 (4%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N+  + I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHTIFTIT     
Sbjct: 248  NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITK 307

Query: 1105 QD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
             D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 308  IDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHS 367

Query: 1270 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 1449
             HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+ 
Sbjct: 368  QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQIN 427

Query: 1450 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDL-ESYKNEVQECKRD 1626
              + KD+ +     E+ +++ +L +++ K+G+Y++Q+ +     DL ES    V E K  
Sbjct: 428  QSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF-----DLYESNGILVDEQKAK 482

Query: 1627 IEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG-FNNK 1803
            I                    ++ Q  + +   +    +  +L+   K   E+S    +K
Sbjct: 483  I------------------VNMEEQIKKFKEKYVNQTAINKELETSLKNSQELSNDLLDK 524

Query: 1804 LQKLTEIMQLALQDYKRRELDLNKKFETHIS--KEIKSLKTTLFSQLSGMEQNNISQETN 1977
               L  I      ++K  E ++N   E +++    I + +  L  QLS  +  +   ET 
Sbjct: 525  QASLISIFGEYQSNFKLFETEINTIHENNLNLIDLISTERNDL--QLSSQKYYDFLVET- 581

Query: 1978 IQPNLDIIKNEVLTLM--ETMQEKAELMYKDCVKKILNESPKFFNVIVEKI--DIIRVDF 2145
                   I+N++  ++  +T      + +K+ +  +  E         +KI  +   +DF
Sbjct: 582  ----FRTIENQMKFILQSQTTLSSYNIKFKEVIGGVFEELEDNTINFRKKILTETQELDF 637

Query: 2146 QRFYNNIAENLSDISEENNNLKQYLKNHFFK--NNHQELLNHHIDSTY---EDIEKKTSE 2310
                 +I E  + + E    L    K    K  ++H +++     ST    +DI     +
Sbjct: 638  SSTILSIEELDNCLQENIRVLTTPQKEQMEKIYSSHTDIIKGLYKSTIGSSDDIRHSMEQ 697

Query: 2311 FVENFKNTLNDHLEENKKLIMQNLTNATSAVINQE---MDLFEPKRVKWENSFDLINKCD 2481
            F+++     ND L   K   ++ +    + V  Q+   + L      + E S     K  
Sbjct: 698  FLQDLNLKTNDALVLAKTQYLKKIEELKTLVDTQKEQILSLEGKLTEEREKSIKTDEKIF 757

Query: 2482 SMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV-----MKGQVEESENAVSXXXXXXXX 2646
             +   F           KN V+    S+  SIS+      K   +     +S        
Sbjct: 758  ELEQYF-----------KNYVEKEKESVFDSISIAILSAKKKHDQIDSGVLSKCSSIISD 806

Query: 2647 XXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMK 2778
                   VN  + LK   + S+ S+ + IT   D+ DTI+   K
Sbjct: 807  TLTQINNVNDMS-LKSLAQQSVNSSKALITQFQDVADTIDKTSK 849

 Score =  133 bits (335), Expect = 7e-31
 Identities = 74/164 (45%), Positives = 94/164 (57%), Gaps = 7/164 (4%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI V VRCR RN+REI  KSSVV++     G E V      D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVV----LSDPSSVLSHTKKTYIFDQVF 114

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG-------E 444
           G  + Q+++F+  A     + ++GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 445 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
           L + AGIIPRVL+ LF  L  +  +Y VK SF+ELYNE LKDLL
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL 218

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
            YBL063W
          Length = 1105

 Score =  240 bits (613), Expect = 5e-65
 Identities = 197/682 (28%), Positives = 329/682 (48%), Gaps = 19/682 (2%)
 Frame = +1

Query: 907  RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 1086
            R+S A +  S+ I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTI
Sbjct: 237  RTSSA-SSSSSSIMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTI 295

Query: 1087 TLYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 1251
            T      D     +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN
Sbjct: 296  TTNVARTDPVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVIN 355

Query: 1252 ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            AL D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IK
Sbjct: 356  ALVDNSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIK 415

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESYKN 1602
            N PQ+   + K+  +     E+ +++ +L +++ KEG+Y+++D ++   S+   +E  K 
Sbjct: 416  NTPQVNQSMSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQLYESNSILVEEQKV 475

Query: 1603 EVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELE 1782
             +Q  +  I                     Q+  S+    +L  +QL  +     K E+ 
Sbjct: 476  RIQNMEDQI------------LKFKAKYVEQTNLSKDAEKRLKQSQLLCKKLSIEKAEMS 523

Query: 1783 ISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNI 1962
               F +  Q  TE +  +++D  R  L+L +  +     ++        + +S +  +NI
Sbjct: 524  -ENFQSFRQTCTEYVD-SVEDIHRSNLELIRSLKDE-RDDLFGKSVESGNMISSLIADNI 580

Query: 1963 SQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD 2142
             Q  N+        +++ + ++    K + +     +++ +      N IV ++  I +D
Sbjct: 581  RQGKNL--------SKLNSSLQAYSSKYDQVSAGVFEEMESNVIFHKNAIVGQLSSISLD 632

Query: 2143 FQRFYNNIAENLSDISEENNNLKQYL--KNHFFKNNHQELLNHHIDSTYEDIEKKTSEFV 2316
               F  NI    S + +  + L+ Y   +     + H+ +LN         +    S F 
Sbjct: 633  --TFMTNIRSMHSALIKVFSELQTYRFDEKGIIFSAHRSILNQCYRRVCHFMTMLDSSF- 689

Query: 2317 ENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNE 2496
                + L   L +  +L +  +     +   +  ++ E ++   E   D+ NK    +  
Sbjct: 690  ----SGLVHGLRQASELSLDEVDKLGDSYSGRACEVIEAQKRHIE---DMENKLCRKSQA 742

Query: 2497 FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNK 2676
               + A  LS  +   +      +K    +K  VE +E                   + K
Sbjct: 743  LEKSNAHILSLQEYFAENIMKQRSKIFDDLKKAVETAEGHQLSLEEDVLKKSIDTLQIVK 802

Query: 2677 HTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMID---------NI 2829
            + +  ++    +TS H          ++   ++K++ NK + + +   D         +I
Sbjct: 803  NEMCTEH----VTSLHEMAELGTSSLNSFSELVKSFRNKLSQLSHGSTDRLSHLLATNSI 858

Query: 2830 LKEIPSLSKRVPLRLSNTNGNS 2895
             KE+    K + +  S+    S
Sbjct: 859  TKELHDFKKAIVIECSDHKSQS 880

 Score =  142 bits (359), Expect = 9e-34
 Identities = 80/167 (47%), Positives = 103/167 (61%), Gaps = 10/167 (5%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           N+ V VRCR RNE+EI  KSSVV++     G E +  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 435
           G  + Q+ +FDEVA     + ++GYNCTV  YG T TGKTYTM+GD          +K+ 
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 436 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
            GE S   GIIPRVL+ LF  L  + N+Y VK SF+ELYNE+LKDLL
Sbjct: 157 LGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL 200

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
            YBL063W
          Length = 1142

 Score =  226 bits (576), Expect = 3e-60
 Identities = 203/731 (27%), Positives = 344/731 (47%), Gaps = 85/731 (11%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT----- 1089
            +   + I ++ +QE  I NAMEGLNLL +G   R+V STK+ND SSRSHTIFTIT     
Sbjct: 202  DSSDSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIK 261

Query: 1090 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
            L  +   E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL+DK+
Sbjct: 262  LDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKT 319

Query: 1270 G------------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1377
                                     HIP+RESKLTRLLQDSLGG TKT +IATISPAK  
Sbjct: 320  NNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTC 379

Query: 1378 SEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDL-LSTKSKEGIYMS 1554
             +ET STLEYA++A +IKN P++         + +   ++ ++K +L  ST    GI++ 
Sbjct: 380  LDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIP 439

Query: 1555 QDHYKNLNSDLESYK-NEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLT 1731
             +        L  YK NE+                           I+ QN+++ ++   
Sbjct: 440  LE-------KLNYYKSNEI--------------------------LIEEQNAKINNMTNQ 466

Query: 1732 INQLK------AQLDKQHKTELEISGF-NNKLQKLTEIMQLALQDYKR---------REL 1863
            I + K       Q++KQ  T+++ S +  N+L  +   + + + ++K+            
Sbjct: 467  IAKFKKKFVEQIQINKQLNTDMKKSQWEKNQLLTIKLKLIILIVNFKQNIFQYLNNIENF 526

Query: 1864 DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI---QPNLDIIKNEVLTLMETM 2034
            D NK    +I K +   K +LF     +    IS  +N+   + NL  I N ++      
Sbjct: 527  DQNK---NNIIKNLNDEKNSLFDNSIEIFNQFISIHSNLISNKENLLQIDNSLIKFNNNF 583

Query: 2035 QEKAELMYKDCVKKILNES----PKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEEN- 2199
            +  ++ ++ + +K ++  S        N+ +   + I  +FQ+ Y +I+ +  D  + N 
Sbjct: 584  KSVSKSLFDELIKMLITFSSTTKDSILNIQISNFNDIIDNFQKNYYSISHDHFDNVKSNF 643

Query: 2200 ----NNLKQYLKNHFFKNNHQ--ELLNHHIDSTYEDIEKKTSEFVENFKNTLN---DHLE 2352
                +NL Q LK +    + +  ++++ +I +     EK  ++ V +    +N   ++  
Sbjct: 644  QINLSNLDQSLKKYLIDQSSKLNKIISMNITNLKSYNEKIFNKIVMDSNEIINKSLNNFN 703

Query: 2353 ENKKLIMQN----LTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 2520
              K  I++N    + N    ++++  +L   K +    +  + N+  S  N+  N++  +
Sbjct: 704  SEKNSIIENQLIEIKNLKEIILSKNDELINSKIIINNLTSFIKNEISSKRNQLINHLKDS 763

Query: 2521 LSQIKNTVDTSSNSM--NKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKH----- 2679
            L   +   +   +S+  N   S+ K Q    ++ +                ++ H     
Sbjct: 764  LDDFQRQNELLDDSILENSIQSITKSQTIYQDHLMDSIDNLYNSNINSIDRLDNHFDDQN 823

Query: 2680 TILKDNIENSITSTHS-HITNID---------DIYDTIENIMKNYGNKENAVKNEMIDNI 2829
              L+  I N I S  S  I N D         D+Y+ +++    + N  N++   ++DNI
Sbjct: 824  IQLRKKILNHIDSMESLVIKNFDYNEFIKPTRDLYEELDH--SKFNNNFNSISTMLLDNI 881

Query: 2830 LKEIPSLSKRV 2862
                 S+ + +
Sbjct: 882  NNTKNSMDQNI 892

 Score =  131 bits (330), Expect = 3e-30
 Identities = 80/172 (46%), Positives = 102/172 (59%), Gaps = 15/172 (8%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI V VRCR RN++EI  KSSVVV+     G++ +  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 444
           G  + Q+ IF+ VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 445 LSDAAGIIPRVLLKLF----DTLELQQN----DYVVKCSFIELYNEELKDLL 576
           L + AGIIPRVL++LF    D++  Q+N     Y VK SF+ELYNE LKDLL
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 66/320 (20%), Positives = 137/320 (42%), Gaps = 17/320 (5%)
 Frame = +1

Query: 1696 SQNSQMESLKLTINQLKAQLDKQHKTELEISG--FNNKLQKLTEIMQLALQDYKRRELDL 1869
            S  ++   L + I+     +D   K    IS   F+N        +    Q  K+  +D 
Sbjct: 602  SSTTKDSILNIQISNFNDIIDNFQKNYYSISHDHFDNVKSNFQINLSNLDQSLKKYLIDQ 661

Query: 1870 NKKFETHISKEIKSLKT---TLFSQLSGMEQNNISQET----NIQPNLDIIKN---EVLT 2019
            + K    IS  I +LK+    +F+++  M+ N I  ++    N + N  II+N   E+  
Sbjct: 662  SSKLNKIISMNITNLKSYNEKIFNKIV-MDSNEIINKSLNNFNSEKN-SIIENQLIEIKN 719

Query: 2020 LMETMQEKAELMYKDCVKKILNESPKFF-NVIVEKIDIIRVDFQRFYNNIAENLSDISEE 2196
            L E +  K + +     K I+N    F  N I  K +       +  N++ ++L D   +
Sbjct: 720  LKEIILSKNDELINS--KIIINNLTSFIKNEISSKRN-------QLINHLKDSLDDFQRQ 770

Query: 2197 NNNLKQYLKNHFFKN--NHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
            N  L   +  +  ++    Q +   H+  + +++       ++   N  +D   + +K I
Sbjct: 771  NELLDDSILENSIQSITKSQTIYQDHLMDSIDNLYNSNINSIDRLDNHFDDQNIQLRKKI 830

Query: 2371 MQNLTNATSAVINQ--EMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
            + ++ +  S VI      +  +P R       DL  + D  +++F NN  +  + + + +
Sbjct: 831  LNHIDSMESLVIKNFDYNEFIKPTR-------DLYEELD--HSKFNNNFNSISTMLLDNI 881

Query: 2545 DTSSNSMNKSISVMKGQVEE 2604
            + + NSM+++I  +K ++ E
Sbjct: 882  NNTKNSMDQNIDDLKLKINE 901

>Kwal_56.22407 s56 complement(113066..113392) [327 bp, 108 aa] {OFF}
            [contig 185] FULL
          Length = 108

 Score =  142 bits (357), Expect = 6e-39
 Identities = 76/108 (70%), Positives = 84/108 (77%)
 Frame = -2

Query: 1544 IPSLDFVESKSDLILASSIVMFLTKISFIMKAPSCGLFLMFLAFDAYSSVLQVSSEVTFA 1365
            +PS DFVES+SD IL SS V  L+K SFI+K P+CGLFL+FLAF AYSSVL+VSSE   A
Sbjct: 1    MPSFDFVESRSDFILTSSAVTLLSKTSFIIKLPTCGLFLIFLAFVAYSSVLEVSSEFILA 60

Query: 1364 GDIVAINAVFVLPPSESWSKRVNFDSRNGI*PLLSASALITLPSVSRL 1221
            G+IVAINAV V PP ES S  VNFDSRNGI  LLSAS  ITLP V RL
Sbjct: 61   GEIVAINAVLVFPPKESCSNLVNFDSRNGICKLLSASEFITLPKVKRL 108

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa] {ON}
            weakly similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079W SMY1 not believed to act as a kinesin,
            colocalizes with Myo2p; kinesin heavy chain homolog
          Length = 649

 Score =  149 bits (377), Expect = 1e-36
 Identities = 117/349 (33%), Positives = 179/349 (51%), Gaps = 11/349 (3%)
 Frame = +1

Query: 907  RSSMAPND-QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1083
            R S++ +D + +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I  
Sbjct: 184  RISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVR 243

Query: 1084 ITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            I L K++  +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL 
Sbjct: 244  INLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALT 303

Query: 1261 D-------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1419
                     S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+A
Sbjct: 304  QVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRA 363

Query: 1420 KNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK 1599
            K IKN           IL KN       ++  L   KS+E  Y+ +         + + +
Sbjct: 364  KKIKNFA---------ILNKNNLSSRNLLEQQLEELKSRETGYLLR---------ISTLE 405

Query: 1600 NEVQECK--RDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT 1773
             E+ E K   DIE                   ++SQ   +  L ++ +   A  D     
Sbjct: 406  KELLESKAQNDIEDPSQKPLPPTPDLLEENKKLKSQVESLAGL-ISHSNSGATDDPSISY 464

Query: 1774 ELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKT 1920
            +  I    N+ + + EI Q +L +    +++LNKKF+  ++   + + T
Sbjct: 465  DDLIQNLMNRCENVVEI-QASLDE----QVELNKKFQQSLASTTERMYT 508

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 40/115 (34%), Positives = 70/115 (60%), Gaps = 3/115 (2%)
 Frame = +1

Query: 241 TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 420
           + Q N + +T D+VF  G++Q+ +++ VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 421 DEKLYNGELSDAAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
            +        +  G+IPR+   + K  +T + +   + V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W
          Length = 473

 Score =  140 bits (354), Expect = 1e-34
 Identities = 89/224 (39%), Positives = 133/224 (59%), Gaps = 8/224 (3%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1125
            +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L  +
Sbjct: 169  FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 1126 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 1287
                S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229  LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 1467
            ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL      D
Sbjct: 289  DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNTQETVD 346

Query: 1468 ILVKNITM--ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES 1593
              V+ + M  +L +++  L     +  +    +  K  N  LE+
Sbjct: 347  GKVQMLAMRQQLDELQGALSRVGDQRLVREQMEKIKLTNQFLEA 390

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 16/197 (8%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR------- 264
           NI V+VR R   ERE                +E V      +  I  +  AKR       
Sbjct: 4   NIKVSVRLRKPLERE---------------SAERVIAQVVSENLIKVEQRAKREETRNFE 48

Query: 265 YTVDKVFGPGASQDL--IFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           + +   +     +D   +++++A       + GYN  +  YG T +GK++TMTG  +L  
Sbjct: 49  FDLCCTYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL-- 106

Query: 439 GELSDAAGIIPRVLLKLFDTLELQQN-------DYVVKCSFIELYNEELKDLLDXXXXXX 597
                  GI+PR+  +LF+  E+ ++        + ++CS++E+YNE ++DLL       
Sbjct: 107 ------PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLGANKCRI 160

Query: 598 XXXGFEGPFMKKLRIFD 648
                +  F++ L+ F+
Sbjct: 161 RERADKTTFVEGLQEFE 177

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
            YGL216W (KIP3) - kinesin-related protein involved in
            mitosis [contig 192] FULL
          Length = 479

 Score =  136 bits (343), Expect = 3e-33
 Identities = 76/175 (43%), Positives = 116/175 (66%), Gaps = 6/175 (3%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1125
            +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169  FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 1126 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 1287
                S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229  IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 1452
            ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 289  DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 11/192 (5%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 286 GPG----ASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
                  A Q  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 454 AAGIIPRVLLKLFDTLELQQN-------DYVVKCSFIELYNEELKDLLDXXXXXXXXXGF 612
           + GI+ R+  +LF+  E+ ++        + ++CS++E+YNE ++DLL            
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 613 EGPFMKKLRIFD 648
           +  F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1 Kinesin-related motor protein required for
            mitotic spindle assembly and chromosome segregation;
            functionally redundant with Cin8p
          Length = 456

 Score =  135 bits (341), Expect = 4e-33
 Identities = 93/238 (39%), Positives = 135/238 (56%), Gaps = 22/238 (9%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1125
            ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT+++ ++  D   R 
Sbjct: 149  FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 1126 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALADKSGH-IPFRESK 1296
            S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ LA  S H IP+R+S 
Sbjct: 209  SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 1297 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI------ 1458
            LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +      
Sbjct: 269  LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 1459 MKDIL--VKNITMELAKIKSDLLSTKSKEGIYMSQ-----------DHYKNLNSDLES 1593
            MK  +    +   EL  +KS++ S +S+  I   Q           +H   LN  LE+
Sbjct: 327  MKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRFNHITKLNDYLEN 384

 Score = 64.7 bits (156), Expect = 6e-10
 Identities = 39/113 (34%), Positives = 56/113 (49%), Gaps = 1/113 (0%)
 Frame = +1

Query: 241 TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 420
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 421 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDY-VVKCSFIELYNEELKDLL 576
                    +   GIIP +   LFD LEL +     V  ++ E+YNE+L DLL
Sbjct: 89  --------TNSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLL 133

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 504

 Score =  134 bits (336), Expect = 4e-32
 Identities = 77/175 (44%), Positives = 112/175 (64%), Gaps = 6/175 (3%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 1113
            +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198  FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 1114 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 1287
              R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ LA K+    IP+R
Sbjct: 258  TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 1452
            +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++ +
Sbjct: 318  DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARVNS 370

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 21/178 (11%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI VAVR R    RE G      V  P     ++  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 286 ----GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 444
                    Q++I+D +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 445 LS-------DAAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLL 576
            +        A GIIPRV   LFD   +  ++       + + CS++E+YNE+++DLL
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YKL079W
            (SMY1)
          Length = 635

 Score =  135 bits (340), Expect = 4e-32
 Identities = 123/380 (32%), Positives = 190/380 (50%), Gaps = 8/380 (2%)
 Frame = +1

Query: 907  RSSMAPNDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1083
            R+S+  ++ +  G+Y++      +++  E LN +  G   R   ST MN  SSRSH I  
Sbjct: 176  RASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVK 235

Query: 1084 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            I L K+   E   + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL 
Sbjct: 236  INLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALT 295

Query: 1261 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1434
              +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKN
Sbjct: 296  QKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKN 355

Query: 1435 KPQLGAFIMK-DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 1611
            K    A + K D+ +K       K++  +   + KE  Y ++         +E  ++EV+
Sbjct: 356  K----AIVNKSDLFLKK------KLERKIAQLEKKEQDYKTR---------IELLEHEVK 396

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
            E +                            +Q++SLK+ +N     LD    TE  IS 
Sbjct: 397  ELQATASHRPLPEEVDLLAEN------TKLRAQVDSLKVLLNPRTDSLD----TEQHIS- 445

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTL-FSQLSGMEQNNISQ 1968
             ++ L KL E  +L ++   R +   +K+      K +K L T L  ++   +E+N+   
Sbjct: 446  VDDLLTKLMEKCELVVELQSRLDDQADKE------KALKKLMTDLKHTEAQLVEKNHQLA 499

Query: 1969 ETNIQPNLDIIK--NEVLTL 2022
            E      LD +   NE +TL
Sbjct: 500  EQLAIAQLDNLNLTNENMTL 519

 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 44/111 (39%), Positives = 64/111 (57%), Gaps = 4/111 (3%)
 Frame = +1

Query: 256 AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 435
           A+ +  D VFG  A Q+ +FD VA  +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 436 NGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLL 576
                   G+IPR+  ++F+ + L +N    +YVV  SF+E+Y E++ DLL
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLL 159

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
            Anc_3.528
          Length = 868

 Score =  131 bits (329), Expect = 2e-30
 Identities = 125/490 (25%), Positives = 227/490 (46%), Gaps = 31/490 (6%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D+ + I + NL   +  +  + ++L+ RG  +R  +ST+ N+ SSRSH +  I + + + 
Sbjct: 302  DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 1108 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                      + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +  
Sbjct: 362  KIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNN 421

Query: 1273 --------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1428
                    HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK I
Sbjct: 422  TRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 481

Query: 1429 K-----NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLE- 1590
            K     N+  L   +     +K IT +  +I++  L T+  + I ++ + YK     ++ 
Sbjct: 482  KTKIIRNQQSLNRHV--GSYLKMITEQKREIEN--LRTREAQMIELNLNRYKLSRKKIQI 537

Query: 1591 SYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHK 1770
            S  + +    R+I                    I  +   ++ + L +N     + +   
Sbjct: 538  SMDDVINNLNRNI-----LENEKYKQVKNLKSLILCKRRFLQMVSLELNNCLNVISEDGG 592

Query: 1771 TELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGME 1950
              + ++ +NN    + +I        K +EL+L    +  +   I   K+   ++L  ME
Sbjct: 593  DTINLNCYNNCSTLIKQI------GNKVQELELKFDTKDELDMIIDHCKSMDLNRLKEME 646

Query: 1951 -----QNNISQETNIQPNLDIIKNEVLTLMETMQEKA---ELMYKDC--VKKILNESPKF 2100
                 ++ I+ ET ++   + IKNE+L     M EK    + + + C  V   L      
Sbjct: 647  NWDDSRDLINFETRLEYISESIKNEILISASMMIEKLFQNDTLMRRCKFVSGCLTTEQPE 706

Query: 2101 FNVIVEKIDIIRV--DFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHID 2274
             ++ +E  D++++  DF+ F   +   L+DI +   N+       +   N ++ +  H D
Sbjct: 707  RSMEIEINDLVKIDEDFEEFSRLL---LNDIEDGTANIHLSQNPLYSNENKEKNMETHYD 763

Query: 2275 STYEDIEKKT 2304
              Y +   +T
Sbjct: 764  LEYSNGTNET 773

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 38/113 (33%), Positives = 62/113 (54%), Gaps = 2/113 (1%)
 Frame = +1

Query: 244 AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 423
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 424 EKLYNGELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
           +        +  GII RV+ +LF+ +E    +  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
            Ashbya gossypii ADR145C
          Length = 662

 Score =  128 bits (322), Expect = 8e-30
 Identities = 79/182 (43%), Positives = 112/182 (61%), Gaps = 5/182 (2%)
 Frame = +1

Query: 907  RSSMAPNDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 1083
            R+S+  ++ S  G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I  
Sbjct: 203  RTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVK 262

Query: 1084 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 1260
            I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL 
Sbjct: 263  INLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALT 322

Query: 1261 DKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             K     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+
Sbjct: 323  QKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIE 382

Query: 1432 NK 1437
            NK
Sbjct: 383  NK 384

 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 4/118 (3%)
 Frame = +1

Query: 235 GITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 414
           G+  +  ++ +  D VFG  ++QD ++D VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 415 TGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLL 576
            G          D  G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E++ DLL
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 809

 Score =  128 bits (322), Expect = 1e-29
 Identities = 120/435 (27%), Positives = 208/435 (47%), Gaps = 29/435 (6%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D   GI + NL         + ++L+ RG  +R  + T  N+ SSRSH +  I + +K++
Sbjct: 247  DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 1263
                 E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 307  TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1443
             + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K  
Sbjct: 367  STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTKVI 426

Query: 1444 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 1623
                 + D  V +    + + + ++   + +E         K +  +L  YK   ++ + 
Sbjct: 427  RNQHSL-DRHVGSYLKMITEQRQEIEELRCRES--------KMVALELNKYKLSREKLQI 477

Query: 1624 DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQ---HKTELEISGF 1794
             I                    +++  S ME L+L   +    L K+       +E+S  
Sbjct: 478  AI--------------WDSINGVKNNYSNMEKLQLLKTKKSLMLCKRRFLQMVSIELSNL 523

Query: 1795 NNKLQKLTEIMQ--LALQDYKRREL-DLNKKFET--HISKEIKSLKTTLFSQLSGMEQNN 1959
               L + T+I +  +AL D    ++ DL +KF+T   +   I+  K+    +L  ME  +
Sbjct: 524  MKLLAQDTKIYENCMALYDQLINKIRDLEEKFDTSDELDMAIEHTKSVDLVKLQEMETWD 583

Query: 1960 ISQ-----ETNIQPNLDIIKNEVLT----LMETMQEKAELM--YKDCVKKILNESPKFFN 2106
             S      E+++    + ++NE+L     +ME + E  +L+  YK   + +L       N
Sbjct: 584  DSVDLPWFESHLNFLAESLRNEILVTASIMMERLFEDEKLISRYKFVSRTVLEAFASKEN 643

Query: 2107 VIVEKIDII--RVDF 2145
               + +D+I  R+DF
Sbjct: 644  GGADTMDMILERLDF 658

 Score = 62.4 bits (150), Expect = 5e-09
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 2/108 (1%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  DK+F   A+Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 187

Query: 439 GELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
               +  G+I   + +LF  +E       + +  S++E+YNE ++DLL
Sbjct: 188 --TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
            Anc_3.528 YGL216W
          Length = 847

 Score =  127 bits (318), Expect = 5e-29
 Identities = 138/599 (23%), Positives = 253/599 (42%), Gaps = 47/599 (7%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D    I + NL         E ++ + RG  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 239  DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 1108 DELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                      + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 299  TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 1273 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K 
Sbjct: 359  RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTKI 418

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 1620
                  +   +   + M + + K ++   + +E   M   H K      E  +  +++C 
Sbjct: 419  IRNQQSLNRHVGSYLKM-ITEQKKEIQELRHREN-NMIDLHLKKYKLGREKVELAIEDCI 476

Query: 1621 RDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 1800
            + I+                  T + QN+++    +   +   QL       LEIS    
Sbjct: 477  QKIK-------------NSLLQTPKFQNTRIIKSLILCKRRLLQL-----VNLEISEVLE 518

Query: 1801 KLQKLTEI-----MQLALQDYKRRELDLNKKFETHISKEI-----KSLKTTLFSQLSGME 1950
             ++  T++      ++  +   ++  +L ++F+T    EI     K+++    S++   +
Sbjct: 519  AVEDWTDVAIVENCRIIQEQLNKKTKELEEQFDTPAELEIIIENAKTIEKQRLSEMEFWD 578

Query: 1951 QNNISQETNIQPN--LDIIKNEVLT----LMETMQEKAELMYK-----DCV--KKILNES 2091
              N +   +I+ N   ++I+N++L       E++ E  +L+ K      C+  K+ ++E 
Sbjct: 579  PANDAYNFDIKLNYIAELIRNDILVKASMFTESLFENRKLISKFKFLSKCLSSKQDIHEC 638

Query: 2092 PKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK----------- 2238
             K    I ++ DI   +   + N+     SD     +    Y K                
Sbjct: 639  LKDLLDIDKEFDIFGKELMSYENSNITGFSDFENRISKANDYTKTSIVSEANNVPPVNIT 698

Query: 2239 --NNHQELLNHHIDSTYEDIEKKTSEFVENFK-NTLNDHLEENKKLIMQNLTNATSAVIN 2409
               N   + N  +     +     S+F    K N  +  L E KK+      +      N
Sbjct: 699  NLKNSPTVANKIVTHNNSETPPSISKFPNKLKYNKYSSPLSEKKKITAAKRISKNENGGN 758

Query: 2410 QEMDLFEPKRV-KWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 2583
               +   PK + K +N   +++  +  +N   N+    +  I N+V T   ++   +S+
Sbjct: 759  SNSNSPSPKNINKIKN--PILSFKEGASNINVNSSKNNVLNIHNSVMTKPFNLKSRMSL 815

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 32/108 (29%), Positives = 58/108 (53%), Gaps = 2/108 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG------- 179

Query: 442 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 579
              +  GII   + +LF  +E  ++  +  +  S++E+YNE ++DLL+
Sbjct: 180 -TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  126 bits (317), Expect = 6e-29
 Identities = 149/553 (26%), Positives = 244/553 (44%), Gaps = 46/553 (8%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + + ++
Sbjct: 264  DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                      + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL    G 
Sbjct: 324  LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 1273 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1443
               HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K  
Sbjct: 384  RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK-- 441

Query: 1444 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 1623
                     +++N                            ++L+  + SY   + E KR
Sbjct: 442  ---------IIRN---------------------------QQSLSRHVGSYLKMITEQKR 465

Query: 1624 DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNK 1803
             IE                   ++ +  +M SLKLT    K +L+K+ K +L I+   N 
Sbjct: 466  QIE------------------ELREREEKMISLKLT----KYKLNKE-KIQLAINECINH 502

Query: 1804 LQK---LTEIMQLA-----LQDYKRRELDLNK----------KFETHISKEI-------K 1908
            +Q+     E  Q+A     L   KRR L + K          + E  I  E+       +
Sbjct: 503  VQQTYSTVETYQVAKILKSLILCKRRFLQMVKLEVDNLTLLFQQEERIGTEMQPVISNCR 562

Query: 1909 SLKTTLFSQLSGME--------QNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 2064
             +   LF+++  +E         N++ Q+ +   ++D+ K   L  ME   E  +L+Y +
Sbjct: 563  LISEQLFNKIHELEVKFDETDALNSVIQQVH---SIDLNK---LREMEDWDETYDLVYLE 616

Query: 2065 -CVKKI----LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNH 2229
             C+ +I     NE     +++ EK+ I  V     +  +++ L D + +   + Q L   
Sbjct: 617  ACLNQISELQRNEILVNSSIMTEKL-ISDVRLNSRFKFLSKWLMDRTPDIEFIIQDLV-- 673

Query: 2230 FFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVIN 2409
                        HID  +E   K    F+ N  NT       +  + M+N T A +    
Sbjct: 674  ------------HIDEEFESFAK---NFIANPGNTFT-----STNISMKNTTAAAAPAET 713

Query: 2410 QEMDLFEPKRVKW 2448
             +   F  K+VKW
Sbjct: 714  LQRQKFPNKKVKW 726

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG------- 204

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
                 GII   + +LF+ +     + ++ +  S++E+YNE + DLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  125 bits (313), Expect = 2e-28
 Identities = 140/525 (26%), Positives = 239/525 (45%), Gaps = 26/525 (4%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264  DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 1263
                      + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324  LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1443
            +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K  
Sbjct: 384  RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK-- 441

Query: 1444 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 1623
                     +++N                            ++L+  + SY   + E KR
Sbjct: 442  ---------IIRN---------------------------QQSLSRHVGSYLKMITEQKR 465

Query: 1624 DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNK 1803
             IE                   ++ +  +M SLKLT    K +L+K+ K +L I+   N+
Sbjct: 466  QIE------------------ELREREEKMISLKLT----KYKLNKE-KIQLAINECINR 502

Query: 1804 LQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS--LKTTLFSQLSGMEQNNI----S 1965
            +Q+       A++ Y+             ISK +KS  L    F Q+  +E +N+     
Sbjct: 503  VQQTYS----AVETYQ-------------ISKILKSLILCKRRFLQMVRLEVDNLILLFE 545

Query: 1966 QETNIQPNLDIIKNEVLTLMETMQEKA-ELMYKDCVKKILNESPKFFNVI--VEKIDIIR 2136
            QE  +   + ++ N    + E +  K  EL  K       +ES    +VI  V  ID+ +
Sbjct: 546  QEERVAAEMQLVINNCRMISEQLFNKIHELEVK------FDESDALHSVIQQVHSIDLNK 599

Query: 2137 V----DFQRFYN--NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEK 2298
            +    D+   Y+   +   L+ ISE   N  + L N       + + +  ++S ++ + K
Sbjct: 600  LREMEDWDETYDLVYLESCLNQISELQRN--EILVNSSIM-TEKLMSDPGLNSRFKFLSK 656

Query: 2299 KTSEFVENFKNTLND--HLEENKKLIMQN-LTNATSAVINQEMDL 2424
               +   + ++ + D  H++E  +L  +N L N  S   N  +++
Sbjct: 657  WLMDRTPDIESIIQDLVHIDEEFELFAKNFLANPGSTFTNTNINI 701

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG------- 204

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
                 GII   + +LF+ +     + ++ +  S++E+YNE ++DLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  124 bits (311), Expect = 3e-28
 Identities = 118/447 (26%), Positives = 201/447 (44%), Gaps = 22/447 (4%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264  DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                      + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    G 
Sbjct: 324  LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 1273 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK-- 1437
               HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K  
Sbjct: 384  RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 1438 -PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 1614
              Q          +K IT +  +I+   L  + ++ I M    YK LN   E  +  + E
Sbjct: 444  RNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISMKLTKYK-LNK--EKIQLAINE 498

Query: 1615 CKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 1794
            C   ++                   I  +   ++ +KL ++ L     +      E+   
Sbjct: 499  CINRVQ-QSYSTVETYQVAKILKSLILCKRRFLQMVKLEVDNLVQLFQQGDIMVAEMQPV 557

Query: 1795 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGME-------- 1950
             +  Q ++E +       K  EL++       +   I+ + +   ++L  ME        
Sbjct: 558  ISNCQMISEQL-----FNKIHELEVKFDETNALDSVIQQVHSIDLNKLREMEDWDETYDL 612

Query: 1951 ---QNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 2121
               ++ +SQ + +Q N  +I + ++T            +K   K +++ +P     I++ 
Sbjct: 613  VYLESCLSQISELQRNEILINSSIMTEKLISDAGLNRRFKFLSKWLMDRTPD-IEFIIQD 671

Query: 2122 IDIIRVDFQRFYNNIAENLSDISEENN 2202
            +  I  DF+ F  +   N S+     N
Sbjct: 672  LVHIDEDFELFAKSFIANPSNTFSNTN 698

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 39/128 (30%), Positives = 65/128 (50%), Gaps = 6/128 (4%)
 Frame = +1

Query: 211 SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 378
           SIN+ G     +Q        ++  DK+F   +SQ  ++ E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 379 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELY 552
           YG T  GKTYT++G             G+I   + +LF+ ++    + ++ +  S++E+Y
Sbjct: 191 YGATGCGKTYTVSG--------TPSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIY 242

Query: 553 NEELKDLL 576
           NE ++DLL
Sbjct: 243 NERIRDLL 250

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
            KIP3Kinesin-related motor protein involved in mitotic
            spindle positioning
          Length = 805

 Score =  124 bits (310), Expect = 4e-28
 Identities = 122/455 (26%), Positives = 205/455 (45%), Gaps = 28/455 (6%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264  DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 1263
                      + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324  LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK-- 1437
            +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K  
Sbjct: 384  RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 1438 -PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 1614
              Q          +K IT +  +I+   L  + ++ I +    YK LN   E  +  + E
Sbjct: 444  RNQQSLSRHVGSYLKMITEQKRQIEE--LREREEKMISLKLTKYK-LNK--EKIQLAINE 498

Query: 1615 CKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELE---- 1782
            C   ++                   I  +   ++ +KL ++ L    +++  T  E    
Sbjct: 499  CVNRVQ-QTYAGVETYQVAKTLKSLILCKRRFLQMVKLEVDNLILLFEREESTAAEMQPV 557

Query: 1783 ------ISG-FNNKL----QKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSL--KTT 1923
                  ISG   NK+     K  E   L+   ++   +DLNK  E     E   L    +
Sbjct: 558  ISNCRMISGQLYNKIHELEMKFDETDTLSSVIHQVHSIDLNKLREMEDWDETYDLVYLES 617

Query: 1924 LFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFF 2103
              +Q+S +++N I           ++ + ++T            +K   K ++N +P   
Sbjct: 618  CLNQISELQRNEI-----------LVNSSIMTEKLMSDPGLNSRFKFLSKWLMNRTPNIE 666

Query: 2104 NVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNL 2208
            ++I + + I   +F+ F      N  D +  N N+
Sbjct: 667  SIIQDLVHIDE-EFESFARTFIAN-PDSNFTNTNI 699

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG------- 204

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
                 GII   + +LF+ +     + D+ +  S++E+YNE ++DLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
            kinesin-related protein required for nuclear migration
          Length = 705

 Score =  122 bits (307), Expect = 7e-28
 Identities = 72/180 (40%), Positives = 104/180 (57%), Gaps = 10/180 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N I + NL +   T   E ++L+ RG  +R  + T+ N+ SSRSH +  I + +K++
Sbjct: 267  DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 1108 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                 E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 327  TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 1273 -----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
                 H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387  ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 63.2 bits (152), Expect = 3e-09
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 207

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
              +  GI+ + + +LF  +E       + +  SF+E+YNE ++DLL
Sbjct: 208 -TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13554)
            [2421 nt, 807 aa]
          Length = 806

 Score =  123 bits (308), Expect = 7e-28
 Identities = 140/581 (24%), Positives = 253/581 (43%), Gaps = 32/581 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  + I + NL         + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 257  DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 1108 DELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                  S     ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 317  TVDLTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGT 376

Query: 1273 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
                H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK K 
Sbjct: 377  RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK- 435

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 1620
                      +++N                            ++LN  + SY   + E K
Sbjct: 436  ----------VIRN---------------------------QQSLNRHVGSYLKMITEQK 458

Query: 1621 RDIEXXXXXXXXXXXXXXXXXXTIQSQNS---QMESLKLTINQLKAQLDKQHKTELEISG 1791
            ++I+                    + QN    Q++  KL   +++  +D   +       
Sbjct: 459  KEIDELRQ----------------REQNMIEIQLKKYKLGREKIQLSMDDCLRNIQNTYA 502

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 1971
              +K Q    I  L L   KRR L +       I+ E+ S+   +          N +Q+
Sbjct: 503  QTSKFQNAKNIKSLIL--CKRRFLQM-------INLELDSVLYVV----------NSTQD 543

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKID-----IIR 2136
              +    +I+K ++L  +  ++E+ +    D +  ++  S K   + + +++     I R
Sbjct: 544  MGVMETCNILKEQILNKIRELEEQFDT--PDELDLVIEHSKKNDAMKLSEMEYWDDIIDR 601

Query: 2137 VDFQRFYNNIAE--------NLSDISE---ENNNLKQYLKNHFFKN--NHQELLNHHIDS 2277
             +F+   +NI E        N S ++E   EN NL    K  FF     HQ  +N  +  
Sbjct: 602  ANFESRLDNINEVVRNEVLVNGSMLTEKLFENENLMYKCK--FFSKCLYHQGDINESLQE 659

Query: 2278 TYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENS 2457
               DI+K+  +F +    ++N ++  +K    Q +     A ++ E  L +P +V  +++
Sbjct: 660  LL-DIDKEFEQFGQRMFASINFNVNVSK---TQKVATVPIASVSSEKKLVKPIKVT-KST 714

Query: 2458 FDLINKCDSMNN--EFYNNMATTLSQIKNTVDTSSNSMNKS 2574
             ++ N  +S  +       +   ++  K    T +NS N +
Sbjct: 715  TEMSNSTNSSPSPKNIEKILRPIIASKKTATTTWTNSHNNN 755

 Score = 62.4 bits (150), Expect = 5e-09
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 2/108 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISG------- 197

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 579
              +  GII   + +LF  +E      ++ +  S++E+YNE ++DLL+
Sbjct: 198 -TPEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
            Anc_3.528 YGL216W
          Length = 672

 Score =  122 bits (306), Expect = 8e-28
 Identities = 74/178 (41%), Positives = 111/178 (62%), Gaps = 8/178 (4%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK--K 1101
            DQ++ I + NL      N  + ++L+ RG  +R  + T+ N+ SSRSH++  I + +  K
Sbjct: 206  DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 1102 HQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--D 1263
            + D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 266  NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
            KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326  KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 5/110 (4%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   ++Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 442 ELSDAAGIIPRVLLKLFDTLELQQND-----YVVKCSFIELYNEELKDLL 576
             S+  GII R + +LF  +E+   D       +  S++E+YNE ++DLL
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] {ON}
            Anc_3.528 YGL216W
          Length = 733

 Score =  122 bits (305), Expect = 1e-27
 Identities = 112/394 (28%), Positives = 183/394 (46%), Gaps = 22/394 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + +  +
Sbjct: 240  DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 1108 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
                  D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL    
Sbjct: 300  TAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 1270 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1434
            G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358  GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 1435 KPQLGAFIMKDILVKNITMELAKIKSDL--LSTKSKEGIYMSQDHYKNLNSDLESYKNEV 1608
            K        +  L ++I+  L  I+     +    K    M     K      E  +  +
Sbjct: 418  K----VVRNQQSLDRHISSYLKMIEEQRQEIDELRKRETTMIDLRLKRYKLTQEKVQMAI 473

Query: 1609 QECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEI- 1785
             +C   ++                   I  +   ++ ++L +N + A    Q+ T +EI 
Sbjct: 474  DDCMNSLQ-DTYDRIPNYQNAKVVKSLILCKRRFLQMVQLEVNNVIA--IAQNWTNIEIV 530

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFE-TH--ISKEIKSLKTTLFSQLSGMEQN 1956
            +  +    +LT          K REL++  KF+ TH  + + I   +T    +L  ME  
Sbjct: 531  NSCSLVADQLTN---------KIRELEI--KFDSTHDELEQAIDHARTITLPRLREMENW 579

Query: 1957 NISQ-----ETNIQPNLDIIKNEVLTLMETMQEK 2043
            N ++     E  +    D ++NE+L    TM EK
Sbjct: 580  NETRDHPYFEARLTQIADSLRNEILVNGSTMVEK 613

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSG------- 180

Query: 442 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 576
              +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 181 -TPERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
            Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  119 bits (298), Expect = 2e-27
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 5/172 (2%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDE---- 1113
            YI+ L +  + +  E L  ++ G   R VA T +N+ SSRSH I TI + +   D     
Sbjct: 173  YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 1114 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA-DKSGHIPFRE 1290
            + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233  VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 1291 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 1446
            S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293  SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 48/166 (28%), Positives = 79/166 (47%), Gaps = 9/166 (5%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 285
           NI VA+R R +  RE    S +         S E+++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 286 GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGI 465
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 466 IPRVLLKLFDTLELQQND---------YVVKCSFIELYNEELKDLL 576
           IP V  +LF  +++ Q++         + V  S+ ++YNE++ D+L
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
            YGL216W
          Length = 723

 Score =  121 bits (303), Expect = 2e-27
 Identities = 70/179 (39%), Positives = 104/179 (58%), Gaps = 9/179 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D +  I + NL      +  + L+L+ RG  +R  + T+ N  SSRSH +  I + ++++
Sbjct: 254  DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 1108 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                 E      ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 314  LVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGS 373

Query: 1273 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 374  HRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 2/114 (1%)
 Frame = +1

Query: 241 TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 420
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 421 DEKLYNGELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
                     +  GII R + +LF  ++      D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] {ON}
            Anc_3.528 YGL216W
          Length = 801

 Score =  121 bits (303), Expect = 3e-27
 Identities = 83/247 (33%), Positives = 133/247 (53%), Gaps = 18/247 (7%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D +N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221  DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 1108 --------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 1263
                    ++LF  S ++++DLAGSE    +    +   E  +IN+SLL LG  INAL  
Sbjct: 281  LNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCI 338

Query: 1264 KSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 1422
             +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK
Sbjct: 339  NTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAK 398

Query: 1423 NIKNK---PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES 1593
             IK K    QL         +K IT +  +I++       K  + +  +H   +  DL+ 
Sbjct: 399  EIKTKIIRNQLSLNRHISSYLKMITQQKQEIEN-----LRKNQLTIINNHLSKIEIDLKK 453

Query: 1594 YKNEVQE 1614
             + E+ +
Sbjct: 454  IEFEIDQ 460

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 53/201 (26%), Positives = 86/201 (42%), Gaps = 11/201 (5%)
 Frame = +1

Query: 10  ENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPD 189
           ENQ  I   S+   +N +NA       PN   NI   +  +            ++ +   
Sbjct: 27  ENQRLINFDSNTTNNNGINALELFQNQPNGIRNILECIDDK-----------LLIFDPQH 75

Query: 190 ITGSEEVSINTTGDTGITAQMNAK---------RYTVDKVFGPGASQDLIFDEVAGPLFQ 342
           +    ++S N       ++Q++ +         R+  DK+    ++Q  +F     PL  
Sbjct: 76  LNPLNKISENILNSIYSSSQLSRRHYRKNGGELRFIFDKLLDQNSTQQHVFQSTTEPLLD 135

Query: 343 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLE--LQQN 516
             + GYN TV  YG T  GKTYT++G          +  GII   L  LF+ +E      
Sbjct: 136 SILDGYNGTVFAYGATGCGKTYTISG--------TPENPGIIFLTLQSLFNKIENLKDTK 187

Query: 517 DYVVKCSFIELYNEELKDLLD 579
           +  +  S++E+YNE +KDLLD
Sbjct: 188 EISISLSYLEIYNESIKDLLD 208

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
            Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (302), Expect = 3e-27
 Identities = 77/182 (42%), Positives = 102/182 (56%), Gaps = 13/182 (7%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-K 1101
            +DQS   Y+ N++ F I N  + + L+ +    R  +ST +N  SSRSH IF I L    
Sbjct: 556  DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 1102 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 1257
            H+     ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL        
Sbjct: 616  HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 1258 ----ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1425
                  K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  N
Sbjct: 676  NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 1426 IK 1431
             K
Sbjct: 736  TK 737

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF        +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIE-QLIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 445 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDL 573
           L+   G+IP  +  +F++++ L++N  +Y V C FIELYNE + DL
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDL 538

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 80/376 (21%), Positives = 152/376 (40%), Gaps = 33/376 (8%)
 Frame = +1

Query: 1477 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXX 1656
            K  +++L  ++SD+ + +S       +D+  N NS LE   NE+   K  ++        
Sbjct: 94   KEYSLQLKSLQSDVNNHQSV------RDNLSNKNSLLE---NEILSLKFKLDSLSSNNSV 144

Query: 1657 XXXXXXXXXXTIQSQNSQMESLK---------LTINQLKAQLDKQHKTELEISGFNNKLQ 1809
                       ++  N +++ LK         L INQLK+  D       E+S    + +
Sbjct: 145  FVEKVKSKENQLKELN-EIKILKEKNIVDNHHLEINQLKSTHDN------ELSSIIRQYK 197

Query: 1810 KLTEIMQLA-LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQP 1986
            K  E  + + L+ +  ++ D+N+K    ISK+I + +  L S+L  ++ N          
Sbjct: 198  KKYESTKFSKLESFGNQKKDINEKLSV-ISKDIINNEKNLNSELRKVDNNQSKS------ 250

Query: 1987 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 2166
            N+D +K       E  +E   L  K+  K   N   +       K   +++  +   NN+
Sbjct: 251  NIDWLKENQTQYNEKTKENNGLT-KEIYKLSENIKKQLEPDCSNKRKELQLQIEN-NNNL 308

Query: 2167 AENLSDISEENNNLKQYL----KNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN- 2331
               LSD+ +E  NL +++    K      N  E     I+   E  +  +   +EN  N 
Sbjct: 309  DSELSDVLKEKENLIEHISSIQKKLLDLKNENETQLKLIEDENEKRKILSKLIIENDTNR 368

Query: 2332 -TLNDHLEENKKLI---------MQNLTNATSAVINQEMDLFEPKRVKWENSFD------ 2463
              +++  +E +  I         ++ +TN+     +  +++ E K +    +FD      
Sbjct: 369  RIIHNQFQELRGNIRVYCRVRPPLKKITNSPQ-TSHFSIEIPEDKNILEVQNFDQTKGTQ 427

Query: 2464 --LINKCDSMNNEFYN 2505
               + K DS NN  Y+
Sbjct: 428  TIKVKKLDSNNNATYS 443

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
            Anc_3.528
          Length = 784

 Score =  120 bits (300), Expect = 6e-27
 Identities = 113/433 (26%), Positives = 195/433 (45%), Gaps = 54/433 (12%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D +N I + NL   +     E ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 262  DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 1108 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 1260
                      + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 322  TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 1261 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
             ++S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382  TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 1438 ---------PQLGAFIMKDILVKNITMELAKIKSDLLSTK------SKEGIYMSQDH--- 1563
                       +G+++      K    EL + ++ ++  +      S+E I M+QD    
Sbjct: 442  IIRNQQSLNRHVGSYLKMITEQKREIEELRERETKMIELQLRKYKISRERIQMAQDDCIQ 501

Query: 1564 --------------YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQ 1701
                           KN+ S +   +  +Q  K +IE                    Q  
Sbjct: 502  NIIKSYSTLPKYKMAKNMKSLMLCKRRFLQMVKLEIENCISLIQNWTDHYMVFETCGQLN 561

Query: 1702 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 1881
            N  M      I +L+ + D + + EL I        ++T++++L   +      DL   F
Sbjct: 562  NQIMNK----IRELEREFDSKDELELVIDHV-----RVTDLVRLREMENWDDSTDL-IIF 611

Query: 1882 ETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQ------------PNLDIIKNEVLTLM 2025
            E+ +    +S++  +    S M +     E  +Q             NL  +  +++ L 
Sbjct: 612  ESRLDYISESIRNEILVNASIMTEKLFQNEILMQRCKFLSTCLANEQNLANVIQDLIKLD 671

Query: 2026 ETMQEKAELMYKD 2064
            E  +E  +L+  +
Sbjct: 672  EEFEEFGKLLINE 684

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           ++  DK+F   ASQ+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 202

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
              +  GII RV+ +LF+ +E       + +  S++E+YNE ++DLL
Sbjct: 203 -TPEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
            similar to uniprot|P53086 Saccharomyces cerevisiae
            YGL216W KIP3 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 778

 Score =  119 bits (299), Expect = 8e-27
 Identities = 74/244 (30%), Positives = 131/244 (53%), Gaps = 9/244 (3%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D +  I + NL  ++     + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239  DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 1108 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                +     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    G 
Sbjct: 299  TADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGT 358

Query: 1273 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 1440
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K 
Sbjct: 359  RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTKV 418

Query: 1441 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 1620
                  + D  V +    +++ K ++   + +E + +     K      E  +  +++C 
Sbjct: 419  SRNNQTL-DRHVSSYLKMISEQKQEIDELRRREQVVIDM-RLKKYQLTQEKVQLAIEDCL 476

Query: 1621 RDIE 1632
            ++++
Sbjct: 477  QNVQ 480

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 34/107 (31%), Positives = 58/107 (54%), Gaps = 2/107 (1%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           R+  D++F   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------ 180

Query: 442 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 576
              +  GII + + +LF+ +E       + +  SF+E+YNE ++DLL
Sbjct: 181 --PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa] {ON}
            YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  119 bits (298), Expect = 1e-26
 Identities = 69/179 (38%), Positives = 109/179 (60%), Gaps = 9/179 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D    I + NL    ++   + ++L+ +G  +R  ++T  N+ SSRSH +  + + ++++
Sbjct: 236  DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 1108 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA---DK 1266
                 E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL     K
Sbjct: 296  TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 1267 SG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
             G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356  RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  D+VF   +SQ  +++    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG------ 176

Query: 439 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 579
               +  GII   + +LF  +E  Q+   + +  S++E+YNE ++DLL+
Sbjct: 177 --TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 769

 Score =  118 bits (296), Expect = 2e-26
 Identities = 71/182 (39%), Positives = 107/182 (58%), Gaps = 12/182 (6%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 1104
            D  N  ++ NL +    N  E ++L+ +G  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235  DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 1105 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 1269
                 QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   S
Sbjct: 295  TADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 1270 G------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
                   H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353  TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 1432 NK 1437
             K
Sbjct: 413  TK 414

 Score = 65.5 bits (158), Expect = 6e-10
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 2/109 (1%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  D++F    +Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 122 QKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 175

Query: 439 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 579
              S+  GII   + +LF  +E  ++   + ++ SF+E+YNE++ DLLD
Sbjct: 176 --TSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar to
            uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 819

 Score =  118 bits (295), Expect = 3e-26
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 9/179 (5%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D    I + NL    +    + ++L+ +G  +R  ++T  N+ SSRSH +  + + +K++
Sbjct: 236  DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 1108 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--DKS 1269
                 E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    K 
Sbjct: 296  TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 1270 G---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
            G   H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK K
Sbjct: 356  GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 41/130 (31%), Positives = 69/130 (53%), Gaps = 7/130 (5%)
 Frame = +1

Query: 211 SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVL 375
           SI T   +     MN++R     +  D+VF   ASQ+ +++    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 376 VYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIEL 549
            YG T  GKTYT++G         ++  GII   + +LF  +E  ++   + +  S++E+
Sbjct: 162 AYGATGCGKTYTVSG--------TAENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEI 213

Query: 550 YNEELKDLLD 579
           YNE ++DLL+
Sbjct: 214 YNESIRDLLE 223

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  116 bits (290), Expect = 8e-26
 Identities = 75/166 (45%), Positives = 99/166 (59%), Gaps = 4/166 (2%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 1125
            YI N+    + +      +L+R  K R  AST  N+ SSRSH+IF I L  K++    + 
Sbjct: 522  YITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKS 581

Query: 1126 SK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRES 1293
               +NLVDLAGSE +N S  + +R +E  SIN+SL  LG VI+AL    G   HIPFR S
Sbjct: 582  QGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNS 641

Query: 1294 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            KLT LLQ SL G++KT +   ISPA +   ET ++L +ASK  N K
Sbjct: 642  KLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 46/123 (37%), Positives = 61/123 (49%), Gaps = 6/123 (4%)
 Frame = +1

Query: 226 GDTGITAQMNAKR---YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 396
           GD G+T      +   +  DK+F    + D IF EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 397 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELK 567
           GKTYTM          L+   GI+P  +  +F   D L  +   Y V C FIE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 568 DLL 576
           DLL
Sbjct: 490 DLL 492

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
            similarities with uniprot|P28742 Saccharomyces cerevisiae
            YBL063W KIP1
          Length = 478

 Score =  114 bits (284), Expect = 1e-25
 Identities = 78/211 (36%), Positives = 120/211 (56%), Gaps = 13/211 (6%)
 Frame = +1

Query: 946  YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL-----YKKHQD 1110
            +++ L+E  + N  E ++ + +G ++R V ST MN  SSRSH IF I++     +KK   
Sbjct: 179  FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 1111 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD----KSGHI 1278
             +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    +S  I
Sbjct: 239  VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 1279 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 1458
            P+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K    + +  
Sbjct: 299  PYRESALTWILKENLGGNSNTCLVACVSPENY--YESLSTLRYASLTKKVKTNATINSMS 356

Query: 1459 ----MKDILVKNITMELAKIKSDLLSTKSKE 1539
                M+++  K    EL K+ +D   T + +
Sbjct: 357  HIEQMEELKAK--LRELQKMINDKKPTSAHQ 385

 Score = 67.8 bits (164), Expect = 7e-11
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 13/120 (10%)
 Frame = +1

Query: 256 AKRYTVDKVFGPGAS----QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 423
           AK +  D  FG   S    Q +I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 424 EKLYNGELSDAAGIIPRVLLKLFDTLEL-----QQNDYV----VKCSFIELYNEELKDLL 576
           +           GI+PR   +LF+   +     Q++D +    VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8.678
            YPL155C
          Length = 637

 Score =  115 bits (288), Expect = 1e-25
 Identities = 104/376 (27%), Positives = 176/376 (46%), Gaps = 31/376 (8%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ I  L E    ++ E    +Q G K+R+ + T  N  SSRSH I  + L    
Sbjct: 245  DDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTD 304

Query: 1105 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
                  +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 305  LRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 1270 --------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 1407
                           HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +
Sbjct: 362  GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 1408 ASKAKN----IKNKPQL--GAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMS---QD 1560
            AS+AKN    +  +P +  G++  KD  ++N+T +L K    ++  K +  +  S    D
Sbjct: 422  ASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHNDD 481

Query: 1561 HYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQ 1740
               + NS L   +N V +CK                      TI+ ++S+M ++   I+ 
Sbjct: 482  STVDPNSTLLKAENRVLKCK-----------LSNCEKLLDKDTIELEDSEMVAI---IDM 527

Query: 1741 LKAQLDKQHKTELEISGFNNKL---QKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS 1911
            L   +D     E +  G  ++L   ++ T+ ++  L ++ RRE    + F  H++  I+S
Sbjct: 528  L--PIDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAEPFTAHVNSVIQS 585

Query: 1912 LKTTLFSQLSGMEQNN 1959
                +      +E+ +
Sbjct: 586  KDVEILELRRSLERKD 601

 Score = 74.3 bits (181), Expect = 9e-13
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 4/142 (2%)
 Frame = +1

Query: 166 SVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQD 345
           SVV+    +   E    +    T I+    A  +T D+VF    +   I++  + P+   
Sbjct: 80  SVVIRPKPVANRERDPWHIRDGTTISHD-EAGEFTFDRVFPANCTNLDIYEASSRPMIDK 138

Query: 346 FIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ---- 513
            ++G+N TV  YGMT +GKT+TMTG E        D AG+IP  +  LF  +        
Sbjct: 139 LLQGFNATVFAYGMTGSGKTFTMTGTE--------DEAGLIPLSVTYLFSKILEHSMRGT 190

Query: 514 NDYVVKCSFIELYNEELKDLLD 579
           + Y V  S++E+YNE++ DLLD
Sbjct: 191 SKYEVVVSYLEIYNEKIYDLLD 212

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
            (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  113 bits (282), Expect = 2e-25
 Identities = 78/222 (35%), Positives = 119/222 (53%), Gaps = 26/222 (11%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            ++   +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ +   
Sbjct: 184  NRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDI 243

Query: 1108 D-----ELFRISKMNLVDLAGSENINRS-GALNQRAKEAGSINQSLLTLGRVINAL---- 1257
            D      +   S    VDLAGSE    +    N R KE  SIN+SL TL RV+ +L    
Sbjct: 244  DLNTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKRE 303

Query: 1258 -------ADKSGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 1407
                   ++ S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL Y
Sbjct: 304  ELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRY 361

Query: 1408 ASKAKNIKNKPQLGAFIMKDIL------VKNITMELAKIKSD 1515
            A  A+ IK    +  +    +L      ++ + +E+ K++ D
Sbjct: 362  ADIAQTIKTNSIINTYSNTTLLDNLQKQLRIMEIEVNKLQKD 403

 Score = 80.5 bits (197), Expect = 8e-15
 Identities = 55/171 (32%), Positives = 76/171 (44%), Gaps = 14/171 (8%)
 Frame = +1

Query: 109 ITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFG 288
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 289 PGA----SQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
            G     SQ   +        +D + GYNC +L YG T +GKTYTM G+ K      +D 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 457 AGIIPRVLLKLFDTLE----------LQQNDYVVKCSFIELYNEELKDLLD 579
            G+IPR    LF  +E           Q+++Y V CS  E+YNE++ DLL+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
            Anc_3.479 YPR141C
          Length = 724

 Score =  114 bits (286), Expect = 3e-25
 Identities = 72/167 (43%), Positives = 99/167 (59%), Gaps = 6/167 (3%)
 Frame = +1

Query: 949  IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 1128
            + N+    + N     N+L++  K R  A+T  N+ SSRSH++F I  Y K ++E+   S
Sbjct: 554  VTNINTIALNNKGIVNNVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDS 611

Query: 1129 K---MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRE 1290
                +NLVDLAGSE +N S A+  R +E  +IN+SL  LG VI+AL        HIPFR 
Sbjct: 612  SEGILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRN 671

Query: 1291 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            SKLT LLQ SL G++KT +   ISP K    ET ++L +ASK  + K
Sbjct: 672  SKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           Y  D++F    S   +F E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 445 LSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 576
           L+D  G+IP  +  +FD  E  +     Y + C FIE+YNE + DLL
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL 525

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] {ON}
            Anc_3.479 YPR141C
          Length = 706

 Score =  114 bits (285), Expect = 3e-25
 Identities = 75/175 (42%), Positives = 100/175 (57%), Gaps = 6/175 (3%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D+S    I N+    +        +L R  K R  ASTK N+ SSRSH+IF I L+ K+
Sbjct: 530  DDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKN 589

Query: 1105 Q---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD---K 1266
                ++ + I  +NLVDLAGSE IN S    +R +E   IN+SL  LG VI+AL     K
Sbjct: 590  SKTNEDSYGI--LNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHK 647

Query: 1267 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
              HIPFR SKLT LL+ SL GN+KT +   IS +     ET ++L +ASK  + K
Sbjct: 648  ERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 55/163 (33%), Positives = 77/163 (47%), Gaps = 3/163 (1%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 276
           +EL   + V CR R      +KS    N   I      + + T    IT   N  +Y  D
Sbjct: 369 QELRGNIRVYCRLRPP----LKSIEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKYKFD 424

Query: 277 KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 456
           K+F    S   IF EV G L Q  + GYN  +  YG T +GKT+TM          L+ +
Sbjct: 425 KIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM----------LNPS 473

Query: 457 AGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
            GIIP  +  +F   D L+ +  +Y + C F+E+YNE + DLL
Sbjct: 474 DGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
            Anc_8.678 YPL155C
          Length = 658

 Score =  113 bits (283), Expect = 5e-25
 Identities = 110/395 (27%), Positives = 173/395 (43%), Gaps = 52/395 (13%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   +
Sbjct: 261  DDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHN 320

Query: 1105 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
              D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 321  VIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 1270 --------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 1389
                                 HIP+R+SKLTRLLQ +L GN+    I TI P   T  ET
Sbjct: 378  KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 1390 CSTLEYASKAKNI-------KNKPQLG-AFIMKDILVKNITMELAKIKSDLLSTKSKE-- 1539
             +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K  +   K K   
Sbjct: 438  INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKSSH 497

Query: 1540 -----------GIYMSQDHYKNLNSDLESYKNEVQECK---RDIEXXXXXXXXXXXXXXX 1677
                        I + Q     L   LE+Y+N + +     +D +               
Sbjct: 498  DTSNKFSLDNPNISLLQTENSILKKKLENYENIMNKDMIELQDSQMSEIIDMLPIEIGAL 557

Query: 1678 XXXTIQSQNSQMESLKLTINQLK---AQLDKQHKTELEISGFNNKLQKLTEIMQLALQDY 1848
                 Q   SQ+   +   N+L+     L KQ+++ L  S ++  L K  EI++  LQ  
Sbjct: 558  LENKFQGMESQIRQFQKYTNELENKILNLKKQNRSLLNNSTYS--LDKDDEILE--LQKM 613

Query: 1849 KRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ 1953
              R+  + + F++      ++LK    S ++ + Q
Sbjct: 614  LERKDKIIEAFQSVSKLRDRALKPISQSNIASLPQ 648

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 2/115 (1%)
 Frame = +1

Query: 241 TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 420
           T   N   Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 421 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 579
           D +       +  GI+P  +  LF+ +   +ND  Y V  S++E+YNE++ DLLD
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLD 232

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa] {ON}
            complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  113 bits (283), Expect = 5e-25
 Identities = 68/151 (45%), Positives = 101/151 (66%), Gaps = 4/151 (2%)
 Frame = +1

Query: 976  TNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 1152
            +N  E   L+QR  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543  SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 1153 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSL 1323
            GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603  GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 1324 GGNTKTALIATISPAKVTSEETCSTLEYASK 1416
             G++KT ++ T+SP+  +  ET ++L +A+K
Sbjct: 663  QGSSKTLMLVTVSPSNSSRNETMNSLRFATK 693

 Score = 58.5 bits (140), Expect = 7e-08
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 3/108 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM  +E      
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTMLNEED----- 461

Query: 445 LSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLLD 579
                GIIP  L  + D     +     Y +K  F+E+YN+ + DLL+
Sbjct: 462 -----GIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLN 504

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] {ON}
            Anc_3.479 YPR141C
          Length = 764

 Score =  113 bits (283), Expect = 7e-25
 Identities = 69/142 (48%), Positives = 90/142 (63%), Gaps = 3/142 (2%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 1176
            +L+R  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612  VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSLGGNTKTALI 1350
                +R +E  +IN+SL  LG VI AL DK+   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672  QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 1351 ATISPAKVTSEETCSTLEYASK 1416
              ISP+     ET ++L +ASK
Sbjct: 732  VNISPSSSHINETINSLRFASK 753

 Score = 74.7 bits (182), Expect = 8e-13
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 3/107 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  DK+F  G S D +F EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 445 LSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 576
           L    G+IP  +  +FD +E  +    +Y + C F+E+YNE + DLL
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 47/231 (20%), Positives = 102/231 (44%), Gaps = 5/231 (2%)
 Frame = +1

Query: 1693 QSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLN 1872
            + Q  ++  L+ T+   K +LD+  +  LE+     K QK     +   ++ K ++L L 
Sbjct: 134  KQQVKELNDLQTTLYNRKMELDEL-RDNLEVRKDQLKEQKYAVGRESGSKNTKEQQLRLR 192

Query: 1873 KKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAEL 2052
               +T +SK  + L+      L G + +    E   Q      KN+   L    ++K E 
Sbjct: 193  ---QTELSKLKEDLEARKKFLLDGFKLHLKQMEVENQTK----KNK---LAIEYRDKLEA 242

Query: 2053 MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ-YLKNH 2229
            + +  +KK+ +E  +    + +++D++R       + + + L D++++  N+K+ +LK+ 
Sbjct: 243  VKRVKIKKMEDEKDQ----LAKEVDVLREKIANNDSTLDDMLRDVTQKYENMKEPWLKSF 298

Query: 2230 FFKNNHQELLN----HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
              K      +N      I    +++E+      E  K+  +   E+  +LI
Sbjct: 299  EVKWKENVEINEKCIQEITELRKELEENLQPKAEKLKSKFDSLKEQRDELI 349

 Score = 32.3 bits (72), Expect = 8.3
 Identities = 30/168 (17%), Positives = 66/168 (39%), Gaps = 13/168 (7%)
 Frame = +1

Query: 2329 NTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKC----DSMNNE 2496
            + L + +  N   +   L + T    N +    +   VKW+ + ++  KC      +  E
Sbjct: 263  DVLREKIANNDSTLDDMLRDVTQKYENMKEPWLKSFEVKWKENVEINEKCIQEITELRKE 322

Query: 2497 FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEES---ENAVSXXXXXXXXXXXXXXX 2667
               N+     ++K+  D+     ++ I+ +K Q +E    E  +S               
Sbjct: 323  LEENLQPKAEKLKSKFDSLKEQRDELIAKLKQQQKEHRKIEEEIS--------------- 367

Query: 2668 VNKHTILKD------NIENSITSTHSHITNIDDIYDTIENIMKNYGNK 2793
              K T L++      +++  I+ T S +  +++I    E + ++  NK
Sbjct: 368  -QKKTTLRETEEREASLKEEISKTESDLKELNEILIKEETLRRSLHNK 414

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL216W
            (KIP3)
          Length = 818

 Score =  113 bits (283), Expect = 7e-25
 Identities = 103/409 (25%), Positives = 185/409 (45%), Gaps = 37/409 (9%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            D  +   + NL  +H    +E  ++L+ RG  +R  + T  N+ SSRSH +  + + +  
Sbjct: 239  DSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSS 297

Query: 1105 QDELFRISKM----NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 1272
            +    +  KM    +++DLAGSE  + +    +R  E  +IN+SLL LG  INAL     
Sbjct: 298  RTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGR 357

Query: 1273 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK- 1437
                H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K 
Sbjct: 358  RAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTKV 417

Query: 1438 --------PQLGAFI--------------MKDILVKNITMELAKIKSDLLSTKSKEGIYM 1551
                      +G+++               ++  V ++ ++  ++  + L     EG+  
Sbjct: 418  IRNQHSLDRHVGSYLKMITAQKQEIEELRSREAKVIDLRLQQFRLSRNKLQMAMWEGVNQ 477

Query: 1552 SQDHYKNLNS-DLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKL 1728
             + +Y+ L+          +  CKR                             ++ ++ 
Sbjct: 478  LKSNYQVLDRFQRTKTMKSLMLCKRHF---------------------------LQLVQT 510

Query: 1729 TINQLKAQLDKQHKTELEISGFNNKL--QKLTEIMQLALQDYKRRELDLNKKFETHISKE 1902
             +N L  QL +  K +  +SGF   +  Q LT+I +L          D   +F+  + + 
Sbjct: 511  EVNHL-LQLTESTKVDHPLSGFCQTINEQLLTKICEL------EDSFDAEDEFQLTL-EH 562

Query: 1903 IKSLKTTLFSQLSGMEQ--NNISQETNIQPNLDIIKNEVLTLMETMQEK 2043
             K      F Q+   ++  + +  E  ++   + IKNE++     M +K
Sbjct: 563  AKEADMARFQQMETWDEATDALWYEQQLEHLAESIKNEIMVNASAMMDK 611

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  DK+F   ASQ  +F     PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG------ 179

Query: 439 GELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 579
               D+ GII   + +LF  +        + +  S++E+YNE ++DLL+
Sbjct: 180 --TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
            Anc_3.479 YPR141C
          Length = 698

 Score =  112 bits (281), Expect = 1e-24
 Identities = 77/176 (43%), Positives = 101/176 (57%), Gaps = 7/176 (3%)
 Frame = +1

Query: 925  NDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 1101
            +DQ N    I N+   ++ +     N+L+R  K R  AST  N+ SSRSH+IF I L   
Sbjct: 522  HDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGS 581

Query: 1102 HQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 1272
            +    +E + I  +NLVDLAGSE IN S     R +E  +IN+SL  LG VI+AL     
Sbjct: 582  NSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQ 639

Query: 1273 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
               HIPFR SKLT LLQ SL GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 640  GKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 53/173 (30%), Positives = 77/173 (44%), Gaps = 13/173 (7%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNER-EIGMKSSVVVNVPDITGS---------EEVSINTTGDTGITA 246
           +EL   + V CR R     I  K +  + V D             + + +N    T I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQIP- 401

Query: 247 QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 426
               +R+  DK+F    +   +F EV G L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 402 ----QRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 427 KLYNGELSDAAGIIPRVLLKLFD-TLELQQN--DYVVKCSFIELYNEELKDLL 576
                 L    GIIP  +  +F+ T  L++    Y + C F+E+YNE + DLL
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
            Ashbya gossypii AER441C
          Length = 833

 Score =  113 bits (282), Expect = 1e-24
 Identities = 66/178 (37%), Positives = 103/178 (57%), Gaps = 8/178 (4%)
 Frame = +1

Query: 928  DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 1107
            D  N   + NL      +  + ++L+ +G  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 241  DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 1108 DELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 1272
                +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 301  SVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 360

Query: 1273 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 1437
               H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 361  TYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG------ 181

Query: 439 GELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 579
               +  GII   + +LF  +E       + +  S++E+YNE ++DLL+
Sbjct: 182 --TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  111 bits (277), Expect = 3e-24
 Identities = 69/172 (40%), Positives = 99/172 (57%), Gaps = 5/172 (2%)
 Frame = +1

Query: 931  QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK--H 1104
            +  G YI N+    +T+  +   +L++  K R  A+T+ N+ SSRSH++F + +  +  H
Sbjct: 535  EKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLH 594

Query: 1105 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---H 1275
              E  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI AL        +
Sbjct: 595  TGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRY 653

Query: 1276 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 654  IPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 68.2 bits (165), Expect = 8e-11
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 7/167 (4%)
 Frame = +1

Query: 97  EELNITVAVRCRGR----NEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 264
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN         ++ +  
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINRN-----EGRILSYN 414

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D +F P  +   IF+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIR-QLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 445 LSDAAGIIPRVLLKLFD-TLELQQN--DYVVKCSFIELYNEELKDLL 576
           L+   G+IP  L  +F  T  L++   +Y ++C +IE+YNE + DLL
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
            Anc_8.678
          Length = 655

 Score =  109 bits (273), Expect = 8e-24
 Identities = 71/183 (38%), Positives = 103/183 (56%), Gaps = 15/183 (8%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L+E    ++ E +  ++RG  HR+ A T  N  SSRSH I  I L   +
Sbjct: 273  DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTN 332

Query: 1105 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
              +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 333  VIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 1270 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1419
                      GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+A
Sbjct: 390  HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 1420 KNI 1428
            KN+
Sbjct: 450  KNV 452

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 55/200 (27%), Positives = 85/200 (42%), Gaps = 7/200 (3%)
 Frame = +1

Query: 1   MPAENQNTIQERSS---NNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSV 171
           +P     TI+  SS   NN SNN     G           T+ V  R +        +S 
Sbjct: 71  LPPRRLTTIKRTSSLSSNNTSNNNTTYRG-----------TITVAIRPKPTPPTHFSNSW 119

Query: 172 VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFI 351
           +V  P+    +++                  +  D V+ P  S   I++ +  P+     
Sbjct: 120 LVTDPETIVHDDMG----------------EFKFDHVYSPHVSNLEIYESINKPMIDKLF 163

Query: 352 KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQND 519
           +G+N TV  YGMT +GKTYTM G      G+  D  G+IP  +  LF  +     + +  
Sbjct: 164 QGFNATVFAYGMTGSGKTYTMMGS----GGDGGDDDGLIPLSVSYLFSKVIEVGLVGERK 219

Query: 520 YVVKCSFIELYNEELKDLLD 579
           + V  S++E+YNE + DLLD
Sbjct: 220 FDVLLSYLEIYNERIYDLLD 239

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] {ON}
            Anc_3.479
          Length = 763

 Score =  110 bits (274), Expect = 8e-24
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 11/156 (7%)
 Frame = +1

Query: 997  NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 1167
            N+L+R  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602  NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 1168 NRSGALNQRAKEAGSINQSLLTLGRVINALAD--------KSGHIPFRESKLTRLLQDSL 1323
            N S    +R +E  +IN+SL  LG VI+AL          K  HIPFR SKLT LLQ SL
Sbjct: 660  NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 1324 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720  IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 52/167 (31%), Positives = 80/167 (47%), Gaps = 7/167 (4%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNE---REIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKR 264
           +EL   + V CR R     +E    S + V+   D  G++ + I    +   +      +
Sbjct: 393 QELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNSTTLK 452

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  DK+F    + D +F EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 445 LSDAAGIIPRVLLKLFD-TLELQQN--DYVVKCSFIELYNEELKDLL 576
           L    GIIP  +  +F+ T  L++    Y ++C F+E+YNE + DLL
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
            Anc_3.479 YPR141C
          Length = 704

 Score =  109 bits (273), Expect = 9e-24
 Identities = 77/173 (44%), Positives = 101/173 (58%), Gaps = 4/173 (2%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            N ++    I N+    +T+      LL+R  K R  AST  N+ SSRSH+IF + L  ++
Sbjct: 524  NQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGEN 583

Query: 1105 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--ADKSG- 1272
                 R    +NLVDLAGSE IN S  + +R +E  SIN+SL  LG VI+AL  AD S  
Sbjct: 584  VLTGERSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKR 643

Query: 1273 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            HIPFR SKLT LLQ SL GN+KT +   IS     + ET ++L +ASK  + K
Sbjct: 644  HIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 51/161 (31%), Positives = 76/161 (47%), Gaps = 4/161 (2%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 282
           NI V  R R    RE    + + V    D  G++ + +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 283 FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 462
           F    +   +F E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 463 IIPRVLLKLFD-TLELQQND--YVVKCSFIELYNEELKDLL 576
           IIP  +  +F+ T  L++    Y V C F+E+YNE + DLL
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 731

 Score =  109 bits (273), Expect = 1e-23
 Identities = 70/173 (40%), Positives = 97/173 (56%), Gaps = 4/173 (2%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY-KK 1101
            N ++N   + N+    + +  +   LL++  + R  AST  N+ SSRSH++F I L    
Sbjct: 541  NQETNTTTVTNVTLCPLNSEEQVDGLLRKANRLRSTASTSANERSSRSHSVFIIFLKGSN 600

Query: 1102 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 1272
            H         +NLVDLAGSE IN S  L +R +E  +IN+SL  LG V++AL        
Sbjct: 601  HLTGEQSDGILNLVDLAGSERINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKR 660

Query: 1273 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            HIPFR SKLT LLQ SL GN+KT +   IS  +    ET ++L +ASK  + K
Sbjct: 661  HIPFRNSKLTYLLQYSLTGNSKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 4/161 (2%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 282
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N K    D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQNFK---FDRI 433

Query: 283 FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 462
           F    + + +F+E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 463 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 576
           IIP  +  +F  +E  +    +Y + C FIE+YNE + DLL
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 706

 Score =  109 bits (272), Expect = 1e-23
 Identities = 72/174 (41%), Positives = 99/174 (56%), Gaps = 5/174 (2%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YK 1098
            + +S   ++ N+    +T+      LL+R  K R  A+T  N+ SSRSH++F I L  Y 
Sbjct: 529  DQESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYN 588

Query: 1099 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG-- 1272
             +  E  +   +NLVDLAGSE IN S     R +E  +IN+SL  LG VI+ALA      
Sbjct: 589  SNTGEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASK 647

Query: 1273 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             HIPFR SKLT LLQ SL G++KT +   ISP      ET ++L +ASK  + +
Sbjct: 648  RHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 51/138 (36%), Positives = 66/138 (47%), Gaps = 11/138 (7%)
 Frame = +1

Query: 196 GSEE--VSINTTGDTGITAQMNAKR------YTVDKVFGPGASQDLIFDEVAGPLFQDFI 351
           GSE   V IN   D   T  MN  R      +  DK+F P  S D IF+E+   L Q  +
Sbjct: 382 GSESCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIR-QLVQSSL 440

Query: 352 KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DY 522
            GYN  +  YG T +GKTYTM          L    G+IP  L  +F  + L +    +Y
Sbjct: 441 DGYNVCIFAYGQTGSGKTYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEY 490

Query: 523 VVKCSFIELYNEELKDLL 576
            +   FIE+YNE + DLL
Sbjct: 491 EISSQFIEIYNETIIDLL 508

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 668

 Score =  108 bits (271), Expect = 1e-23
 Identities = 81/250 (32%), Positives = 129/250 (51%), Gaps = 31/250 (12%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++   
Sbjct: 230  DDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCT- 288

Query: 1105 QDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-- 1269
             DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S  
Sbjct: 289  -DEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSG 344

Query: 1270 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 1431
                 GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI  
Sbjct: 345  LSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISL 404

Query: 1432 -----------NKPQLGAFIMKDILVKNITMEL---------AKIKSDLLSTKSKEGIYM 1551
                       +K QL   + K +  + IT++          + I SD    +  E + M
Sbjct: 405  AVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKM 464

Query: 1552 SQDHYKNLNS 1581
              +HY+ L +
Sbjct: 465  KVEHYERLET 474

 Score = 80.1 bits (196), Expect = 1e-14
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 2/107 (1%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF P  + D +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 445 LSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 579
                GIIP  +  +FD +   L +  + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
            (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (268), Expect = 3e-23
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 17/212 (8%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D + G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRSH I  I L    
Sbjct: 225  DDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSD 284

Query: 1105 QDELFRI-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK----- 1266
                  + S ++L DLAGSE +    A ++R +E   IN+SLL LG VI+ L+ +     
Sbjct: 285  LSSGEVVTSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNST 341

Query: 1267 ----SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 1431
                + HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +AS+AKN+  
Sbjct: 342  ESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNVSL 401

Query: 1432 ---NKPQLGAF---IMKDILVKNITMELAKIK 1509
                K  + A+     KD +++++  +L + K
Sbjct: 402  HVVKKSSISAYDANDQKDRIIESLVQQLQEQK 433

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 445 LSDAAGIIP----RVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 579
           +   AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
            (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  108 bits (269), Expect = 3e-23
 Identities = 99/358 (27%), Positives = 170/358 (47%), Gaps = 26/358 (7%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L    
Sbjct: 272  DDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTD 331

Query: 1105 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
                    S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  S    
Sbjct: 332  LVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTT 388

Query: 1270 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI-- 1428
                  HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN+  
Sbjct: 389  PSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSM 448

Query: 1429 ---KNKPQLGAFIMKDILVKNITMELAKIKSDLLSTK-SKEGIYMSQDHYKNLNSDLESY 1596
               +N+ +L     KD L+ N+  +L + +  +   K ++E    + D Y  L  + ++ 
Sbjct: 449  TVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKESDAL 505

Query: 1597 KNEVQECKR----------DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLK 1746
            K ++Q C+R          D +                   IQ   SQ+ S +   +QL+
Sbjct: 506  KRKLQLCERLLDKDEAAVQDDQLVEIVEMLPPAVGALLESKIQGLQSQLRSHRDYSSQLE 565

Query: 1747 AQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKT 1920
             QL     ++L+    +++     + +Q+ LQ+ +    +L+K   T  +K + +L++
Sbjct: 566  RQL-----SDLDSRLSSHQSTASDQSLQILLQEQQEELAELHKSL-TRKNKMLDALQS 617

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +1

Query: 229 DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 408
           D    A  +   +  D VF P ++   ++ ++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 409 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 579
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE++ DLL+
Sbjct: 187 TMSG--------TPEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
            Ashbya gossypii AGR253W
          Length = 711

 Score =  107 bits (268), Expect = 4e-23
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = +1

Query: 949  IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 1128
            I N+ +  +T+  +  ++L+R  + R  A T+ N+ SSRSH++F + +   H D+   +S
Sbjct: 543  ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTGEVS 601

Query: 1129 --KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRES 1293
              K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI AL        HIPFR S
Sbjct: 602  HGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 1294 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            KLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 662  KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 3/104 (2%)
 Frame = +1

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DK+F P  +   +F E+   L Q  + GYN  +  YG T +GKTYTM          L+ 
Sbjct: 420 DKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM----------LNP 468

Query: 454 AAGIIPRVLLKLFD-TLELQQND--YVVKCSFIELYNEELKDLL 576
             G+IP  L  +F  T +L ++   Y + C +IE+YNE + DLL
Sbjct: 469 GDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 654

 Score =  107 bits (267), Expect = 4e-23
 Identities = 85/228 (37%), Positives = 113/228 (49%), Gaps = 31/228 (13%)
 Frame = +1

Query: 907  RSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 1068
            RSS  P       D   G+ I  L E    ++ E L  ++ G K R+   T  N  SSRS
Sbjct: 244  RSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRS 303

Query: 1069 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 1245
            H I  I L K    E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG V
Sbjct: 304  HAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTV 360

Query: 1246 INALADKS-------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1386
            I+ L+ +S             GHIP+R+SKLTR+LQ +L GN     I TI      S E
Sbjct: 361  ISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSE 420

Query: 1387 TCSTLEYASKAKNIK----NKPQL-------GAFIMKDILVKNITMEL 1497
            T +TL +AS+AKN+      KP L       G    KD  + ++T +L
Sbjct: 421  TLNTLRFASRAKNVSLHIFRKPLLPSMSGSNGIVEEKDKTIMSLTRQL 468

 Score = 61.6 bits (148), Expect = 8e-09
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF    +   ++ + + P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 445 LSDAAGIIPRVLLKLFDTL--ELQQND--YVVKCSFIELYNEELKDLLD 579
             +  G+IP  +  L+  +  E  Q D  + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD 222

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3.479
            YPR141C
          Length = 676

 Score =  107 bits (267), Expect = 4e-23
 Identities = 69/181 (38%), Positives = 103/181 (56%), Gaps = 6/181 (3%)
 Frame = +1

Query: 907  RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 1086
            R  +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF I
Sbjct: 492  RHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFII 551

Query: 1087 TLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 1257
             ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N+L
Sbjct: 552  KIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSL 609

Query: 1258 ADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1428
                    HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + 
Sbjct: 610  GSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNST 669

Query: 1429 K 1431
            K
Sbjct: 670  K 670

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 3/108 (2%)
 Frame = +1

Query: 262 RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 441
           +Y+ DKVF    +   IF EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 442 ELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 576
            L+   GIIP     +FD ++    +   Y V C F+E+YN+E+ DLL
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL 478

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
            KAR3Minus-end-directed microtubule motor that functions
            in mitosis and meiosis, localizes to the spindle pole
            body and localization is dependent on functional Cik1p,
            required for nuclear fusion during mating; potential
            Cdc28p substrate
          Length = 729

 Score =  106 bits (265), Expect = 9e-23
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1176
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 1347
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1348 IATISPAKVTSEETCSTLEYASKAKNIK 1431
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 52/164 (31%), Positives = 80/164 (48%), Gaps = 4/164 (2%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           +EL   + V CR R   + +    + ++NV +   +  V          TAQ++  ++  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKF-- 438

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 454 AAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
             GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
            complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  106 bits (264), Expect = 1e-22
 Identities = 67/150 (44%), Positives = 89/150 (59%), Gaps = 6/150 (4%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 1170
            L+++  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539  LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 1171 RSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKT 1341
             S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597  SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 1342 ALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             +   ISP +   +ET ++L +ASK    K
Sbjct: 657  LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 3/109 (2%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           +++  D++F        +FDE+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 439 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
             L+   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE + DLL
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

 Score = 40.0 bits (92), Expect = 0.035
 Identities = 62/293 (21%), Positives = 117/293 (39%), Gaps = 14/293 (4%)
 Frame = +1

Query: 2143 FQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVEN 2322
            FQ      +EN   +   N+NL  +   +  + N  +    +  +  + ++ + +E+ EN
Sbjct: 36   FQNKSQEHSENAPVLQRSNSNLTSFYNQNLTELNELQDNLFNKKTKLDSLKDELNEYKEN 95

Query: 2323 FKNTLN--DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNE 2496
            +K   +  ++L E++    + L+  T+ +I  + D F+ K              D MN E
Sbjct: 96   YKEIQSKWENLRESRVYKQEQLSLKTNELIKLK-DQFKCKE-------------DFMNKE 141

Query: 2497 FYNNMATTLSQIK--NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXV 2670
                 A  L Q+K  NT D S  S      + K + E+ +                   +
Sbjct: 142  H----ALKLKQMKASNTSDISRLSNKYMSDIDKLKFEKIKKYEQERNNLLDEVNIIKEKI 197

Query: 2671 -NKHTILKDNIENSIT----STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILK 2835
             N +TI+K N + + +       S +  +D    + E + K Y ++   + N++ DN+  
Sbjct: 198  SNNYTIVKKNNDEADSKFEQEKSSWLKELDSNISSNEELKKKYNDEVTNLTNDLNDNLNP 257

Query: 2836 EIPS-LSKRVPLRLSNTNGNSAQNILSPKKHAIDDE----NPSNEITDGEESR 2979
            ++ S +SK   L+       S  N    KKH  D E    N   +I +  E +
Sbjct: 258  KLNSQISKLESLKCKLDELKSIMN--EKKKHVSDIELNLINKRQDIKNANEKK 308

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155C KIP2 Kinesin-related motor protein involved in
            mitotic spindle positioning
          Length = 657

 Score =  105 bits (263), Expect = 1e-22
 Identities = 78/251 (31%), Positives = 126/251 (50%), Gaps = 18/251 (7%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L    
Sbjct: 267  DDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTD 326

Query: 1105 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 1272
             +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 327  LKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNM 383

Query: 1273 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 1431
                  HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI  
Sbjct: 384  GVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISL 443

Query: 1432 --NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD-----HYKNLNSDLE 1590
               + ++     KD +++N+  +L +    +   KS  G   + D        +L S+ +
Sbjct: 444  VVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENK 503

Query: 1591 SYKNEVQECKR 1623
              K  ++ C++
Sbjct: 504  VLKLRLEHCEK 514

 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 3/108 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           ++ D VF P      +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSG-------- 198

Query: 445 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 579
            S+  G+IP  +  +F  +    L    + VK S++E+YNE++ DLL+
Sbjct: 199 TSNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  105 bits (263), Expect = 2e-22
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1176
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 1347
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1348 IATISPAKVTSEETCSTLEYASKAKNIK 1431
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 53/166 (31%), Positives = 80/166 (48%), Gaps = 6/166 (3%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREI--GMKSSVV-VNVPDITGSEEVSINTTGDTGITAQMNAKRY 267
           +EL   + V CR R   E    + +S++ VN  D    +   + +   T I +      +
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFD----DNRGVQSMEVTKIQSTTQVHEF 436

Query: 268 TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 447
             DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM          L
Sbjct: 437 KFDKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------L 485

Query: 448 SDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
           +   GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 486 NTGDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
            YPR141C (REAL)
          Length = 729

 Score =  105 bits (263), Expect = 2e-22
 Identities = 66/148 (44%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1176
            +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577  ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 1347
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 1348 IATISPAKVTSEETCSTLEYASKAKNIK 1431
               ISP+     ET ++L +ASK  + +
Sbjct: 697  FVNISPSSSHINETLNSLRFASKVNSTR 724

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 53/164 (32%), Positives = 76/164 (46%), Gaps = 4/164 (2%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSV-VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           +EL   + V CR R   E    S   ++NV +    +   I +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTAQVHEFKF 438

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 454 AAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
             GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
            YPR141C (REAL)
          Length = 731

 Score =  105 bits (263), Expect = 2e-22
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 1176
            +L+R  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 576  VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 1177 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 1347
              +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636  QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 1348 IATISPAKVTSEETCSTLEYASKAKNIK 1431
               ISP+     ET ++L +ASK  + +
Sbjct: 696  FVNISPSSSHINETLNSLRFASKVNSTR 723

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 52/164 (31%), Positives = 80/164 (48%), Gaps = 4/164 (2%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 273
           +EL   + V CR R   E +    + ++NV +   +  V          T Q++  ++  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNRGVQSMEVTKIQNTPQVHEFKF-- 438

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 454 AAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 576
             GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa] {ON}
            similar to uniprot|P17119 Saccharomyces cerevisiae
            YPR141C KAR3 Minus-end-directed microtubule motor that
            functions in mitosis and meiosis localizes to the spindle
            pole body and localization is dependent on functional
            Cik1p required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 702

 Score =  104 bits (260), Expect = 3e-22
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 5/174 (2%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YK 1098
            +++S   +I N+    +T+      +L+R LK R  A+T  N  SSRSH++F I L  Y 
Sbjct: 525  DNESRTTHITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYN 584

Query: 1099 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--ADKSG 1272
                E      +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL  AD S 
Sbjct: 585  TISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASK 643

Query: 1273 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 644  RHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 51/161 (31%), Positives = 75/161 (46%), Gaps = 5/161 (3%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYTVDK 279
           NI V  R R   E E    SS+ +         E   + TG   IT + ++K  ++T D+
Sbjct: 363 NIRVFCRLRPALENENYSSSSIEI---------EKFSDETGMQSITIKRDSKQHKFTFDR 413

Query: 280 VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA 459
            F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          L+   
Sbjct: 414 CFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LNPND 462

Query: 460 GIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDL 573
           GIIP  L  +F  +E  +     Y +   F+E+YNE +KDL
Sbjct: 463 GIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDL 503

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 690

 Score =  103 bits (256), Expect = 1e-21
 Identities = 65/163 (39%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = +1

Query: 949  IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELFRI 1125
            I N+    +        +L+   K + +A+T  N+ SSRSH++FTI ++  +        
Sbjct: 524  ITNVTSIKLETRARVNTVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASD 583

Query: 1126 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-GHIPFRESKLT 1302
              +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI AL  K   HIPFR SKLT
Sbjct: 584  GVLNLVDLAGSERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLT 643

Query: 1303 RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
             LLQ SL G++KT +   +SP+    +ET ++L +ASK  + K
Sbjct: 644  YLLQYSLIGDSKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 80.9 bits (198), Expect = 9e-15
 Identities = 57/161 (35%), Positives = 79/161 (49%), Gaps = 4/161 (2%)
 Frame = +1

Query: 106 NITVAVRCRGRNEREIGMKSSV-VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 282
           NI V  R R   E E+   S + V N  +  GS+ + I+         +    R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISN--------EDRNSRFLFDKV 409

Query: 283 FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 462
           F   AS   +F+EV G L Q  + GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 463 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 576
           +IP  L  +FD   L +    DY  +  FIE+YNE++ DLL
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

 Score = 40.0 bits (92), Expect = 0.035
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 34/219 (15%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKT--ELEISGFNNKLQKLTEIMQLALQDYKR--- 1854
            I + N ++ +    INQLK +LDK++    E  +  F  + + +TE  Q  ++D  +   
Sbjct: 199  IHNLNDEVNNNDNVINQLKEELDKKYSNLKEKWMVEFQTEWKNITEANQSMIKDINKLSQ 258

Query: 1855 -------RELDLNKKFETHISKEIKSL----------KTTLFSQLSGME---QNNISQET 1974
                    ELD +K     + KE+  L          K ++  Q+  +E   +  ISQ  
Sbjct: 259  DIENDMTNELDQSKDKRNILEKELAKLEEKLNEKNVFKESITVQIDTVEEEIEQTISQRK 318

Query: 1975 NIQPNLDIIKNEVLTL------METMQEKAELMYKDC---VKKILNESPKFFNVIVEKID 2127
             +   +   KNE+L +       ETM+ K     ++    ++      P   N   E  D
Sbjct: 319  ELNEYITNSKNELLQINEILIKEETMRRKLHNELQELRGNIRVYCRIRPPLEN---EVQD 375

Query: 2128 IIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNN 2244
            I  +    F N       +IS E+ N  ++L +  F +N
Sbjct: 376  ISHIHVSNFDNRNGSQAIEISNEDRN-SRFLFDKVFSSN 413

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  102 bits (253), Expect = 2e-21
 Identities = 73/196 (37%), Positives = 100/196 (51%), Gaps = 28/196 (14%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E    ++ E +N + +G K R+ A T  N  SSRSH I  I L    
Sbjct: 275  DDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD 334

Query: 1105 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
              +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 335  MKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 1270 -----------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 1380
                                   GHIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392  SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 1381 EETCSTLEYASKAKNI 1428
             ET +TL +AS+AKNI
Sbjct: 452  AETLNTLRFASRAKNI 467

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 6/197 (3%)
 Frame = +1

Query: 4   PAENQNTIQERSSNNISNNLNAQIGCHGV--PNEELNITVAVRCRGRNEREIGMKSSVVV 177
           PA ++++   RS ++IS++ +A    + +   N +   T +          + ++     
Sbjct: 52  PANSRSSSPLRSVSSISDHFHAPRRFNTIRRTNSQTYNTKSEHSTYTGTITVAIRPKPTS 111

Query: 178 NVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKG 357
           N  D++ S  +      D    A  +   +  D VF    S   I+  +  P+     +G
Sbjct: 112 NPSDVSTSSWL----VTDEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRPMIDKLFQG 167

Query: 358 YNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND----YV 525
           +N T+  YGMT +GKTYTM G       E     G+IP  +  LF  +  +  D    + 
Sbjct: 168 FNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIMEETLDGDKKFE 222

Query: 526 VKCSFIELYNEELKDLL 576
           +  S++E+YNE++ DLL
Sbjct: 223 IVLSYLEIYNEKIYDLL 239

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] {ON}
            similar to uniprot|P28743 Saccharomyces cerevisiae
            YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  100 bits (249), Expect = 7e-21
 Identities = 70/194 (36%), Positives = 102/194 (52%), Gaps = 26/194 (13%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L +     + E L+ + +G K+R+ + T+ N  SSRSH I  I L  K 
Sbjct: 263  DDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKD 322

Query: 1105 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADKSG-- 1272
             +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+ L A+ +G  
Sbjct: 323  IRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 1273 ----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1386
                                  HIP+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380  HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 1387 TCSTLEYASKAKNI 1428
            T +TL +AS++KN+
Sbjct: 440  TLNTLRFASRSKNV 453

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 4/134 (2%)
 Frame = +1

Query: 190 ITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 369
           I G + +S N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 370 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCS 537
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L      +     V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 538 FIELYNEELKDLLD 579
           ++E+YNE++ DLLD
Sbjct: 220 YLEIYNEKINDLLD 233

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] {ON}
            Anc_2.633 YKL079W
          Length = 644

 Score = 99.8 bits (247), Expect = 1e-20
 Identities = 100/417 (23%), Positives = 193/417 (46%), Gaps = 26/417 (6%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            + + + I I+NL+  ++T+ +E L+  ++G   R +AS       SRS  I  IT+ ++ 
Sbjct: 183  DSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRD 232

Query: 1105 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD------ 1263
               E+F+     LVDL  S+ I++   L    +    INQS++TL  V  +LA       
Sbjct: 233  NVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVK 292

Query: 1264 ----KSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 1425
                +SG  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K 
Sbjct: 293  NGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKL 352

Query: 1426 IK-----NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLE 1590
            +K     NK    +  M D+L+K+   +    +S  +    KE + + +  Y    S+  
Sbjct: 353  VKNLFQQNKAGTNSKAMLDLLMKDFDAKEKNYQSH-IQLLEKELMNLKKLQY---GSETA 408

Query: 1591 SYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHK 1770
              +NE+    + ++                        +Q+ESL   ++   ++ +   K
Sbjct: 409  DKQNEIMLENKKLK------------------------AQLESLSQLLHSSSSKANVSTK 444

Query: 1771 TELEISG----FNNKLQKLTEI-MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQ 1935
             + E S        K +K+ E+ M+L  +    + L    +F++   + + ++   L  Q
Sbjct: 445  NDEEHSKIMGILMEKCEKVMEVQMRLDNEISSNKSLTSQLEFKSSKEEALAAMNLKLLEQ 504

Query: 1936 LSGMEQ---NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2097
            L   E+   + ++   +++ +L+   N   +  ET+ +   ++ +  V K+ N + +
Sbjct: 505  LQANEEEMKDLLASNLHMRQDLEKWSNLANSRFETIGDLEGMLREVHVSKLENPAAR 561

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 3/114 (2%)
 Frame = +1

Query: 244 AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 423
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFGY 123

Query: 424 EKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 576
            K          G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 124 NK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
            YPL155C
          Length = 696

 Score = 99.4 bits (246), Expect = 2e-20
 Identities = 70/219 (31%), Positives = 112/219 (51%), Gaps = 24/219 (10%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L    
Sbjct: 243  DDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATD 302

Query: 1105 QDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 1272
             +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L+ +S    
Sbjct: 303  LETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHR 359

Query: 1273 ----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 1404
                            HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL 
Sbjct: 360  NADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLR 419

Query: 1405 YASKAKNIK----NKPQLGAFIMKDILVKNITMELAKIK 1509
            +AS+AKN+      K  +     KD L+  +  +L + K
Sbjct: 420  FASRAKNVSLHVTKKQNVSKDEEKDKLIFTLIQQLEEQK 458

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 46/144 (31%), Positives = 74/144 (51%), Gaps = 4/144 (2%)
 Frame = +1

Query: 160 KSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLF 339
           K  V +    I+ +E+   N   +  I A  +   + +D++F    S   I+ E+  PL 
Sbjct: 75  KIIVAIRPKPISNNEKKVWNIVDNKRI-AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLI 133

Query: 340 QDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLE----L 507
                GYN T+  YGMT +GKT+TM+G +        +  G+IP  +  LF+T+     L
Sbjct: 134 DKLAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLL 185

Query: 508 QQNDYVVKCSFIELYNEELKDLLD 579
            +  Y +  S++E+YNE+L DLLD
Sbjct: 186 GKKKYEMLVSYMEIYNEKLYDLLD 209

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
            similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 71/211 (33%), Positives = 108/211 (51%), Gaps = 20/211 (9%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L +  
Sbjct: 270  DDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCE 329

Query: 1105 QDELFRI-SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 1269
                  + S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L+  S    
Sbjct: 330  LKTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSG 386

Query: 1270 ------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 1413
                        GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+ +AS
Sbjct: 387  SGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFAS 446

Query: 1414 KAKNIK---NKPQLGAFIMKDILVKNITMEL 1497
            +AKNI     K ++     KD +++N+  +L
Sbjct: 447  RAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 5/109 (4%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 445 LSDAAGIIPRVLLKLFD-----TLELQQNDYVVKCSFIELYNEELKDLL 576
                G+IP  +  +FD     T +  ++ Y VK S++E+YNE++ DLL
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.8 bits (242), Expect = 5e-20
 Identities = 71/209 (33%), Positives = 111/209 (53%), Gaps = 18/209 (8%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 1098
            +D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L +  
Sbjct: 269  DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 1099 -KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 1260
             K   E    S ++L DLAGSE   R+     R KE   IN+SLL LG VI  L+     
Sbjct: 329  LKTGSEA--TSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQ 383

Query: 1261 -------DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1419
                     +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS+A
Sbjct: 384  ANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRA 443

Query: 1420 KNIK---NKPQLGAFIMKDILVKNITMEL 1497
            KNI     K ++ +   KD +++N+  +L
Sbjct: 444  KNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF  G     ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 445 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLD 579
                G+IP+ +  +FD +  + +     Y VK S++E+YNE++ DLL+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar to
            uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
            Kinesin-related motor protein involved in mitotic spindle
            positioning
          Length = 678

 Score = 97.4 bits (241), Expect = 6e-20
 Identities = 67/188 (35%), Positives = 99/188 (52%), Gaps = 20/188 (10%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D  +G+ +  L E  + ++ + L  ++ G  +R+   T  N  SSRSH I TI   K  
Sbjct: 269  DDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KVT 325

Query: 1105 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 1272
              EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  SG
Sbjct: 326  CTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSG 382

Query: 1273 ----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 1404
                            H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ 
Sbjct: 383  ASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIR 442

Query: 1405 YASKAKNI 1428
            +AS+AKN+
Sbjct: 443  FASRAKNV 450

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 3/105 (2%)
 Frame = +1

Query: 274 DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 453
           DKVF P  +   +++E+  P+     +GYN T+  YGMT +GKT+TM+G          D
Sbjct: 143 DKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR--------D 194

Query: 454 AAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 579
            AG+I   + ++F  +    +    Y V+ S++E+YNE++ DLL+
Sbjct: 195 EAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
            KIP2Kinesin-related motor protein involved in mitotic
            spindle positioning, stabilizes microtubules by targeting
            Bik1p to the plus end; Kip2p levels are controlled during
            the cell cycle
          Length = 706

 Score = 95.1 bits (235), Expect = 3e-19
 Identities = 71/200 (35%), Positives = 99/200 (49%), Gaps = 32/200 (16%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   +
Sbjct: 297  DDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN 356

Query: 1105 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 1266
             ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357  VKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 1267 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 1368
                                      S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414  GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 1369 KVTSEETCSTLEYASKAKNI 1428
               + ET +TL +AS+AKN+
Sbjct: 474  NDAAAETMNTLRFASRAKNV 493

 Score = 62.4 bits (150), Expect = 5e-09
 Identities = 54/208 (25%), Positives = 91/208 (43%), Gaps = 16/208 (7%)
 Frame = +1

Query: 4   PAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCR----GRNEREIGMKSSV 171
           P  +   I+ R S++I+NN        G      +ITV +R +    G +   +G+KS  
Sbjct: 74  PFLHPGRIRIRRSDSINNNSRKNDTYTG------SITVTIRPKPRSVGTSRDHVGLKSP- 126

Query: 172 VVNVPDITGSEEVSINT--------TGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA 327
                    +     NT        T D  I  +     +  D VF    +   +++  +
Sbjct: 127 --RYSQPRSNSHHGSNTFVRDPWFITNDKTIVHE-EIGEFKFDHVFASHCTNLEVYERTS 183

Query: 328 GPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLEL 507
            P+    + G+N T+  YGMT +GKT+TM+G+E+          G+IP  +  LF  +  
Sbjct: 184 KPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ--------ELGLIPLSVSYLFTNIME 235

Query: 508 Q----QNDYVVKCSFIELYNEELKDLLD 579
           Q       + V  S++E+YNE + DLL+
Sbjct: 236 QSMNGDKKFDVIISYLEIYNERIYDLLE 263

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
            complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 90/375 (24%), Positives = 168/375 (44%), Gaps = 24/375 (6%)
 Frame = +1

Query: 937  NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 1113
            NG  ++NL+   +    E   L+   L +++    + N+   RSHTI  +++ K+++ DE
Sbjct: 191  NGFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 1114 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--DKSGHI--- 1278
               +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L   ++ G I   
Sbjct: 248  SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 1279 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 1434
                    P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308  ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 1435 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 1614
             P++  F +      +I +   K+K D   + +        +   NL +   S ++E++ 
Sbjct: 368  NPRINRFGLNSKATMDIFLTDMKLKEDNFISITNN----LTNQVNNLMTQANSLEDELKN 423

Query: 1615 CKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQ--LKAQLDK-QHKTELEI 1785
             +                         +  SQ++      N   L   L+K +H   LE+
Sbjct: 424  NETKYNKKETNILKSQVETLTELLNNPNNRSQVDLRNQNENTEILTKLLEKCEHNASLEL 483

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQL-------SG 1944
            S  ++K++++  I++    +YK R +   +    H+   +  L+  + S L        G
Sbjct: 484  S-LDDKMKEIL-ILRRRESEYKAR-IASTETMNQHLLDRVTELELQMKSLLVGNSNFEIG 540

Query: 1945 MEQNNISQETNIQPN 1989
            ++  N+ Q +++ PN
Sbjct: 541  IDNENMGQYSSLTPN 555

 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 43/135 (31%), Positives = 73/135 (54%), Gaps = 12/135 (8%)
 Frame = +1

Query: 211 SINTTGDTGITA----QMNAKRYTVDKVFGPGASQD--LIFDEVAGPLFQDFIKGYNCTV 372
           SIN T DT +T     Q+   +Y  DKVF   AS D  +   E      +  ++GYN ++
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASNDTGVEHQEFIESNLESLLQGYNTSI 107

Query: 373 LVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND------YVVKC 534
           + YG + TGK++ + G+++          G+I ++L KLF+ ++ +  +      Y VK 
Sbjct: 108 VTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKF 158

Query: 535 SFIELYNEELKDLLD 579
           SF+E+Y E++ DL+D
Sbjct: 159 SFLEVYQEKMFDLMD 173

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
            YPL155C (REAL)
          Length = 706

 Score = 93.6 bits (231), Expect = 1e-18
 Identities = 71/200 (35%), Positives = 96/200 (48%), Gaps = 32/200 (16%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E    +  E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297  DDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTD 356

Query: 1105 QDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 1266
             +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357  VNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSV 413

Query: 1267 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 1368
                                      S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414  DSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 1369 KVTSEETCSTLEYASKAKNI 1428
               + ET +TL +AS+AKN+
Sbjct: 474  NDAAAETMNTLRFASRAKNV 493

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF    +   +++    P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 445 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLD 579
                G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL+
Sbjct: 218 ---ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLE 263

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
            YPL155C (REAL)
          Length = 704

 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 70/200 (35%), Positives = 97/200 (48%), Gaps = 32/200 (16%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297  DDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 1105 QDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 1266
             +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357  LESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPT 413

Query: 1267 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 1368
                                      + HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414  GSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 1369 KVTSEETCSTLEYASKAKNI 1428
               + ET +TL +AS+AKN+
Sbjct: 474  NDAAAETINTLRFASRAKNV 493

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 445 LSDAAGIIPRVLLKLF-DTLELQQN---DYVVKCSFIELYNEELKDLLD 579
                G+IP  +  LF + +EL  N    + V  S++E+YNE + DLL+
Sbjct: 218 ---ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLE 263

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
            (REAL)
          Length = 715

 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 71/206 (34%), Positives = 98/206 (47%), Gaps = 38/206 (18%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297  DDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 1105 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 1266
             +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357  VRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 1267 --------------------------------SGHIPFRESKLTRLLQDSLGGNTKTALI 1350
                                            S HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414  GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 1351 ATISPAKVTSEETCSTLEYASKAKNI 1428
             T+      + ET +TL +AS+AKN+
Sbjct: 474  CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 4/109 (3%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VF    +   ++++ + P+    + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 445 LSDAAGIIPRVLLKLFDTLELQ----QNDYVVKCSFIELYNEELKDLLD 579
                G+IP  +  LF  +  Q       + V  S++E+YNE + DLL+
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLE 263

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
            YPL155C
          Length = 625

 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 64/184 (34%), Positives = 92/184 (50%), Gaps = 16/184 (8%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 1104
            +D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   +
Sbjct: 237  DDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTN 296

Query: 1105 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 1272
              +     + ++L DLAGSE  +      +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 297  LLNGTTHFNTLSLCDLAGSEKASEQ---LERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 1273 ------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1416
                        HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS+
Sbjct: 354  SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 1417 AKNI 1428
            AKN+
Sbjct: 414  AKNV 417

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 37/105 (35%), Positives = 58/105 (55%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G    +N  
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG----HNDG 182

Query: 445 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 579
           +    G    V  ++ +  + +Q    V  S++E+YNE++ DLL+
Sbjct: 183 IVKMCG--DCVFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 88.6 bits (218), Expect = 3e-17
 Identities = 56/161 (34%), Positives = 91/161 (56%), Gaps = 3/161 (1%)
 Frame = +1

Query: 943  IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 1119
            I + + ++  I  + +   L++ G   R   ST MN+ SSRSH++F + +   ++  +  
Sbjct: 508  IKLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEH 567

Query: 1120 RISKMNLVDLAGSENINRSGALNQRA--KEAGSINQSLLTLGRVINALADKSGHIPFRES 1293
               ++NLVDLAGSE + +   +  +   KE  SIN+SL  L  VI+++  +  +IPFR S
Sbjct: 568  STGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNS 627

Query: 1294 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1416
            KLT LL++SL   +KT +   ISP   +  ET ++L  A K
Sbjct: 628  KLTYLLKNSLINKSKTLMYVNISPNINSIRETINSLRLARK 668

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           +T DK+FG       +FD++   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 445 LSDAAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 579
           L++  GII +    ++     L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
            YPL155C
          Length = 468

 Score = 86.3 bits (212), Expect = 9e-17
 Identities = 53/150 (35%), Positives = 85/150 (56%), Gaps = 5/150 (3%)
 Frame = +1

Query: 994  LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 1173
            L L+ +G ++R+V ST+ N  SSRSH +  + +         +   + L DLAGSE    
Sbjct: 241  LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSMGS---KARVLTLCDLAGSER--- 294

Query: 1174 SGALNQRA--KEAGSINQSLLTLG---RVINALADKSGHIPFRESKLTRLLQDSLGGNTK 1338
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN  
Sbjct: 295  -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 1339 TALIATISPAKVTSEETCSTLEYASKAKNI 1428
              ++ T+S +    E++  TL +A +A  +
Sbjct: 354  VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 27/70 (38%), Positives = 37/70 (52%)
 Frame = +1

Query: 367 TVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIE 546
           T++ YG T +GKTYTM G         + A G I  V L + D L     +  +  S++E
Sbjct: 142 TIIAYGATGSGKTYTMHG---------TKAEGGI--VQLSIRDLLTQLSKNCQITISYLE 190

Query: 547 LYNEELKDLL 576
           +YNE L DLL
Sbjct: 191 IYNERLHDLL 200

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
            Anc_2.633 YKL079W
          Length = 682

 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 79/343 (23%), Positives = 153/343 (44%), Gaps = 13/343 (3%)
 Frame = +1

Query: 931  QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ- 1107
            +  G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + 
Sbjct: 205  EHKGLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKL 261

Query: 1108 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS------ 1269
            DE    S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L+  S      
Sbjct: 262  DESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKN 321

Query: 1270 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
                    +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K
Sbjct: 322  YEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSK 381

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 1611
              PQ+  F + +    +I +E  K+K +    +  E +   ++    + +  ES   E  
Sbjct: 382  TVPQINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEEL 441

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
               R  E                   + S +  +E+ K   N    + +  +  E  +  
Sbjct: 442  NKLRS-ENAKLKAQVNTLTQLMVSPKLASPSPMLENNKTVRNNSAERNETSY--ENVVQT 498

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKT 1920
               K +KL +  +L+L D K +++ + K+    I   I S++T
Sbjct: 499  LMEKCEKLAD-TELSLDD-KLKDILVLKRENDQIKSNIASIET 539

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 28/105 (26%), Positives = 55/105 (52%), Gaps = 6/105 (5%)
 Frame = +1

Query: 280 VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA 459
           +F   ++ DLI + +   +  + ++GYN  ++ YG   +GKTY+      LY  ++ D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 460 GIIPRVLLKLFDTLELQQND------YVVKCSFIELYNEELKDLL 576
           G+   +   LF  +     D      ++VK SF+E++ +++ DLL
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
            YKL079W
          Length = 803

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 108/469 (23%), Positives = 201/469 (42%), Gaps = 39/469 (8%)
 Frame = +1

Query: 922  PNDQSNG--IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 1095
            PN + N   + I+NL++ ++ +  E  + L  G  +R      M   +SRS+ +  I L 
Sbjct: 228  PNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLE 282

Query: 1096 KKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 1272
            +   +D+L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN LA+ +G
Sbjct: 283  QVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE-TG 341

Query: 1273 HIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1419
              P+ +           S L  ++   +GGN KT  I+TISP      ET  TL  + + 
Sbjct: 342  TSPYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRISEQI 401

Query: 1420 KNI--------KNKPQLGA-----FIMKDILVKN--ITMELAKIKSDLLSTKSKEGIYMS 1554
            K+I        KN   L +      I  DI +K      ++  ++  L   KS   I   
Sbjct: 402  KSIISSSNNINKNIKGLNSKKELELIRMDINLKEEYYKCQIRILEEQLKLMKSHSNIITE 461

Query: 1555 QDHYKN--LNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS--QNSQMESL 1722
             +  +N  L  +++  + E ++ K+ ++                  TI +   N   E  
Sbjct: 462  TNTTRNSGLQEEIKYQEKENRKLKKQVKTLAYILTKTNRNNKSATNTISNDDMNQGDEID 521

Query: 1723 KLTINQLKAQLDKQHKT----ELEISGFNNKL--QKLTEIMQLALQDYKRRELDLNKKFE 1884
               IN    +L+KQ       + +  G  N L  +  +E +   L +   + ++L    +
Sbjct: 522  GNNINDDDNELNKQDTNLADEDDDDDGDGNSLETEDNSEHLLNTLLEKCEQVVELQLSLD 581

Query: 1885 THISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 2064
              I+K +   K T FS+  G     ++ +   Q NL +  +  +TL E + ++ E+ +  
Sbjct: 582  EEINKGLILQKQTEFSKFKGQTLETMNLKLLDQINL-LEADLQMTLAENVSKRKEIEH-- 638

Query: 2065 CVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLK 2211
             +K+I N        +   I    +  +    N + +++  +  NNNLK
Sbjct: 639  -LKQIANSRKSRIQYLENDIKEKDISIKSIATNNSLSVNQ-TNSNNNLK 685

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)
 Frame = +1

Query: 220 TTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 396
           TTG+T          + VDKVF     Q DL+  ++      +   G+N +++ +G + T
Sbjct: 45  TTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGT 95

Query: 397 GKTYTMTGDEKL 432
           GK++TM G+  L
Sbjct: 96  GKSFTMFGNNSL 107

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 99/375 (26%), Positives = 172/375 (45%), Gaps = 33/375 (8%)
 Frame = +1

Query: 1060 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 1230
            S+SH +F + + ++++ +++ + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233  SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALK--KLNQSIE 290

Query: 1231 TLGRVINALADK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 1380
             L  ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291  ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 1381 EETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 1560
              T STLE+    + I NK      +M      N+  ++     D+   K K+  Y+SQ 
Sbjct: 351  --TISTLEFGDNIRQIINK------VMSSTTGLNMKKKMDLFVQDM---KIKDDNYVSQI 399

Query: 1561 HYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQ 1740
            +   L S+L+S K+   E                        + +   +++E+ +    +
Sbjct: 400  NI--LKSELDSLKDLSNESS----------------------SREDMKTELENYEKENVK 435

Query: 1741 LKAQLDKQHKTELEISGF-----NNKLQKLTEIMQLALQDYKRRELD----------LNK 1875
            LK QLD    T+L  S       NN   ++ EI+    +   + EL           L K
Sbjct: 436  LKLQLDS--ITQLLSSSTNENPNNNIDDEVAEILMKRCEQIAQLELSFDRQMNANSKLRK 493

Query: 1876 KFETHISKE--IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT---LMETMQE 2040
            +FE   SKE  ++S+   L  Q+  +++  I +   +  N  I+K E+ T   L ET  E
Sbjct: 494  EFEYKKSKEEALESMNVRLLEQIQ-LQEKEIQE---LLTNNAILKGELDTHTKLAETRSE 549

Query: 2041 KAELMYKDCVKKILN 2085
            K + + +D VK++ N
Sbjct: 550  KIKSL-EDSVKELTN 563

 Score = 64.7 bits (156), Expect = 9e-10
 Identities = 57/187 (30%), Positives = 88/187 (47%), Gaps = 4/187 (2%)
 Frame = +1

Query: 28  QERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEE 207
           +E+SS+++S  L A       P E L  T+  +  G    E   K + V N      S+ 
Sbjct: 8   KEQSSSSVS--LPAIDSSEPCPIEVLLRTIPEK--GLQNNESTFKINSVDNTVLFRTSKP 63

Query: 208 VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 387
           +  N TG    T Q        DKVF   A+Q  + D +  P  +D + GYN T+L YG 
Sbjct: 64  LH-NATGSPHSTFQF-------DKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGP 115

Query: 388 TSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYN 555
           + +GK+Y++ G +  YN       G++P +   LF+TLE  +     ++ V     E+Y 
Sbjct: 116 SFSGKSYSLLGSQ--YN------EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYM 167

Query: 556 EELKDLL 576
           E+  DLL
Sbjct: 168 EKSYDLL 174

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 88/359 (24%), Positives = 162/359 (45%), Gaps = 20/359 (5%)
 Frame = +1

Query: 937  NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 1116
            +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195  HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 1117 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK----SGHIPF 1284
             R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L ++    S H  F
Sbjct: 250  TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 1285 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 1449
            ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308  KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 1450 AFIMKDILVKNITME----LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 1617
            A    D+LV+++ ++    LAKI  +LL T+ K    +  ++    NS   S +N +QE 
Sbjct: 365  AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKT---LKTENDSTTNSTSNSLENALQEN 419

Query: 1618 KRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLK-AQLDKQHKTEL-EISG 1791
             +                            Q+ESL+  +  +  A     +K E+ E   
Sbjct: 420  SK-------------------------LKLQLESLQQILGTMSLANPSSSNKNEMNEHDE 454

Query: 1792 FNNKLQKLTE---IMQLALQDYKRRELDLNKKFETHISKE--IKSLKTTLFSQLSGMEQ 1953
               KL    E    +QL++ + K     L K+ + + SKE   +++ +TL  Q+   E+
Sbjct: 455  LLKKLMSTCEDVANLQLSVDNGKHINRKLKKQIDANSSKEDVFETMNSTLLKQIQNQEK 513

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 30/104 (28%), Positives = 48/104 (46%)
 Frame = +1

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
           Y  D +F   + +   +D +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTND- 144

Query: 445 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 576
                G+I  +  +L           +   S  ELY +++ DLL
Sbjct: 145 -----GLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLL 183

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
            (REAL)
          Length = 656

 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 86/375 (22%), Positives = 169/375 (45%), Gaps = 40/375 (10%)
 Frame = +1

Query: 1048 NDFSSRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQS 1224
            N   S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS
Sbjct: 229  NTERSKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQS 288

Query: 1225 LLTLGRVINALADK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 1374
            +  L  ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   + V
Sbjct: 289  IEALKNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNV 348

Query: 1375 TSEETCSTLEYASKAKNIKN-----------KPQLGAFIMKDILVK--NITMELAKIKSD 1515
            ++  T STLE+    + I N           K ++  FI +D+ ++  N    +  +K++
Sbjct: 349  ST--TLSTLEFGECIRQITNKVIDNTTGLNLKKKMDLFI-EDMKIRDNNYASRINILKAE 405

Query: 1516 LLSTKSKEGIYMSQDHYKNL--NSDLESYKNEVQ-ECKRDIEXXXXXXXXXXXXXXXXXX 1686
            + S K+  G  +SQ   K    NS+ E+ K ++Q +    +                   
Sbjct: 406  IDSLKTPSGELVSQGDMKTKFENSEKENAKLKLQLDSISLLLSSSTSENPNHSIDEEVAE 465

Query: 1687 TIQSQNSQMESLKLTI-------NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQD 1845
             +  +  Q+  L+L+        ++L+ +L+ +   E  +   N +L +  +I +  +Q+
Sbjct: 466  ILMKRCEQVAQLELSFDRQMNVNSKLQKELEYKISKEKALESMNVRLLEQIQIQEKEIQE 525

Query: 1846 YKRRELDLNKKFETHI------SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 2007
                   L  + ETH       S+ IK L+       S +++ +I++ T   P    + +
Sbjct: 526  LLTTNAILKGELETHAKLTETRSERIKYLE-------SSIKELSINKSTASSPRKGSVSS 578

Query: 2008 EVLTLMETMQEKAEL 2052
                 M  ++E +EL
Sbjct: 579  SSGNTMSHIEEGSEL 593

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 4/130 (3%)
 Frame = +1

Query: 199 SEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 378
           + E S  TTGDT  T       +  DKVF   A+Q+ + D +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 379 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIE 546
           YG + +GK+Y++ G +        +  GI+P +   LF+TLE  +    N++ V     E
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 547 LYNEELKDLL 576
           ++ E+  DLL
Sbjct: 165 IFMEKTYDLL 174

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
            that interacts with Myo2p, proposed to be involved in
            exocytosis; N-terminal domain is related to the motor
            domain of kinesins
          Length = 656

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 78/329 (23%), Positives = 151/329 (45%), Gaps = 40/329 (12%)
 Frame = +1

Query: 1060 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1236
            SRSH +F + + ++++ D++ + S + LVDL G+E  ++             +NQS+  L
Sbjct: 233  SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 1237 GRVINALADK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1386
               + +L+ K          S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 293  KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 1387 TCSTLEYASKAKNIKN-----------KPQLGAFIMKDILVK--NITMELAKIKSDLLST 1527
            T STLE+    + I N           K ++  FI +D+ +K  N   ++  +K+++ S 
Sbjct: 351  TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFI-QDMKIKDDNYVAQINILKAEIDSL 409

Query: 1528 KSKEGIYMSQDHYKNL--NSDLESYKNEVQ-ECKRDIEXXXXXXXXXXXXXXXXXXTIQS 1698
            KS     + +D  K +  N+  E+ K ++Q +    +                    +  
Sbjct: 410  KSLHNKSLPEDDEKKMLENTKKENIKLKLQLDSITQLLSSSTNEDPNNRIDEEVSEILTK 469

Query: 1699 QNSQMESLKLTI-------NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRR 1857
            +  Q+  L+L+        ++L+ +L+ +   E  +   N +L +  ++ +  +Q+    
Sbjct: 470  RCEQIAQLELSFDRQMNSNSKLQQELEYKKSKEEALESMNVRLLEQIQLQEREIQELLTT 529

Query: 1858 ELDLNKKFETHI------SKEIKSLKTTL 1926
               L  + ETH       S+ IKSL++++
Sbjct: 530  NAILKGELETHTKLTETRSERIKSLESSV 558

 Score = 63.2 bits (152), Expect = 3e-09
 Identities = 36/116 (31%), Positives = 60/116 (51%), Gaps = 4/116 (3%)
 Frame = +1

Query: 241 TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 420
           T +     +  DKVF   A+Q+ +   +  P+  D + GYN TV+ YG + +GK+Y++ G
Sbjct: 67  TTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIG 126

Query: 421 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLL 576
            +        ++ GI+P +   LFDTLE  +    + + V     E+Y E+  DLL
Sbjct: 127 SK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
            YDR356W
          Length = 989

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 96/451 (21%), Positives = 178/451 (39%), Gaps = 1/451 (0%)
 Frame = +1

Query: 1459 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXX 1638
            MK   ++N+ +EL  +K   L+TK KE +   ++   N++S+ E YK        D E  
Sbjct: 345  MKLSEIENLELELNDLKD--LNTKLKESLNDKENELTNVSSEYEKYK-------LDAEAH 395

Query: 1639 XXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLT 1818
                             I+ +N ++ S  L +N++   L             N++L  L 
Sbjct: 396  MGIMKDSDDKLKNQVIEIRKKNIELNSKLLQMNEVNENL-------------NDELMSLK 442

Query: 1819 EIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDI 1998
            +I++   QD K +             +E+KSLK++  SQ+  ++QNN++ E  ++ NLD 
Sbjct: 443  DIIEKLEQDKKAK------------LQELKSLKSSDISQIEDLKQNNLTLERKLKENLD- 489

Query: 1999 IKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENL 2178
             KN  +  +       +      V K+  ES        +KI+ +        N +  N+
Sbjct: 490  EKNVEINKLRRQHVDMQKTNSALVDKLTKESQSLRKEYEDKINDLE-------NQLKSNI 542

Query: 2179 SDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEEN 2358
            +D+S   + L     +   K N +   N H   T E+I       +++ KN L +++  N
Sbjct: 543  TDLSTNKDLLAVEYNSKMDKLNKELEENKHALKTSEEI-------IKDLKNQLIENV-TN 594

Query: 2359 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFD-LINKCDSMNNEFYNNMATTLSQIK 2535
                +  LT A ++ I   +   E  R K+    + LIN+ +     +       L + K
Sbjct: 595  SSQKLAKLTEAKNSEIESLLSQMESLRNKYRKKTETLINEQEEERQSYIRK----LREEK 650

Query: 2536 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSIT 2715
             + +   ++ +K +     Q    +NA+                +N    L+DN+ N I 
Sbjct: 651  LSTEREKDNYDKLLL----QFNSEKNAI----------------INSKKELEDNLNNKIN 690

Query: 2716 STHSHITNIDDIYDTIENIMKNYGNKENAVK 2808
            S    +         +E +      KE  +K
Sbjct: 691  SLEKLLQQTSSTDVELETLKSELRGKELEIK 721

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 55/168 (32%), Positives = 79/168 (47%), Gaps = 7/168 (4%)
 Frame = +1

Query: 94  NEELNITVAVRC---RGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 264
           +E  +I V +R    +G    E   K+S   N      S     NTTGDT  T Q     
Sbjct: 23  SEPCHIDVLLRAIPEKGLPNDESTFKASSSDNTVLFRTSNGPLQNTTGDTHSTFQF---- 78

Query: 265 YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 444
              DKVF   A+Q  + D +  P   D + GYN T+L YG + +GK+Y++ G +      
Sbjct: 79  ---DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ------ 129

Query: 445 LSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLL 576
             D  GI+P +   LF TLE ++    N++ V     E+Y E+  DLL
Sbjct: 130 --DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 76/369 (20%), Positives = 157/369 (42%), Gaps = 38/369 (10%)
 Frame = +1

Query: 1060 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 1236
            SRSH +F + + ++++  ++ + S + L+DL G+E  ++             +NQS+  L
Sbjct: 234  SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 1237 GRVINAL----------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 1386
               + +L          A  S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 294  KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 1387 TCSTLEYASKAKNIKN-----------KPQLGAFIMKDILVKN---------ITMELAKI 1506
            T STL++    + I N           + ++  F+ +D+ +K+         +  E+  +
Sbjct: 352  TLSTLKFGDSIRQINNRVMDNTSGLNLRKKMDLFV-QDMKIKDDNYISQINILKAEVEIL 410

Query: 1507 KSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXX 1686
            K     + SKE +    D  K  N+ L+   + + +    +                   
Sbjct: 411  KGQSSESDSKEDMATKFDDSKKENTKLKLQLDSIAQ----LLGKLTNEEPNNSINDEVSV 466

Query: 1687 TIQSQNSQMESLKLTI-------NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQD 1845
             + ++  Q+  L+L+        ++L+ +L+ +   E  +   N KL +  ++ +  +Q+
Sbjct: 467  ILMNRCEQIAQLELSFDRQVNANSKLEKELEYKKSKEEALESMNVKLLEQIQLQEKEIQE 526

Query: 1846 YKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLM 2025
                   L  + ETH SK  ++    + S    +++  I++     P    + +     M
Sbjct: 527  LLTTNAILKGELETH-SKLTETRNERIKSLEGSVKELGINKSATPSPRKGSVSSSSGNTM 585

Query: 2026 ETMQEKAEL 2052
              ++E +EL
Sbjct: 586  SHIEEGSEL 594

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 53/164 (32%), Positives = 76/164 (46%), Gaps = 5/164 (3%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 270
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 271 VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 450
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM   E        
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED------- 461

Query: 451 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDL 573
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL
Sbjct: 462 ---GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDL 502

 Score = 36.2 bits (82), Expect = 0.52
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1092
            +  S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 524  DSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 53/164 (32%), Positives = 76/164 (46%), Gaps = 5/164 (3%)
 Frame = +1

Query: 97  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 270
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 271 VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 450
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM   E        
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED------- 461

Query: 451 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDL 573
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL
Sbjct: 462 ---GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDL 502

 Score = 36.2 bits (82), Expect = 0.53
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +1

Query: 925  NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 1092
            +  S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 524  DSDSQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_56.22402 s56 complement(111953..112234) [282 bp, 93 aa] {OFF}
           [contig 185] FULL
          Length = 93

 Score = 60.5 bits (145), Expect = 2e-10
 Identities = 33/48 (68%), Positives = 35/48 (72%)
 Frame = -2

Query: 239 MPVSPVVLMETSSEPVISGTFTTTELFIPISLSFLPLHLTATVIFNSS 96
           MPVSPVVL+ETS  PV SGT TTTEL    S S  PLH TATVI +SS
Sbjct: 1   MPVSPVVLIETSLVPVTSGTATTTELLAFTSFSLRPLHRTATVILSSS 48

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
            Anc_2.633
          Length = 598

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 87/395 (22%), Positives = 169/395 (42%), Gaps = 31/395 (7%)
 Frame = +1

Query: 937  NGI----YIQNLQEFHITNAMEGLNLLQRGLKHR-QVASTKMNDFSSRSHTIFTITLYKK 1101
            NGI    +++NL    I +    L+ LQ+  K   Q +S  +N  +++     +I + K 
Sbjct: 198  NGIKGDKHVKNLSHIQIAS----LDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 1102 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 1263
            H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L+D
Sbjct: 254  HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 1264 KSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 1425
                +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313  PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 1426 IKNKPQLGAF---IMKDILV---------KNITMELAKIKSDL-LSTKSKEGIYMSQDHY 1566
            IKN   +  F   + K +L+         +N   ++  ++S+L L  K  E +  +  H 
Sbjct: 372  IKNPLIMNVFGLNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPV-ATDHHE 430

Query: 1567 KNLNSDLE-SYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQL 1743
            +N N +   S K  + + K  IE                  T  +++ ++      + +L
Sbjct: 431  ENYNDESSCSDKETIMKLKLKIESLEQVLEHISTSENPKSKTETNEHDEL------LKKL 484

Query: 1744 KAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 1923
              + +   K ++EI    N   KL + ++ +       E  +N K    +  + K  K  
Sbjct: 485  MDKCEDVAKLQVEIEAEKNTNSKLKQDLKYSASKQHALE-TMNLKLLEQLQNQEKECKEL 543

Query: 1924 LFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLME 2028
            L S      +  + +E     NL   K E + ++E
Sbjct: 544  LIS------EERLKRELASAENLKNSKAERIVILE 572

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 16/86 (18%), Positives = 45/86 (52%)
 Frame = +1

Query: 169 VVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDF 348
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   + +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 349 IKGYNCTVLVYGMTSTGKTYTMTGDE 426
             GYN + + YG +++GK+ T+  ++
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTLFNEK 119

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 120/611 (19%), Positives = 250/611 (40%), Gaps = 32/611 (5%)
 Frame = +1

Query: 1126 SKMNLVDLAGSENIN-RSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLT 1302
            S+M + +L   +N++ +S  + +++ E   +N +L    R ++ L  K   +P   S   
Sbjct: 224  SRMKITEL--EQNLSSKSTIMEEKSSELAELNITLKEKERKLSELEKKMKELPKAISHQN 281

Query: 1303 ------RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 1464
                  R    + G   K  +       + T + + +T EY    +N++   +      K
Sbjct: 282  VGNNNRRKKNRNKGKKNKGGITTGDISEEETVDNSINTEEYDKLKENLQELQEK----YK 337

Query: 1465 DILVKNITMELAKIKSDLLSTKSKEGIYM--SQDHYKNLNSDLESYKNEVQECKRDIEXX 1638
            D   ++   +   I+++L   K  E   +  S    + LN++L   K  ++E   ++E  
Sbjct: 338  DC--EDWKQKYEDIEAELKDAKELENSQLEKSAKELETLNTELIDTKKSLKEKNSELEEV 395

Query: 1639 XXXXXXXXXXXXXXXXTIQS----QNSQMESLKLTINQLKAQLDKQHKTELEISGF---N 1797
                             I+     QN +++++KL ++ L+      HK    I  +   N
Sbjct: 396  RDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDDLR------HKNATMIEAYEAKN 449

Query: 1798 NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE-T 1974
             +L+   E++   ++  K    +  K+  T  +K  K  +    SQL+  E++NI++E T
Sbjct: 450  TELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEE--ISQLT-YEKSNITKELT 506

Query: 1975 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 2154
            +++ +    +  V  L E +++ +E   KD  +K   +  K    I  ++D+++ + +  
Sbjct: 507  SLRTSYKQKEKTVSYLEEQVKQFSE--QKDVAEKSTEQLRKDHAKISNRLDLLKKENETL 564

Query: 2155 YNNIAENLSDISE---ENNNLKQYL----KNHFFKNNHQELLNHHIDSTYEDIEKKTSEF 2313
            +N+IA+N +   E   EN  L + L    + +    N +   N HIDS     E+   + 
Sbjct: 565  HNDIAKNSNSYEEYLKENGKLSERLNILQEKYNTLQNVKSNSNEHIDSIKRQCEELNVKL 624

Query: 2314 VENFKN--TLNDHLEENKKLIMQNL--TNATSAVINQEMDLFEPKRVKWENSF----DLI 2469
             E+ K   +L D L E   ++       N    +++        K+ + EN      D  
Sbjct: 625  KESTKKILSLEDELNEYANIVQDKTREANTLRRLVSDSQTDDSSKQKELENKLAYLTDEK 684

Query: 2470 NKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXX 2649
            NK ++  +   +  AT L + K+TV      +   I  +K + E  ++ V          
Sbjct: 685  NKLEAELDLQTSRKATELQEWKHTV----TELKSEIHALKLREEGLKSEVDALKHVNNDI 740

Query: 2650 XXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNI 2829
                   +  +   D +E   ++    ++  D+    +++  +   N  N + N+  D +
Sbjct: 741  KRKTQATSDDS---DQLEQITSNLKLSLSKADEKNFELQSANEKLLNLNNEL-NKKFDRL 796

Query: 2830 LKEIPSLSKRV 2862
            LK   SLS ++
Sbjct: 797  LKNYRSLSSQL 807

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] {ON}
            similar to uniprot|P32364 Saccharomyces cerevisiae
            YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 84/405 (20%), Positives = 164/405 (40%), Gaps = 33/405 (8%)
 Frame = +1

Query: 940  GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 1119
            G+Y Q     +I +  E   +++    +++ +  KM+   S SH +   ++     ++L 
Sbjct: 205  GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSV-----EQLD 259

Query: 1120 RI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 1272
            R+      S +   DL GS    +        +    +N S+  L  V+N++        
Sbjct: 260  RVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNH 319

Query: 1273 -----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 1401
                              +P+++S+LT L+Q++LGGN++T ++      K   EET +TL
Sbjct: 320  LYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATL 379

Query: 1402 EYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNS 1581
             +  + +NI N      F+  D+   N     +K   DLL    K    + +++Y    +
Sbjct: 380  RFGVQLQNILN------FVRADVTGLN-----SKKTLDLLIDNMK----VIENNYDQKIT 424

Query: 1582 DLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDK 1761
             LES  N++ +  +  +                   I+    Q+E++    N +  +  +
Sbjct: 425  LLESELNKLADTVKKAK----VTEELETEIVEKNDEIKKLREQLETMTQLFNNIDPKESE 480

Query: 1762 QHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLK----TTLF 1929
              K  ++       ++K   + QL L+     E  L++        EIK  K     T+ 
Sbjct: 481  DTKKIIQ-----TLMEKCESVAQLQLE----LEGQLHENSILKGDGEIKDAKIRTLETMN 531

Query: 1930 SQLSGMEQNNISQETNIQPNLDIIKNEVLTL---METMQEKAELM 2055
            S+L    QN  S   +I  +  I+K E+  L    ++ QEK +++
Sbjct: 532  SRLVEQLQNQESSTQDILKSNGILKKELEALSNISKSQQEKIKIL 576

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 12/174 (6%)
 Frame = +1

Query: 91  PNEELNITVAVRCRGRNEREIGM--------KSSVVVNVPDITGSEEVSINTTGDTGITA 246
           P E   +T  VR    N+ ++             VV  V   T  E    NT     IT 
Sbjct: 24  PIEPSPVTAVVRLATANKEKLAELEKQRSADTQDVVKQVRHFTLQEN---NTIIHYPITN 80

Query: 247 QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 426
             +   +  +KV+  G     I   ++  + +D   GY+ +++ YG   +GK++T+ G+E
Sbjct: 81  FADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE 140

Query: 427 KLYNGELSDAAGIIPRVLLKLFD---TLELQQNDYV-VKCSFIELYNEELKDLL 576
                   D+ GII      +      LE  QN  V ++ S +E+  E++ D+L
Sbjct: 141 --------DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML 186

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 133/724 (18%), Positives = 283/724 (39%), Gaps = 116/724 (16%)
 Frame = +1

Query: 1174 SGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIA 1353
            +G ++ + K   ++N+ L ++   I+ +      +  + + +T  L DS  G+++  L +
Sbjct: 1241 NGIIDDKEKIISNLNEKLESISEDIDIIEKAKNLLEEKLATMTSELNDSENGSSE--LRS 1298

Query: 1354 TISPAKVTSEETCST-LEYASKAKNIKNK-------------------PQLGAFIM---- 1461
                 K+  EE   T  + ++  K ++NK                     +  ++     
Sbjct: 1299 LYDSLKIEFEELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESSINDYVKIKDD 1358

Query: 1462 -----KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRD 1626
                 +D+L K   +E  K K +++  ++   I + +     L  + E YKNE+ + K  
Sbjct: 1359 LEKEKEDLLNKYNVLEDKKDKLEIILEENNSSIKVLEHSIDALKKENEIYKNEIHDMKLQ 1418

Query: 1627 IEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKL 1806
            +E                      Q  ++  LK   N+LK   +++ + +LE+   N  L
Sbjct: 1419 MESSNSEYKNKAG----------EQEKKISRLKEECNKLKNSYEEKIE-KLEVESKNLSL 1467

Query: 1807 ----------QKLTEIMQ--LALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGME 1950
                       K+T + Q  ++++  K+++  + K  +  + KE++ LK     Q +  E
Sbjct: 1468 GHDTEKKQFEDKITSLKQEIISIEKSKKQDEKVLKNQKNTLQKELEELK----DQFTNSE 1523

Query: 1951 QNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK-----ILNESPKFFNVIV 2115
               I +  N Q  ++ ++ E L +   +  K E +  D  K      IL +S K   +  
Sbjct: 1524 NEYIKKLDNFQNEINSVRKEKLDIEAVLNSKIETLKADLSKSEEKSLILEKSNKEHLI-- 1581

Query: 2116 EKIDIIRVDFQR------FYNNIAENLS-DISEENNNLKQYLKNHFFKNNHQELLNHHID 2274
             K+++I+   ++         N  + L+ +++ E   LK+ + +   +  + +   + + 
Sbjct: 1582 -KMEVIQKSLEKQNKELDILGNEKDTLTMNLNNEIKGLKEEINSKVDQIGNLKTELNTVS 1640

Query: 2275 STYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQN---LTNATSAVIN------------ 2409
               EDI+ +  +  E  K+ ++D L E+++ + +N   +++  S+VI+            
Sbjct: 1641 ENMEDIQVRYDQLKEE-KSEISDKLIESEEKLKENFSSISDLNSSVISLEASIISKDEEY 1699

Query: 2410 --------------QEMD-----LFEP----KRVKWENSFDLINKCDS----------MN 2490
                          QE+D     L E     KR       DL N+ DS          + 
Sbjct: 1700 TLLKKEFEEVKISKQELDNQKDKLLEEYSIMKRTNESKLKDLRNELDSKIIKFDKERKLL 1759

Query: 2491 NEFYNNMATTLSQIKNTVDTSSNSM----NKSISVMKGQVEESENAVSXXXXXXXXXXXX 2658
            NE  +N+A   S+   +++    +     +  IS ++  ++   NA++            
Sbjct: 1760 NEGSDNIAQEYSEKVTSLEEELRNQKIYSDDKISELEENIKSKNNALTEKSNLLQKRLEE 1819

Query: 2659 XXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKE 2838
               +   T+ K   +   T  +S + N     D  EN+ K    KEN +K   I+ IL  
Sbjct: 1820 IKELES-TLSKYKADLEATMKNSDLKN-----DEFENVCKELSVKENEIKK--IEEILSS 1871

Query: 2839 IPSLSKRVPLRLSNTNGN-SAQNILSPKKHA----------IDDENPSNEITDGEESRKI 2985
               L   +  +  N     + +++L  KK +          +  EN   +IT+ +  +K+
Sbjct: 1872 KEDLIAEIESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKENLQKKITEYDNLQKL 1931

Query: 2986 QKTE 2997
               +
Sbjct: 1932 MSLD 1935

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 137/684 (20%), Positives = 260/684 (38%), Gaps = 54/684 (7%)
 Frame = +1

Query: 1108 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 1287
            +EL  ++K NL D + S+  N    +++  +E  S+   +  L   I  +  K+ H   +
Sbjct: 1073 EELVEVTKNNLND-SESQVSNLIAKISELDEENKSVKLEVEKLENEITEI--KNSHKSAQ 1129

Query: 1288 ESKLTRLLQDSLGGNTKTALIATISPAKVTS--EETCSTLEYASKAKNIKNKPQLGAFIM 1461
              K T  LQ  L    +T L+   S  ++ S   E  STL   S  +N++N  +  +  +
Sbjct: 1130 --KETDTLQTKLD---ETELLLQSSKEEILSLKNEYSSTL---SDKENLENSEKKSSEKI 1181

Query: 1462 KDI---------LVKNITMELAKIKSDLLSTKSK------------EGIYMSQDHYKNLN 1578
            +++           +NIT E   +K +   T+ K            E I    D    LN
Sbjct: 1182 EELEKNFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLN 1241

Query: 1579 SDLE-------SYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTIN 1737
              ++       +   +++    DI+                   +    +    L+   +
Sbjct: 1242 GIIDDKEKIISNLNEKLESISEDIDIIEKAKNLLEEKLATMTSELNDSENGSSELRSLYD 1301

Query: 1738 QLKAQLDKQHKTELEISG----FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEI 1905
             LK + ++  KT  + S       NK   LTE  ++ L+D K+ E  +N   +  I  ++
Sbjct: 1302 SLKIEFEELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESSINDYVK--IKDDL 1359

Query: 1906 KSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYK----DCVK 2073
            +  K  L ++ + +E      E  ++ N   IK  VL       +K   +YK    D   
Sbjct: 1360 EKEKEDLLNKYNVLEDKKDKLEIILEENNSSIK--VLEHSIDALKKENEIYKNEIHDMKL 1417

Query: 2074 KILNESPKFFNVIVE---KIDIIRVDFQRFYNNIAENLSDISEENNNLK--QYLKNHFFK 2238
            ++ + + ++ N   E   KI  ++ +  +  N+  E +  +  E+ NL      +   F+
Sbjct: 1418 QMESSNSEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFE 1477

Query: 2239 NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEM 2418
            +    L    I  + E  +K+  + ++N KNTL   LEE K       TN+ +  I +++
Sbjct: 1478 DKITSLKQEII--SIEKSKKQDEKVLKNQKNTLQKELEELK----DQFTNSENEYI-KKL 1530

Query: 2419 DLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQV 2598
            D F+             N+ +S+  E  +  A   S+I+      S S  KS+ + K   
Sbjct: 1531 DNFQ-------------NEINSVRKEKLDIEAVLNSKIETLKADLSKSEEKSLILEKSNK 1577

Query: 2599 EESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHI-----------TNID 2745
            E                       N+   L  N+ N I      I           T ++
Sbjct: 1578 EHLIKMEVIQKSLEKQNKELDILGNEKDTLTMNLNNEIKGLKEEINSKVDQIGNLKTELN 1637

Query: 2746 DIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKH 2925
             + + +E+I   Y   +   K+E+ D +++    L +     +S+ N     +++S +  
Sbjct: 1638 TVSENMEDIQVRYDQLKEE-KSEISDKLIESEEKLKENFS-SISDLN----SSVISLEAS 1691

Query: 2926 AIDDENPSNEITDGEESRKIQKTE 2997
             I  +     +    E  KI K E
Sbjct: 1692 IISKDEEYTLLKKEFEEVKISKQE 1715

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 117/575 (20%), Positives = 228/575 (39%), Gaps = 52/575 (9%)
 Frame = +1

Query: 1429 KNKPQLGAF-----IMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES 1593
            K + QL AF     + K+ L K IT E   ++  L+S  +K+ +   +   ++L   LES
Sbjct: 1899 KKESQLEAFQEDVEVQKENLQKKIT-EYDNLQK-LMSLDNKK-LVKCEKQIEDLELKLES 1955

Query: 1594 YKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL----DK 1761
              N ++E +   E                   IQ+    + + K  I +L  ++    + 
Sbjct: 1956 SSNHLKEQEGKYEKLEFESGENKKLISEKDELIQTLQLDISNNKDEIQKLSDKISTLQNN 2015

Query: 1762 QHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLS 1941
               TEL +      + +L   +Q      +  ELDLNK  ET + KE++S      +  +
Sbjct: 2016 SENTELTLEEKEKMVDELNSKLQEKEAQVETLELDLNKLKET-LDKELESSSELQIAHDN 2074

Query: 1942 GMEQNNISQE--TNIQPNLDIIKNEVLTLMETMQEKAE--------LMYKDCVKKILNES 2091
              ++N I ++  T ++  +D  + +   +++ M+E  E        L  K    + +NE 
Sbjct: 2075 LRDENIIQKQKITELKVKIDDSEKDSQVIIDNMKEMEENIMDLRNDLSSKTIQIEKVNED 2134

Query: 2092 PKFFNVIVEKIDIIRVDFQRFYNNIAENL---SDISE-ENNNLKQYLKNHFFKNNHQELL 2259
                N  +E+++    +    Y++I   L   S +SE E N++KQ        ++    L
Sbjct: 2135 LSSKNSEIEQLNKKLAEKCAEYDSIKSELVASSKLSESEKNDMKQL-------SDEINEL 2187

Query: 2260 NHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKR 2439
               ++   E+++K TS+      N  +D   +  K+    +    S + N +  L + K 
Sbjct: 2188 KEQLELKNENLKKVTSDL--QIANNTSDKYNDELKVANNTIREIESKIPNLQKQL-DLKE 2244

Query: 2440 VKWENSF----DLINKCD--SMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVE 2601
            +++ ++     DL  K D  S  +E  +    +L + K  ++   N +   +   K  + 
Sbjct: 2245 IEYNDTLSSKKDLDKKLDNFSKESEILSKEVKSLKKEKLDLEKEKNDLIVELDKYKNDII 2304

Query: 2602 ESENAVSXXXXXXXXXXXXXXXV-NKHTILKDNI---------------------ENSIT 2715
            +  N +                + +K    K N+                     ++ + 
Sbjct: 2305 DLNNTLKENEKNGSEVETEIIGLKDKIEFYKLNVSQLNEEKGKLESDIKTLVGERDDKLK 2364

Query: 2716 STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNS 2895
            S+ S I  + +  ++ ++I   Y  +E+ V+++ + N L EI        L  SN N +S
Sbjct: 2365 SSQSEIIELTNKLESFKDISVAY--EESKVESDGLKNKLSEIEK-----SLEESNENVDS 2417

Query: 2896 AQNILSPKKHAIDDENPSN-EITDGEESRKIQKTE 2997
            A   +S  K   D     N E+ D  +  K   TE
Sbjct: 2418 ANKEISDLKVMNDKLQSHNLELEDKFQQLKNDTTE 2452

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
            (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 79/335 (23%), Positives = 140/335 (41%), Gaps = 63/335 (18%)
 Frame = +1

Query: 1732 INQLKAQLDKQHKTELE--ISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEI 1905
            +N    +L   + T ++  + G N+    L ++++     Y+  E+++N+KF  + +  I
Sbjct: 81   VNNPDNELSSDYLTNIKNLLKGINHPTNNLNQLVKPVNSPYE--EVEINEKFLNYHT--I 136

Query: 1906 KSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILN 2085
             SL TT    LS +E +    +  I   LD IKN ++  ++  Q   EL   D V+ + N
Sbjct: 137  TSLITTNLGWLSALEIDMHYFQIQISDTLDYIKN-IIESLKICQNYLELYCYD-VENLYN 194

Query: 2086 ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS--------------------EE--- 2196
             + KF N +    +I++ ++  +Y+NI   LSDI+                    EE   
Sbjct: 195  SNVKFLNQLANN-EILK-NWLNYYDNILTKLSDINGNKLSSYLNKNELVSISSKIEELDQ 252

Query: 2197 --NNNLKQYL----KNHFFKNNHQELLNHHIDSTYEDI---------------------- 2292
              N+NLK++     KN   +NN    +N  I S  E I                      
Sbjct: 253  RVNSNLKKFKIVIDKNIDLRNN----INKEISSLSEKITPSSEKYKLEETMLEKFTELVK 308

Query: 2293 ----------EKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRV 2442
                      EK  +EF +N+   L   LE++KK+ + NL   + A+ +Q  D+ E K  
Sbjct: 309  NLRNDSKVILEKDENEFDKNYMQNLAKSLEKDKKVTVTNLLTISKALYSQANDISEIKSK 368

Query: 2443 KWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 2547
               +S  L  +   +  E  N     L+++   ++
Sbjct: 369  LQVDSIKLFGQISFIQIETLNIKKLLLNELNKDLE 403

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 73/322 (22%), Positives = 139/322 (43%), Gaps = 29/322 (9%)
 Frame = +1

Query: 1735 NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSL 1914
            N+L + L+K      E+   ++K+++L + +   L+ +K   +D N     +I+KEI SL
Sbjct: 229  NKLSSYLNKN-----ELVSISSKIEELDQRVNSNLKKFKI-VIDKNIDLRNNINKEISSL 282

Query: 1915 --KTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMET---------MQEKAELMYK 2061
              K T  S+   +E+  + + T +  NL   +N+   ++E          MQ  A+ + K
Sbjct: 283  SEKITPSSEKYKLEETMLEKFTELVKNL---RNDSKVILEKDENEFDKNYMQNLAKSLEK 339

Query: 2062 D---CVKKILNESPKFF---NVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
            D    V  +L  S   +   N I E    ++VD  + +  I    S I  E  N+K+ L 
Sbjct: 340  DKKVTVTNLLTISKALYSQANDISEIKSKLQVDSIKLFGQI----SFIQIETLNIKKLLL 395

Query: 2224 NHFFKNNHQ----ELLNHHIDS--------TYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
            N   K+  +    EL   H+          + E+  +++     N+K     HL+ NK L
Sbjct: 396  NELNKDLEKYQGFELKLAHVQDIPLVYGLYSIENYRRESWVLQINYK-----HLDFNKSL 450

Query: 2368 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 2547
              + +     +  N+ +D F    V +    D +   + +NN    N +      +   +
Sbjct: 451  --KTIVEKEKSTRNKWVDNFGSTAVYFTEDMDTLRDFNYLNNIAKGNQSMIKKLEELFKN 508

Query: 2548 TSSNSMNKSISVMKGQVEESEN 2613
             S+ S NK++  ++  ++E E+
Sbjct: 509  ISNESHNKNLVFIETYIKEVED 530

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 118/616 (19%), Positives = 258/616 (41%), Gaps = 58/616 (9%)
 Frame = +1

Query: 1309 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNIT 1488
            LQD+L  N K  +I ++   K   +E    ++   K  N K+       I +  L   + 
Sbjct: 242  LQDNL--NKKNLIIESLQNDK---KENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQ 296

Query: 1489 MEL--AKIKSDLLSTKSKEGIYMSQD----HYKNLNSDLESYKNEVQECKRDIEXXXXXX 1650
              L  + I++D     SK  I   Q+      + L+SD++S  ++     +DI       
Sbjct: 297  YLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKN 356

Query: 1651 XXXXXXXXXXXXTIQSQNSQMESLKL-----TINQLKAQL----DKQHKTELEISGFNNK 1803
                        +++S+ S++++ +      TIN+ K  +    +  +  +LEI    +K
Sbjct: 357  MELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSK 416

Query: 1804 LQKLTEIMQLALQDYKRR---ELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 1974
            + +L   +  + +  K+      +L K  E+ +SK + +   +    L+   QN  ++ T
Sbjct: 417  ISELQSSIPNSKESEKQHFNYHSNLVKDLESKLSK-LSAYSQSTIENLNKDIQNLYNERT 475

Query: 1975 NIQPNLD------IIKNEVLTLMETMQ-----EKAELMYKDCV-KKILNESPKFFNVIVE 2118
            +I  NL+      I+ NE LTL++        E  EL  K+ + ++ LNE  K  N ++ 
Sbjct: 476  DILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLN 535

Query: 2119 KIDIIRVDFQRFYNNIA---ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYED 2289
                 + +   F N +     N   + EENN+LKQ +K+++ +    +  + H++ + E+
Sbjct: 536  DYIKCKTNLLDFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLEN 595

Query: 2290 IEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVIN------QEMDLFEPKRVKWE 2451
               K ++ V+  +  ++  L E K ++ + L N    + +       ++  ++ K  ++E
Sbjct: 596  EISKYTDKVKELELNIS-KLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYE 654

Query: 2452 NSFDLINK---CDSMNNE-FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQ-------- 2595
             +   +      D+ N++    + A   S+  + V +S++    +I +            
Sbjct: 655  KTIKTLESRLPADTQNSKALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYP 714

Query: 2596 VEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY------- 2754
            +EE +N                    ++ +L + +E S          +DDI+       
Sbjct: 715  IEEEKNLELITKELEDTKVRVQNLATQNRLLLEKLERSAN------LEVDDIFVSLRYER 768

Query: 2755 DTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAID 2934
            DT+ + + NY  K+  V    ++++  E+ + + ++ L   N        +   KK  ++
Sbjct: 769  DTLSDQVVNY-EKDMQVILADLESVQSELNAANSQI-LNFENQRA----MVQDHKKGNVN 822

Query: 2935 DENPSNEITDGEESRK 2982
            +E    ++T+ +E ++
Sbjct: 823  EETLIEKLTELDELKE 838

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 72/414 (17%), Positives = 170/414 (41%), Gaps = 58/414 (14%)
 Frame = +1

Query: 1780 EISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISK-----EIKSLKTTLFSQLSG 1944
            E++  N+++    E  +  +QD+K+     N   ET I K     E+K     L  ++  
Sbjct: 795  ELNAANSQILNF-ENQRAMVQDHKKG----NVNEETLIEKLTELDELKERNMELTQEIHA 849

Query: 1945 MEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMY--KDCVKKILNESPKFFNVIVE 2118
            + +NNI+ +  ++ +L+ +K      +ET   +  ++   KD +  + NE  + +     
Sbjct: 850  LNENNIALKCQLEESLERLKP-----LETKISELNILIEDKDNIINVSNEKAENWKTRFN 904

Query: 2119 KIDIIR--------VDFQRFYNNIAENLSDISEENNNLKQYLKNHFF-----KNNHQELL 2259
            ++ +          ++ Q+     ++   ++S+  N LK+            +NN  E  
Sbjct: 905  ELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQS 964

Query: 2260 NHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL-----IMQNLTNATSAVINQEMDL 2424
            N  + +   D+E+  SE +E FK   N    ++++L     + + L NA       E +L
Sbjct: 965  N-ELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFEEEL 1023

Query: 2425 FEPKRVKWENSFDLINKCDSMN--------------NEFYNNMATTLSQIKNTVDTSSNS 2562
             +          DL N+ +S+N              +E  N     +++++  ++ + + 
Sbjct: 1024 IKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQESEIENAKKILIAELEEKLNKTKSE 1083

Query: 2563 MN----KSISVMKGQVE--------ESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIEN 2706
            ++    + + V+K + E        E+E A+                 +K   L+++ + 
Sbjct: 1084 LDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKK 1143

Query: 2707 SITSTHSHITNIDDIYDTIENIMKN-------YGNKENAVKNEMIDNILKEIPS 2847
             + +  +  T+I+ I    E+ + N        G ++ ++K + ++N + ++ S
Sbjct: 1144 KLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLES 1197

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 66/331 (19%), Positives = 134/331 (40%), Gaps = 14/331 (4%)
 Frame = +1

Query: 1912 LKTTLFSQLS-----GMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDC-VK 2073
            L  TL   LS      ++Q N+  ET+I   L+  +N      E+ ++K ++   +  ++
Sbjct: 2    LDNTLLQDLSLRYHIPIDQLNLLNETSIDQLLNYNENSDT---ESFKDKFKIDNLNLQIQ 58

Query: 2074 KILNESPKFFNV---IVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNN 2244
             I N++ K  N    I+EK ++ ++D  +   N+   L  +  EN  L     N   KN 
Sbjct: 59   HINNDNLKLSNQLKNIIEKFNLSKIDQNKTIENLKLKLFKLENENKTLNSTNLNLTDKN- 117

Query: 2245 HQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMD- 2421
              + LN++++    ++ K  ++ +   +   N+ ++   KLI Q         +N +++ 
Sbjct: 118  --DTLNNNLNLKLIEL-KNLNDNITELELKRNNDIQLKDKLIQQ---------LNSKIEN 165

Query: 2422 -LFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQV 2598
             L   K  K++N  ++IN   ++N++  N+ AT        +   +N             
Sbjct: 166  LLKLGKSPKFKNEVEIINDSKTINDDIENSKATIPPSPAKALSKQNNG------------ 213

Query: 2599 EESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMK 2778
                                         LK +I+N +      +  I++    IEN+  
Sbjct: 214  -----------------------------LKSDIQNYLNELEQQLPLIENFKAEIENLQD 244

Query: 2779 NYGNKE---NAVKNEMIDNILKEIPSLSKRV 2862
            N   K     +++N+  +N LK + S+ K +
Sbjct: 245  NLNKKNLIIESLQNDKKEN-LKLMDSMKKTI 274

 Score = 39.3 bits (90), Expect = 0.068
 Identities = 71/354 (20%), Positives = 140/354 (39%), Gaps = 4/354 (1%)
 Frame = +1

Query: 1030 VASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAG 1209
            V++ K  ++ +R + +   TL  K+ D    I+    V+    EN   S   N+  K+A 
Sbjct: 891  VSNEKAENWKTRFNEL---TLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQA- 946

Query: 1210 SINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 1389
              N+ L       N L ++S  +  R + L R L + +                    E 
Sbjct: 947  --NERLHASKVAQNNLTEQSNELKARNTDLERNLSEQM--------------------ER 984

Query: 1390 CSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMS--QDH 1563
               LE +   K+     +LG+       + N   +  K + +L+ T S+    +S  ++ 
Sbjct: 985  FKELENSISLKD----QELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNE 1040

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQL 1743
             ++LN  L+S ++ V   + +IE                     ++   +  L+  +N+ 
Sbjct: 1041 IESLNEKLKSKESSVGLQESEIE--------------------NAKKILIAELEEKLNKT 1080

Query: 1744 KAQLDKQHKTELEI--SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLK 1917
            K++LD +HK EL++  + +   +QK     + AL+  ++  L   +K  T I  ++  L+
Sbjct: 1081 KSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALK--RKIRLPSEEKINTIIESKVADLE 1138

Query: 1918 TTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKI 2079
                 +L  +   +   E   Q   D + N      E  +++A +  K    KI
Sbjct: 1139 EDYKKKLETVSAESTDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKI 1192

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 129/620 (20%), Positives = 257/620 (41%), Gaps = 28/620 (4%)
 Frame = +1

Query: 1183 LNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATIS 1362
            L +   E    +Q L  L   +N +  +   +  ++ +LT+L +     N K  L     
Sbjct: 1045 LKELETEKAEGDQKLANLEEKLNMMKKQ---LEDKDQQLTKLCEGE--ANNKKQL----- 1094

Query: 1363 PAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEG 1542
               VT+EET S+L+ A K   ++     G             +E+ K++++L  TK + G
Sbjct: 1095 ---VTAEETISSLK-ADKETFMEKLEASG-------------LEVEKLQTELKDTKLQHG 1137

Query: 1543 IYMSQ-DHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMES 1719
               ++  + K  ++D +   NE + C   +E                   ++ + ++ E+
Sbjct: 1138 EAETRLTNMKKEHADKDIANNE-KICS--LEEDLKKQQIVMDKEKANAEELEEKLNEKET 1194

Query: 1720 LKLTINQLKAQLDKQHKTELE-ISGFNNKLQKLTE-IMQLALQDYKRRELDLNKKFETHI 1893
                + + KA ++K+     E I   N +L+ LTE + Q  ++  K RE  L  K +   
Sbjct: 1195 ELADVLRNKAAIEKELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLL--KDQNAS 1252

Query: 1894 SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVK 2073
             +EI +L+ TL  +L   ++  + +++ ++ ++  ++ E+    +    + E +++   K
Sbjct: 1253 KEEISALENTL-KELHSEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLHEQIEK 1311

Query: 2074 KILNESPKFFNVIVEKI--DIIRVD-----FQRFYNNIAENLSDI---SEENNNLKQYLK 2223
              +NE  K F  I+EK   ++ R +      +  Y    E L  +   S+E+  LK+  +
Sbjct: 1312 --INEETKDFKAIIEKAASNLKRTESDLKVLKEKYTKNEEKLKIMEVASKEHAELKKKQE 1369

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
            + +      ELL + +    ED++ K  E  E+ K+ L    +E    I   L    SA 
Sbjct: 1370 SEY------ELLENRLKMLEEDVKLKEKELSEHKKSLLEAQEQEKSSTI--ELAKLKSAA 1421

Query: 2404 INQEMDLFEP----------KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTS 2553
             +++  L E           K   +E    L+N+  S   + Y+   + L      V+++
Sbjct: 1422 ADEKNKLEEEIKSCKVELKNKAQAFEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSA 1481

Query: 2554 SNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHI 2733
              S  + +  +K  + E EN  S               + + TI K   +  I + HS  
Sbjct: 1482 HQSKLEELDSLKTNMIELENKNS----EQLKKEKASIVILEETISKQ--KKDIDNLHS-- 1533

Query: 2734 TNIDDIYDTIENIMKNYGNK--ENAVKNEMIDNILKEIPSL--SKRVPLRLSNTNGNSAQ 2901
              ++D  +  +NI K+   K  E    +E  D+ LK +      K V +  S+ +    +
Sbjct: 1534 -EVEDSQEKCKNINKDLTKKLREMQSASETYDSNLKRMEETIEEKNVEIEKSSKSIEELE 1592

Query: 2902 NILSPKKHAIDD-ENPSNEI 2958
              L  ++  + D +N + E+
Sbjct: 1593 KELGSQQLKLKDLQNENTEV 1612

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 53/316 (16%), Positives = 124/316 (39%), Gaps = 4/316 (1%)
 Frame = +1

Query: 1687 TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELD 1866
            T++  N +   L    N+   +L+K +K   +I   + KL K+ + ++++ +  K+   D
Sbjct: 787  TLKKVNDECRELNKLKNENLQKLEKDNK---KIQDLDTKLHKVQQELKISSEAKKKAHDD 843

Query: 1867 LNKKFETHI--SKEIKSLKTTLFSQLSGME--QNNISQETNIQPNLDIIKNEVLTLMETM 2034
            +NK     I  S+E + L+    S    M+   NN  QE N              L + +
Sbjct: 844  INKMSRDLIGLSREKQELEGKCGSLERDMKIKSNNFDQEKN-------------KLNQKI 890

Query: 2035 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
            QEK++ +  + + K L E       + ++ D   +  Q + +    + + + +    LK 
Sbjct: 891  QEKSKEI--ETLNKKLEELKNNITSLEKEKDGTALALQHWKSKFESHDALVPKLTEKLKS 948

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 2394
                              + ++++ +EK+      +F    ++H  +N +          
Sbjct: 949  ------------------LATSFKLLEKEKLALENDFTKYRSEHSHQNAEF------QKA 984

Query: 2395 SAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS 2574
               I +E DL   ++     +F  + +         ++ +     +KN ++ S   MN+ 
Sbjct: 985  IGDITKERDLLRSEKETLVANFSQLKELSDKLKTENSDHSAAYEAVKNELEESMLHMNEQ 1044

Query: 2575 ISVMKGQVEESENAVS 2622
            +  ++ +  E +  ++
Sbjct: 1045 LKELETEKAEGDQKLA 1060

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 111/558 (19%), Positives = 235/558 (42%), Gaps = 32/558 (5%)
 Frame = +1

Query: 1201 EAGSINQSLLTLGRVINA-LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT 1377
            + G  N+ +    + +N  L D S  I  ++ +L +L  D++    K  L          
Sbjct: 1309 QLGKENEDITKQNKELNLRLEDYSAKIDAKDEEL-KLANDAVASTKKKML---------K 1358

Query: 1378 SEETCSTLE-----YASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEG 1542
             EE    LE     +     ++K++ +  A  M ++   N    + K+K++L  T  K  
Sbjct: 1359 LEEKIKDLEDTQHIFKDSENSLKSELEKTALEMNELRSDNDN--IIKLKNELQRTNDKL- 1415

Query: 1543 IYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESL 1722
            I  ++   + L S++   K+E++      E                   I+  + ++ SL
Sbjct: 1416 IEENKRTEEKLRSEVAKLKDELKTKSDTFEKERKLMNEDSSTI------IKEYSEKISSL 1469

Query: 1723 KLTINQLKAQLDKQ-----HKTELEISGFNNKLQKLTEIMQLALQDY-----KRRELDLN 1872
            +  +  +K++ DK+      K E+  S  ++K Q++ +  Q   +       K +E+ + 
Sbjct: 1470 EEKVETIKSEYDKEINILEDKKEVLESELSDKKQEIIDYNQKIKEQETKATEKEKEIQVA 1529

Query: 1873 KKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQ---PNLDIIKNEVLTLMETMQEK 2043
            K    +  K+ K ++  L + ++ +E+ N + +   Q    ++D  +N +  L E + ++
Sbjct: 1530 KNALKNAEKKKKDIENDLRTTIATVEKENTTLKRENQLKSESIDKHQNNIHLLQEELSKQ 1589

Query: 2044 AELMYK--DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQY 2217
             EL  K  D ++K+  E+ K    ++++ID  +++ Q+   N  E +++I +EN++L   
Sbjct: 1590 KELADKKHDEIRKLEKENSK----MIDRID--KLEKQKADTN--EKIANIEKENSSLIS- 1640

Query: 2218 LKNHFFKNNHQELLNHHIDSTYEDIEKKTS-EFVENFKN---TLNDHLEENKKLIMQNLT 2385
                                     E+KT  E VENF++    L   LE+N  L      
Sbjct: 1641 -------------------------ERKTLVEKVENFQDEITNLKSSLEKNDSL------ 1669

Query: 2386 NATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT---TLSQIKNTVDTSS 2556
               S+  ++  D F     + + +   +NK +S N +  + +      +S ++  + T+ 
Sbjct: 1670 ---SSSHDELKDKFNELETELKRNLTELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQ 1726

Query: 2557 NSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHIT 2736
             ++ +   V+  ++++S N ++               ++KH   + + E SIT   S I 
Sbjct: 1727 KTLKEREDVIN-KLKDSNNELNKT-------------IDKHGATEKHYEESITKKDSDIA 1772

Query: 2737 ----NIDDIYDTIENIMK 2778
                 I DI D + NI++
Sbjct: 1773 QLKKKIKDIEDKLSNILE 1790

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 129/674 (19%), Positives = 250/674 (37%), Gaps = 52/674 (7%)
 Frame = +1

Query: 1096 KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEA-GSINQSLLTLGRVINALADKSG 1272
            K+  DEL  + ++ L +L   +  + S  LN + ++  G I     T+  +   L   S 
Sbjct: 1146 KQKYDEL--VKELELKNLESKQLSDNSLNLNSKIEQLEGDIKSKYNTIKELEEKL---ST 1200

Query: 1273 HIPFRESKLTRLLQDSLGGNTK----TALIATISPAKVTSEET---CSTLEYASKAKN-- 1425
             +  RE  +  +    L  N+K    T     +   +++ E+    C  LE   K+ N  
Sbjct: 1201 SLQEREENIANIADIELKLNSKEEQYTEQTNKLEELRISFEKKQSECKELESKLKSSNDD 1260

Query: 1426 IKNKPQLGAFIMK--DILVKNITMELAKIKSDLLSTKSKEGIYMSQ------------DH 1563
            ++ K +L   + K  D L+K+       ++S L   K +E  Y  +              
Sbjct: 1261 LQEKNRLTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENEDITKQ 1320

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQ--------------SQ 1701
             K LN  LE Y  ++     +++                   I+              S 
Sbjct: 1321 NKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSL 1380

Query: 1702 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 1881
             S++E   L +N+L++  D   K + E+   N+KL                  ++ NK+ 
Sbjct: 1381 KSELEKTALEMNELRSDNDNIIKLKNELQRTNDKL------------------IEENKRT 1422

Query: 1882 ETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYK 2061
            E  +  E+  LK  L ++    E+              ++  +  T+++   EK   + +
Sbjct: 1423 EEKLRSEVAKLKDELKTKSDTFEKER-----------KLMNEDSSTIIKEYSEKISSL-E 1470

Query: 2062 DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKN 2241
            + V+ I +E  K  N++ +K +++              LSD  +E  +  Q +K    K 
Sbjct: 1471 EKVETIKSEYDKEINILEDKKEVLE-----------SELSDKKQEIIDYNQKIKEQETKA 1519

Query: 2242 NHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQ--- 2412
              +E       +  ++ EKK  +   + + T+    +EN  L  +N   + S   +Q   
Sbjct: 1520 TEKEKEIQVAKNALKNAEKKKKDIENDLRTTIATVEKENTTLKRENQLKSESIDKHQNNI 1579

Query: 2413 ---EMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS--- 2574
               + +L + K +  +   D I K +  N++  + +     Q  +T +  +N   ++   
Sbjct: 1580 HLLQEELSKQKELA-DKKHDEIRKLEKENSKMIDRIDKLEKQKADTNEKIANIEKENSSL 1638

Query: 2575 ISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY 2754
            IS  K  VE+ EN                   + H  LKD      T    ++T +    
Sbjct: 1639 ISERKTLVEKVENFQDEITNLKSSLEKNDSLSSSHDELKDKFNELETELKRNLTEL---- 1694

Query: 2755 DTIENIMKNYGNK--ENAVKNEMIDNILKEIPSLSKR---VPLRLSNTNGNSAQNILSPK 2919
            + +E+  K   +K  E+  K  M++  L       K    V  +L ++N    + I    
Sbjct: 1695 NKLESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKEREDVINKLKDSNNELNKTI---D 1751

Query: 2920 KHAIDDENPSNEIT 2961
            KH   +++    IT
Sbjct: 1752 KHGATEKHYEESIT 1765

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 93/510 (18%), Positives = 210/510 (41%), Gaps = 43/510 (8%)
 Frame = +1

Query: 1201 EAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 1380
            E  S N +++ L   +    DK      R  +  R     L    KT         K+ +
Sbjct: 1393 ELRSDNDNIIKLKNELQRTNDKLIEENKRTEEKLRSEVAKLKDELKTKSDTFEKERKLMN 1452

Query: 1381 EETCSTL-EYASKAKNIKNKPQ-LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMS 1554
            E++ + + EY+ K  +++ K + + +   K+I   NI  +  ++    LS K +E I  +
Sbjct: 1453 EDSSTIIKEYSEKISSLEEKVETIKSEYDKEI---NILEDKKEVLESELSDKKQEIIDYN 1509

Query: 1555 QDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTI 1734
            Q   K   +     + E+Q  K  ++                  T++ +N+ ++      
Sbjct: 1510 QK-IKEQETKATEKEKEIQVAKNALKNAEKKKKDIENDLRTTIATVEKENTTLKRE---- 1564

Query: 1735 NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSL 1914
            NQLK++   +H+  + +     +L K  E+      + ++ E + N K    I K ++  
Sbjct: 1565 NQLKSESIDKHQNNIHL--LQEELSKQKELADKKHDEIRKLEKE-NSKMIDRIDK-LEKQ 1620

Query: 1915 KTTLFSQLSGMEQNN---ISQETNIQPNLDIIKNEVLTLMETMQEKAELM-----YKDC- 2067
            K     +++ +E+ N   IS+   +   ++  ++E+  L  ++++   L       KD  
Sbjct: 1621 KADTNEKIANIEKENSSLISERKTLVEKVENFQDEITNLKSSLEKNDSLSSSHDELKDKF 1680

Query: 2068 -------------VKKILNESPKFFNVIVE---KIDIIRVDFQRFYNNIAEN---LSDIS 2190
                         + K+ +E+ +  + ++E   K+ ++  +       + E    ++ + 
Sbjct: 1681 NELETELKRNLTELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKEREDVINKLK 1740

Query: 2191 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
            + NN L + +  H     H E      DS    ++KK    +++ ++ L++ LEE  K  
Sbjct: 1741 DSNNELNKTIDKHGATEKHYEESITKKDSDIAQLKKK----IKDIEDKLSNILEEKAKAA 1796

Query: 2371 M---------QNLTNATSAVINQEMDLFEPK----RVKWENSFDLINKCDSMNNEFYNNM 2511
            M          +L N+ S  + QE++ +  K      K +++ +     +  + E + +M
Sbjct: 1797 MLMTQLEKDKTDLKNSESE-LKQELEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSM 1855

Query: 2512 ATTLSQIKNTVDTSSNSMNKSISVMKGQVE 2601
            +  L   K+ + ++  S+++ +  +K QVE
Sbjct: 1856 SLDLKATKDKLKSAEISISE-MDAIKKQVE 1884

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 101/505 (20%), Positives = 194/505 (38%), Gaps = 6/505 (1%)
 Frame = +1

Query: 1420 KNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK 1599
            K++KN  +    I K+++  N+  E+++++  L+ TK +  I        N N  L +Y+
Sbjct: 1186 KSLKNVTEKNEAIYKELI--NMQEEISRLQGHLIQTKEQVSI--------NANKVL-AYE 1234

Query: 1600 NEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTEL 1779
            +E+++CK+  +                     +  ++ E L   I  L+ +L        
Sbjct: 1235 SEIEQCKQRYQDLSQQQKL-------------THKNETEKLHNVIGDLEVKLLNVQNANA 1281

Query: 1780 EISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNN 1959
            ++    N+L+K               +LD +KK +T ++ E+  LK T       +E+N 
Sbjct: 1282 DLENKFNRLKKQAH-----------EKLDASKKQQTALTNELNELKETK----DKLEENL 1326

Query: 1960 ISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRV 2139
             ++E+ +      +K   L + E  ++   + +K                 VE+I+ ++ 
Sbjct: 1327 HNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKP---------------FVEEIESLKK 1371

Query: 2140 DFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVE 2319
            + Q F N  A + SD  E+             KNN +E  N  ID   +D EKK  + V 
Sbjct: 1372 ELQVFRN--ANDASDAFEK------------IKNNMEEEKNKIIDEKTKDFEKKLQDAVN 1417

Query: 2320 NFKNT-----LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDS 2484
              K+       ++H+E  KK  ++     T   I +  +  + KR++   S + I K  S
Sbjct: 1418 KSKSNESEVENSEHIEALKKEWLKEYEEETVKRIKEAEENLK-KRIRLP-SEERIQKIIS 1475

Query: 2485 MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXX 2664
                          +++   +      NKS+       EE+E+ +               
Sbjct: 1476 KRK----------GELEQEFERKLKENNKSLVFSGSNEEEAEDEL--------WNSPSKG 1517

Query: 2665 XVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIP 2844
               K +++ D I+         + N+ +     +   K+   + N   +   DN +    
Sbjct: 1518 SSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIPDSAAADNRVPSAF 1577

Query: 2845 SLSKRVPLRLSNTNG-NSAQNILSP 2916
            S  K  PL  SNT+   S  N  +P
Sbjct: 1578 SFGK--PLFSSNTSSFQSFHNPFTP 1600

 Score = 35.4 bits (80), Expect = 1.0
 Identities = 94/464 (20%), Positives = 173/464 (37%), Gaps = 5/464 (1%)
 Frame = +1

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQL 1743
            + NL  +  S + ++  CKRD+                    ++ +N+   SL+ +I  L
Sbjct: 1105 FSNLRHERSSLETKLTTCKRDL------------------ALLRQKNA---SLEKSIGDL 1143

Query: 1744 -KAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKT 1920
             +A    ++K +      +   + + EI Q+ +       L  + K  T  ++ I     
Sbjct: 1144 QRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELI 1203

Query: 1921 TLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK----ILNE 2088
             +  ++S ++ + I  +  +  N     N+VL   E+  E+ +  Y+D  ++      NE
Sbjct: 1204 NMQEEISRLQGHLIQTKEQVSIN----ANKVLA-YESEIEQCKQRYQDLSQQQKLTHKNE 1258

Query: 2089 SPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHH 2268
            + K  NVI         D +    N+    +D+  + N LK        K  H++L    
Sbjct: 1259 TEKLHNVI--------GDLEVKLLNVQNANADLENKFNRLK--------KQAHEKL---- 1298

Query: 2269 IDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKW 2448
                  D  KK    + N  N     L+E K  + +NL N  S V++ E+ L E      
Sbjct: 1299 ------DASKKQQTALTNELN----ELKETKDKLEENLHNEESKVVDLELKLKEHGLQVG 1348

Query: 2449 ENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXX 2628
            E S D  +       E   ++   L   +N  D S      +   +K  +EE +N +   
Sbjct: 1349 EVSKDHDSIAFKPFVEEIESLKKELQVFRNANDASD-----AFEKIKNNMEEEKNKIIDE 1403

Query: 2629 XXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVK 2808
                               L+D + N   S  S + N + I    +  +K Y       +
Sbjct: 1404 KTKDFEKK-----------LQDAV-NKSKSNESEVENSEHIEALKKEWLKEY-------E 1444

Query: 2809 NEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDE 2940
             E +  I +   +L KR+ L     +    Q I+S +K  ++ E
Sbjct: 1445 EETVKRIKEAEENLKKRIRL----PSEERIQKIISKRKGELEQE 1484

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 126/637 (19%), Positives = 233/637 (36%), Gaps = 66/637 (10%)
 Frame = +1

Query: 1276 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA--SKAKNIKN--KPQ 1443
            + F+E   T LL+  L     T L+ T+S AK   E+  ++LE    S   NI +  + +
Sbjct: 403  VSFKER--TELLEHEL--KCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQR 458

Query: 1444 LGAFIMKDILVKNITM---ELAKIKSDLLSTKSK----EGIYMSQDHYKNLNSDLESYKN 1602
            L       IL+ NI+      + + +D L +  K    E     +D    +   L  +KN
Sbjct: 459  LDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKN 518

Query: 1603 --EVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTE 1776
              E+QE   ++                     + + ++ E+ K T+ +++ Q  K+ K  
Sbjct: 519  IDELQEKNMEL------------LDCIRILADKLETNEGEADK-TVAKIENQTIKEAKEA 565

Query: 1777 L-EISGFNNKLQKLTEIMQLALQDYK--------RRELDLNKKFETHISKEIKSLKTTLF 1929
            + E+   N+KL     I+      YK        +   D     E    K+I+ L++ L 
Sbjct: 566  IIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLS 625

Query: 1930 SQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQE-KAELMYKDCVKKILNESPKFFN 2106
            S  + +E + I Q  N          ++LT  ++  + K  L   +  K ++ E      
Sbjct: 626  S--TRVESSAIIQNLN---------GQLLTYKKSQTDGKIALQEFENFKVLVAEKEA--- 671

Query: 2107 VIVEKIDIIRVDFQRFYNNIA--------ENLSDISEENN---NLKQYLKNHFFKNNHQE 2253
            ++ E+I+ ++   ++   + A         NL+D+S   N   +LK  + N   +N    
Sbjct: 672  MLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLI 731

Query: 2254 LLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
             +   +    E   K+  +       +   H E+N     + L  +T   + ++    + 
Sbjct: 732  AMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKN--LKE 789

Query: 2434 KRVKWENSFDLINKCDSMNNEFYNNMATTLSQI-KNTVDTSSNSMNKSISV--MKGQVEE 2604
              V+ E+    I    S  N        T+    KN    S+   NK  ++  +  ++E 
Sbjct: 790  LNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIEN 849

Query: 2605 SENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENS---ITSTHSHITNIDDIYDTIENIM 2775
              N +                      L+  ++ +   +   HS I   ++I  T EN++
Sbjct: 850  LGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVL 909

Query: 2776 KNYG-----------------NKENAVKNEMIDNILKEIPSLSKRVP---------LRLS 2877
            K                    NKE   K E + ++ KE+  +    P         +  S
Sbjct: 910  KELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQS 969

Query: 2878 NTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQ 2988
               G+ AQ I    K+ ID      E    EES + Q
Sbjct: 970  EKVGDQAQRI-QEMKNKIDKMAAIIEAYQKEESSQYQ 1005

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 127/622 (20%), Positives = 238/622 (38%), Gaps = 66/622 (10%)
 Frame = +1

Query: 1330 NTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIK 1509
            N+ +AL    S    T EE  + L+      + K+    G  I  +   +NI  EL  I 
Sbjct: 715  NSLSALENDSSSKIDTLEEKLTELQNDFNILSEKHSILSGDNISLNSNYENIKNELNSI- 773

Query: 1510 SDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXT 1689
            S+ LS  SKE   +   +      D++S   E+ E ++ I                    
Sbjct: 774  SEQLSMASKENENLKATNASQ-EVDVKSLNKELNEKEKSIYELEKQLNLTKTEKDKAQEG 832

Query: 1690 IQSQNSQMESLKLTI-----------NQLKAQL----DKQHKTELEISGFNNK---LQKL 1815
            I   N+++  L  +I           N++K Q     DK+ K   E+   + +   L+KL
Sbjct: 833  INKMNNELRKLMTSIDTLNEDKSRLQNEIKLQKIELDDKETKINSEMEKTSKEYDNLKKL 892

Query: 1816 TEIMQLALQDYKRREL----DLNK---KFETH------ISKEIKSLKTT----------L 1926
              + +  +++ K + L    DL +   KF++H      +++++K+L T+          L
Sbjct: 893  LALKEEEIEELKSKLLISARDLKEYKGKFQSHDSLVPKLTEKLKTLATSFKELEIERDAL 952

Query: 1927 FSQLSGMEQNNISQETNIQPNLDIIKNEVLTL----------METMQEKAELMY------ 2058
               L   E+N  S+ + +   LDIIK+E  TL          +  ++ K E M       
Sbjct: 953  LQSLKTNEENTSSELSLLTSKLDIIKSENATLEKNKKTLLENISNLESKIEDMITAHTNE 1012

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
            K  +++   E  +F   + E+++ +        N  +E  + I   NN +  Y       
Sbjct: 1013 KKALEESKEELEEFVISLNEQLEDLETSKLESSNKASELEAKIKSFNNEVNSYKNQLDTA 1072

Query: 2239 NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEM 2418
            NN    L   +D     IE+   + V + KN      ++++KL  ++   + + + N E+
Sbjct: 1073 NNLISKLQISLDEANSKIEQLEEDKVSDLKNL----TKKDQKLEARDNELSNAKLQNDEL 1128

Query: 2419 DLFEPKRVKWENSFDLINKCDSMNN--EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKG 2592
             L E + +K +       K +S+N+  E  N+   T+ + K T++ S N    +I  +K 
Sbjct: 1129 -LRERQSLK-DELLSTKEKFNSVNDDLEELNSKYVTIEEEKRTLENSINENQFTIKELKD 1186

Query: 2593 QVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENI 2772
             +    N  +                +    L++ + +  T      T++ ++   +E I
Sbjct: 1187 NISGLTNDYNALE-------------SSKLDLEEELSSQTTELDQKDTSLAELSKKLEEI 1233

Query: 2773 MKN-------YGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAI 2931
                        N E  +K+    N  KEI   S    L++  +N     N L       
Sbjct: 1234 SSEKLKLNSLLQNTETNLKDLEKVNEDKEIRIQSLEKELKVVKSNSKETDNKLQELSDKH 1293

Query: 2932 DDENPSNEITDGEESRKIQKTE 2997
            D  +   EI   ++   +   E
Sbjct: 1294 DQMSREYEILKADKESLLNSKE 1315

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 84/430 (19%), Positives = 174/430 (40%), Gaps = 43/430 (10%)
 Frame = +1

Query: 1462 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKN--LNSDLESYKNE---------- 1605
            K I   N   +++++KSD+++ + ++     ++  ++  L S++E  +N+          
Sbjct: 1494 KKINQTNFNDKISELKSDIINLEKEKDDSKEKNKTESAELKSEIEELQNKNFKMIEEHTI 1553

Query: 1606 -VQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKL----TINQLKAQLDKQH- 1767
             +   K D+E                   ++++N  +  LK     TI+ LK  L+ Q+ 
Sbjct: 1554 TLDALKTDVERLEKAKEDFQVQNNSLTSDLETKNELLHKLKEKSANTISSLKEDLETQNL 1613

Query: 1768 ----------KTELEISGFNNKLQKLT----------EIMQLALQDYKRRELDLNKKFET 1887
                      ++ +E+S  +  L +L+           + Q AL +      +LN + E 
Sbjct: 1614 QLKEKTKCAEESAIELSNISKDLNELSAKYESLNSKLSLKQDALSEITNENAELNSQLEK 1673

Query: 1888 HISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK-----NEVLTLMETMQEKAEL 2052
            H  +EI  L ++L    S ++    + ++    N D+ K     NE L  ++    K  L
Sbjct: 1674 H-KEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVNEELAHLKESSSKTIL 1732

Query: 2053 MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHF 2232
               D +  +  E  K    + E  D I  ++    N + E+L  +  + +      KN  
Sbjct: 1733 SLNDKITSLSEEFEKERTQLTEGSDSITKEYSEKINRLEESLRKVELDKDKETLEYKNK- 1791

Query: 2233 FKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQ 2412
              +   +L     D T  + +KK      N + T  D   E  +L+ + L++A S   ++
Sbjct: 1792 LTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDKSHEELELLNKQLSDALSDAQSK 1851

Query: 2413 EMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKG 2592
               + E +     N+  LI + +S++ +      T L    N  + +SNS    IS +  
Sbjct: 1852 VNCISELQ----SNNEALIKEVESLHLQI-----TDLDSKLNEANVNSNSKENEISDLLI 1902

Query: 2593 QVEESENAVS 2622
            + +++ + +S
Sbjct: 1903 KAKDNSDQLS 1912

 Score = 39.7 bits (91), Expect = 0.055
 Identities = 70/364 (19%), Positives = 154/364 (42%), Gaps = 23/364 (6%)
 Frame = +1

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD--- 2142
            TN++ +L  ++N+  + ++T++EK            L E    FN++ EK  I+  D   
Sbjct: 711  TNLKNSLSALENDSSSKIDTLEEK------------LTELQNDFNILSEKHSILSGDNIS 758

Query: 2143 -------FQRFYNNIAENLSDISEENNNLK--QYLKNHFFKNNHQELLNHHIDSTYE--- 2286
                    +   N+I+E LS  S+EN NLK     +    K+ ++E LN    S YE   
Sbjct: 759  LNSNYENIKNELNSISEQLSMASKENENLKATNASQEVDVKSLNKE-LNEKEKSIYELEK 817

Query: 2287 --DIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSF 2460
              ++ K   +  +   N +N+ L   K +   +  N   + +  E+ L   ++++ ++  
Sbjct: 818  QLNLTKTEKDKAQEGINKMNNEL--RKLMTSIDTLNEDKSRLQNEIKL---QKIELDDKE 872

Query: 2461 DLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSM---NKSISVMKGQVEESENAVSXXX 2631
              IN      ++ Y+N+   L+  +  ++   + +    + +   KG+ +  ++ V    
Sbjct: 873  TKINSEMEKTSKEYDNLKKLLALKEEEIEELKSKLLISARDLKEYKGKFQSHDSLVPKLT 932

Query: 2632 XXXXXXXXXXXXVN-KHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVK 2808
                        +  +   L  +++ +  +T S ++ +    D I++        ENA  
Sbjct: 933  EKLKTLATSFKELEIERDALLQSLKTNEENTSSELSLLTSKLDIIKS--------ENATL 984

Query: 2809 NEMIDNILKEIPSLSKRV-PLRLSNTNGNSAQNILSPKKHAIDDENPS-NEITDGEESRK 2982
             +    +L+ I +L  ++  +  ++TN   A   L   K  +++   S NE  +  E+ K
Sbjct: 985  EKNKKTLLENISNLESKIEDMITAHTNEKKA---LEESKEELEEFVISLNEQLEDLETSK 1041

Query: 2983 IQKT 2994
            ++ +
Sbjct: 1042 LESS 1045

>TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {ON}
            Anc_5.296 YDR285W
          Length = 881

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 107/515 (20%), Positives = 194/515 (37%), Gaps = 24/515 (4%)
 Frame = +1

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 1611
            N   L AF     +   + +EL   + D  + K K  I  + +    L S    YK ++ 
Sbjct: 178  NDVLLDAFNNTQKICSVLKIELQNAQQD--NKKLKNKIQATDEETNKLASKFAEYKKKIC 235

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
            + ++ I+                       ++++  LK T NQL        KT  E  G
Sbjct: 236  DLEQKIKWFDEQK--------------NHNDNKLHDLKKT-NQLVVAKINDLKTNYESIG 280

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 1971
                  K +++M          E +LNKK     +KEI+ L+  L    SG       + 
Sbjct: 281  VTVSNLKRSKMMT---------ETELNKK-----NKEIEYLQKEL-DDCSGQLSEEKIRN 325

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 2151
             N+    + IK +   + E+M++     +   +K  +NE  +F N + ++    + +  +
Sbjct: 326  NNLILEFNTIKTQNTEINESMKKNFN-EFDSMLKTFINE--RFINCLKDESSNTKEEILK 382

Query: 2152 FYNNIAENLSDISEENNNLKQYLKN------HFFKNNHQELLNHHIDSTYEDIEKKTSEF 2313
             +         + E  NN+KQ  ++       F K  +  ++N  I+S+           
Sbjct: 383  TFE------IKLKENENNIKQNYQDDVVILKEFCKTENNNIINS-INSS----------- 424

Query: 2314 VENFKNTLNDHLEENKKLIMQNLTNATSAVINQE------MDLFEPKRVKWENSFDL-IN 2472
               F NT++D     +K IMQN+ N    VI         +D  + + V+  N  +  I+
Sbjct: 425  ---FSNTVSDSSSTLEKSIMQNIHNGNDKVIENSNNMKNCIDEVKIQLVEDRNQINAEIS 481

Query: 2473 KCDSMNNEF--YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXX 2646
            K  S+ +E+  +     T+SQ    +      +  SI   + Q EE  N V         
Sbjct: 482  KFSSLMSEYKEFEKKLETVSQENTELKIQKTQLLTSIGTKEAQYEELLNQVGNLKLSTTT 541

Query: 2647 XXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNK-------ENAV 2805
                         LKD  E  +     +  +I+ + +   N   NY NK        N +
Sbjct: 542  LE------ENEKCLKDQTEKLLEKVSEYEKSIERLKNLESNSSANYENKLASQVTISNTL 595

Query: 2806 --KNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQN 2904
              +N+M+ N++K +    +    +LS+ N    +N
Sbjct: 596  TSENDMLKNMVKRLEESKE----QLSHENNKKFEN 626

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)
 Frame = +1

Query: 253 NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 432
           +  ++  +KV+  G  Q  + +++ G    + + G+N +++ +G   +GKTYTM G++  
Sbjct: 64  DTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGND-- 121

Query: 433 YNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 576
                    GI+ R+   +FD L    E   N+  +  +F EL+ E + DLL
Sbjct: 122 ------HEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 100/550 (18%), Positives = 227/550 (41%), Gaps = 12/550 (2%)
 Frame = +1

Query: 1384 ETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 1563
            ETC + ++  + K   ++  L      +  +K    E A+++ ++++TK +  +   +++
Sbjct: 1090 ETCKSSKHDLQTKLEASEKTLAEMHENEERLKE---EKAQLEKEVVNTKKE--LSTLREN 1144

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM----ESLKLT 1731
            +++L  + +    +V E ++ I                   +IQ +N  +    ++LK  
Sbjct: 1145 FESLEKEHKDSVTQVGEYEKQITDKAKEYNENISKLNDDIRSIQQENEALCKNNDNLKGE 1204

Query: 1732 INQLKAQLDKQHKT-ELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIK 1908
            + Q+K  L++Q    E  +   N +++ L    Q +  + K  E   NK+ ET    E++
Sbjct: 1205 VEQVKQTLEEQSNLRESTVEALNTQIKDLEVKNQSS--EAKLSESVKNKEIETEKMIELQ 1262

Query: 1909 SLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNE 2088
                +   ++S +E+   + E     NL+++K       E  ++K EL  +    ++ N+
Sbjct: 1263 KECNSRKEEISELEEKLKTSEVENSHNLELLK-------ELEEDKRELEIR--TNEVKNQ 1313

Query: 2089 SPKFFNV--IVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ--YLKNHFFKNNHQEL 2256
            S K  N+  + EK +    +  R      +  S++ E+   L+    +K+  F+   ++L
Sbjct: 1314 SEKIANLDKLREKTE---AELCRLKKTSTDEKSNLEEQLGKLRNEIKIKSQAFE-KERKL 1369

Query: 2257 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 2436
            LN    +  ++  +K +  +E+  N L +  E   +LI  +      A ++ + ++ E K
Sbjct: 1370 LNEGSSTITQEYSEKIN-MLEDQLNKLENENESKTRLIDTSKNELEKATLSHD-EILEEK 1427

Query: 2437 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM---KGQVEES 2607
            R + ++  D I        E  N   T L   +   ++ SNS+ + +  +   K +VE  
Sbjct: 1428 RNEIKSMKDEI----LSYKEKINEANTKLLSTERDHESRSNSLKEQLEAVQESKAEVERK 1483

Query: 2608 ENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYG 2787
             N +                +NK   + +N+++ I +    +  + +     +  +K Y 
Sbjct: 1484 MNEME------EESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQY- 1536

Query: 2788 NKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDG 2967
             K + +  + + N   ++ S       ++   +G       S  K     E    E+T  
Sbjct: 1537 TKNSQIDIKELQNEKTDLESQIIEFKKKIEELHGKLKDEAESNSK----TEAIQQELTSA 1592

Query: 2968 EESRKIQKTE 2997
             E  ++ + E
Sbjct: 1593 HEKIRVNEEE 1602

 Score = 38.9 bits (89), Expect = 0.092
 Identities = 84/463 (18%), Positives = 183/463 (39%), Gaps = 40/463 (8%)
 Frame = +1

Query: 1693 QSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYK----RRE 1860
            QS  S   SLK  ++ L+ +L    ++  E++   + L+   +    ALQ+YK    ++E
Sbjct: 777  QSLTSSHMSLKENVSSLEIELKSITESLNEMTKLRDALETKDKDNSFALQEYKSTIHKQE 836

Query: 1861 ---LDLNKKFETHISKE------IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEV 2013
                 L K+ ET  S++      I  +   LF+ LS  +Q    ++ ++Q   D  K+  
Sbjct: 837  EAIRTLEKELETISSQKKKAEDGINKMGKDLFA-LSREKQAVEEKQRSLQKEKD--KSNS 893

Query: 2014 LTLMETMQEKAELMYKDCVKKILNE----SPKFFNVIVEKIDIIRVDFQRFYNNIAENLS 2181
                ET   K E+  K    K LNE    +    + + E+ + I  +   + +    + +
Sbjct: 894  DHQKETKSLKDEITKKIIEIKTLNENLVKTKTQHSALSEEKEQISKELVEYKSRFQSHDN 953

Query: 2182 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENF------------ 2325
             +++    LK    N+       E L   I+ T  + + + S   + F            
Sbjct: 954  LVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQDKFDSLSREKESFQT 1013

Query: 2326 -KNTLNDHLEENKKLI--MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNE 2496
             K  L D ++E K+ I  +++    T++      D +E +  + +   +        N +
Sbjct: 1014 EKEHLTDDIKELKETISRLEHKNEETTSRYTSAKDDYESQINQLKEQLETATTTQDDNMD 1073

Query: 2497 FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNK 2676
              + ++  +  ++  ++T  +S +     ++ ++E SE  ++               + K
Sbjct: 1074 KISELSKNIRNLEMLLETCKSSKHD----LQTKLEASEKTLAEMHENEERLKEEKAQLEK 1129

Query: 2677 HTI--------LKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNIL 2832
              +        L++N E+        +T + +    I +  K Y N+  +  N+ I +I 
Sbjct: 1130 EVVNTKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDKAKEY-NENISKLNDDIRSIQ 1188

Query: 2833 KEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEIT 2961
            +E  +L K         N ++ +  +   K  +++++   E T
Sbjct: 1189 QENEALCK---------NNDNLKGEVEQVKQTLEEQSNLREST 1222

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
            Anc_2.633 YKL079W
          Length = 693

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 45/130 (34%), Positives = 66/130 (50%), Gaps = 5/130 (3%)
 Frame = +1

Query: 1063 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 1239
            RS TI  I L +  +DE L   S +  VDLAGS+  ++        + A   N+ + +L 
Sbjct: 265  RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 1240 RVINALADKSG----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 1407
             ++  LA+          +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325  SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 1408 ASKAKNIKNK 1437
            +S A ++ N+
Sbjct: 385  SSYASSMSNQ 394

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 45/167 (26%), Positives = 70/167 (41%), Gaps = 44/167 (26%)
 Frame = +1

Query: 208 VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 387
           +++N++ + G     N  +Y  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSN--QYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 388 TSTGKTYTMTG----------DEK--------------LYNGELSDAA------------ 459
           T TGKTYT+ G          D K                N  +  +A            
Sbjct: 99  TGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQK 158

Query: 460 ---GIIPRVLLKLFDTLE-----LQQNDYVVKCSFIELYNEELKDLL 576
              G+I +V   LF+ ++      +   ++V  SF+E+Y EE+ DLL
Sbjct: 159 KNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_5.414
            YDR356W
          Length = 1009

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 87/461 (18%), Positives = 183/461 (39%), Gaps = 27/461 (5%)
 Frame = +1

Query: 1687 TIQSQNSQMESLKLTINQLKAQLDKQHKTELE--ISGFNNKLQKLTEIMQLALQDYKRRE 1860
            T+Q+Q  +++  K   +     L  QH  EL+  +S  +  + +  +++        + E
Sbjct: 261  TLQNQFKKLQEEKAKADHEIRNLTTQHHEELDTKLSQLDRIIAEKDDLINKDTAKIHKLE 320

Query: 1861 LDLNK-KFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL---ME 2028
              LN    +T     I SLK  L  + S +E+     ET ++  +  +K+++      ++
Sbjct: 321  EQLNSLNNDTTSQSTIDSLKKQLIEEKSMLERVKTENET-LENKIHDLKSQLRESEIELK 379

Query: 2029 TMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFY------NNIAENLSDI- 2187
             + EK    Y+  ++   + S K  N    KI+ +    +  +      N   + L D  
Sbjct: 380  ALSEKCG-RYETEIRDHKSTSEKSNNYYKNKINELESKIKNLHLQLENLNTERQELQDAL 438

Query: 2188 -------SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 2346
                   S+E   +K+ ++N   K    E  NH +   ++D++K  S+   N KN+    
Sbjct: 439  LGHDIAGSDELRGIKEDMQNELEKIKQLEETNHTLQINFDDLQKDNSKLTRNLKNS---- 494

Query: 2347 LEENKKLI-------MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYN 2505
             EENKK +        Q + N   A I    DL +  R   +     +N+ D  + E  +
Sbjct: 495  -EENKKTLEIQVQSMQQTIDNLEKASIQLTSDLKKLTREVHD-----LNEKDVDSQEQIS 548

Query: 2506 NMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTI 2685
             +   + ++K+        +N+ +   + ++ E+   +                      
Sbjct: 549  RLQDKIEKLKSVHKEELKIVNEELDGKRKELIETNFQIK----------------QLQNQ 592

Query: 2686 LKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVP 2865
            L +N++NS TS  +    I +  D IE++ +   +  +A++ +   N LK+     K   
Sbjct: 593  LFENVKNSTTSDINEKV-IKEKQDQIEDLQRKLADLRDAIRTDQNKN-LKKFDLRIKETE 650

Query: 2866 LRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQ 2988
            ++ +   G   +++   K      +N    I + + + + Q
Sbjct: 651  MKYTEELGKLKEDVRLLKNERAKLKNQLETIKESKVNMETQ 691

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
            similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 99/521 (19%), Positives = 212/521 (40%), Gaps = 18/521 (3%)
 Frame = +1

Query: 1099 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI----NALADK 1266
            K  D L    K+ L          + G + +       ++Q + TL  ++    NAL+  
Sbjct: 163  KDLDALLETQKLKLEQKYDEIVREKDGEIEELKSTLQKVDQKIETLELLVAEKENALSGL 222

Query: 1267 SGHIPFRESKLTRLLQDSLGGNTKTALIATISP-AKVTSEETCSTLEYASKAKNIKNKPQ 1443
             G +  ++ KL ++  + L    K  +     P + V S+ +  T    S  +N KNK  
Sbjct: 223  DGQLKDQDEKLNQM--EKLLSLYKDVIKEFDEPKSNVVSKGSPPTSTGRSNKRN-KNKKN 279

Query: 1444 LGAFIMKDILVKNITMELAKI--KSDLLSTKSKEGIYMSQD---HYKNLNSDLESYKNEV 1608
                 +KDI    + +E   +  K     T   E I+ S +    Y+NL  D E  K E+
Sbjct: 280  KNKQSVKDIAGGGVNLEHDGVDNKDKEPGTSLSEAIFSSIETKVKYENLCGDYEKLKEEL 339

Query: 1609 QECKRDIEXXXXXXXXXXXXXXXXXXT---IQSQNSQMESLKLTINQLKAQL-DKQHKTE 1776
            ++ K+D +                  T   ++++N ++E +K  +  +  +L D + K +
Sbjct: 340  EKNKKDGDQYREMELRISSLQSELSDTKVALKTRNEELEMVKDMLKTVGNELVDAKDKLK 399

Query: 1777 LEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQN 1956
             +    + +L++L   ++ AL D K +       +E  + K  K + T L          
Sbjct: 400  EQGGTSDEELKRLKAEVE-ALHDAKSQSA---SSYEEQLGKLTKEVATLL---------- 445

Query: 1957 NISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR 2136
                + N   ++ +  N+ LT  +   +K  +   +     +N+  + FN + +     +
Sbjct: 446  ---DDKNRLESVLVQSNDQLTRAQEQVQKFRIQNNE-----MNDKMREFNTLKKSESNSK 497

Query: 2137 VDFQRFYNNIA---ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTS 2307
            +   +    IA   + + D S + +N ++ L++       +E LN  I+   +D+E+  S
Sbjct: 498  LALAQREKTIAYLEQQVKDYSLQGSNAQKALRD---LEIERERLNKRIEYLVKDLERTKS 554

Query: 2308 EFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK-CDS 2484
            E  ++   +L ++++EN KL      +    V+ ++ D  +  +    N  D I + C+ 
Sbjct: 555  ESKKS-SGSLENYIKENGKL------SERLEVLQEKYDTVKSLKSNSNNQVDSIKRQCEE 607

Query: 2485 MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEES 2607
            +N          L +    +      +N++ ++++ +  E+
Sbjct: 608  LN--------VKLKEANKKIIALEEELNENANILQERTRET 640

 Score = 36.2 bits (82), Expect = 0.57
 Identities = 66/320 (20%), Positives = 124/320 (38%), Gaps = 14/320 (4%)
 Frame = +1

Query: 1381 EETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 1560
            E+T + LE   K  +++      A    +I  + +   +  +  DL  TKS+        
Sbjct: 504  EKTIAYLEQQVKDYSLQGSNAQKALRDLEIERERLNKRIEYLVKDLERTKSES------- 556

Query: 1561 HYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQ 1740
              K  +  LE+Y  E  +    +E                     + N+Q++S+K    +
Sbjct: 557  --KKSSGSLENYIKENGKLSERLEVLQEKYDTVKSLK-------SNSNNQVDSIKRQCEE 607

Query: 1741 LKAQLDKQHKT----ELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFE------TH 1890
            L  +L + +K     E E++   N LQ+ T       +       D N KF         
Sbjct: 608  LNVKLKEANKKIIALEEELNENANILQERTRETNAMRRLLNDDHTDTNAKFRELEEKLAI 667

Query: 1891 ISKEIKSLKTTLFSQLSGMEQN-NISQETNIQPNLDIIKNEVLTLMETMQEK---AELMY 2058
            I  E   LK+ L  Q+S   +     +ETN++     +K+++ TL  T++EK    E+++
Sbjct: 668  IRDERDKLKSELDIQVSRRHREVQDLRETNLE-----LKSQISTL--TLKEKEYETEVLH 720

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
               V + +       +   E+++++              +  + E   N +Q L+N    
Sbjct: 721  LKAVNQRMQRRSSTASEGSEELELV--------------VKSLKESLGNSEQRLRNLKAS 766

Query: 2239 NNHQELLNHHIDSTYEDIEK 2298
            N    LLN  ++S  E + K
Sbjct: 767  NQELRLLNSDLNSKLERLSK 786

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 1/108 (0%)
 Frame = +1

Query: 259 KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 438
           + +++DKVF P ASQ  +   + GP+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 439 GELSDAAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEELKDLLD 579
                + G++ R+L K+F  +   +   V    S +EL N+++ DLL+
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLN 142

>TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {ON}
            Anc_8.331 YDR150W
          Length = 1795

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 70/337 (20%), Positives = 142/337 (42%), Gaps = 3/337 (0%)
 Frame = +1

Query: 1906 KSLKTTLFSQLSGMEQNNISQE-TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 2082
            KS K T+ S  S  + N+   +  +IQ  LD++K +++   +++ +      K+      
Sbjct: 6    KSSKNTVSS--SSQDDNDAKNDYQDIQSQLDLLKQKIIE--DSIDDIKHSSNKN------ 55

Query: 2083 NESPKFFNVIVEKIDI--IRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 2256
            N +    N ++ ++D   I   F + +N    NL    + N ++   + +     N ++L
Sbjct: 56   NTNNPILNSLLSQLDTTDISPSFLKDFNLNTSNLD--LQHNMSILMEINSKLILEN-RKL 112

Query: 2257 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 2436
            LN +I                N++ ++ND   EN+KL+  +         + E  L + K
Sbjct: 113  LNDNI----------------NYEKSINDITFENEKLV-DSKKKIIDNYYSNETQLIKLK 155

Query: 2437 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 2616
             + W    DL NK  S+N + YN+M   + ++ + +D+ ++S+              EN 
Sbjct: 156  DLNW----DLENKLKSINKD-YNSMKMKMLKLNDELDSKNSSI--------------ENQ 196

Query: 2617 VSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE 2796
            +                +NK   +K N  N I + +  I+N++D  D +++ + N  +K+
Sbjct: 197  IKSLNDLNLKKNNLEKDINK---IKFNYNNEINNLNERISNLNDENDALQSKLNNQNSKK 253

Query: 2797 NAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNI 2907
             ++            PS S  +  +L +TN    + I
Sbjct: 254  LSINTP---------PSSSNSIITQLQDTNSQLKEEI 281

 Score = 42.4 bits (98), Expect = 0.008
 Identities = 72/340 (21%), Positives = 140/340 (41%), Gaps = 7/340 (2%)
 Frame = +1

Query: 1837 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL 2016
            L D K++ +D     ET + K +K L   L ++L            +I  + + +K ++L
Sbjct: 133  LVDSKKKIIDNYYSNETQLIK-LKDLNWDLENKLK-----------SINKDYNSMKMKML 180

Query: 2017 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 2196
             L + +  K   +      K LN+     N + + I+ I+ ++    NN+ E +S++++E
Sbjct: 181  KLNDELDSKNSSIENQI--KSLNDLNLKKNNLEKDINKIKFNYNNEINNLNERISNLNDE 238

Query: 2197 NNNLKQYLKNHFFKN---NHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
            N+ L+  L N   K    N     ++ I +  +D   +  E +E  +       ++  + 
Sbjct: 239  NDALQSKLNNQNSKKLSINTPPSSSNSIITQLQDTNSQLKEEIEKLR------FKQQNEQ 292

Query: 2368 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 2547
            I     ++ S+ I+Q+   F+       NS D      S+ +   +N   TL++++  V+
Sbjct: 293  INSQTKSSRSSSISQDSLKFDSNGELVINSMD----SSSIKSLSQSNCPLTLNEVEKFVE 348

Query: 2548 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 2727
                 +N  I + K +    EN  +               V    + KDN +     T  
Sbjct: 349  -----LNDMILLPKERYNSLENLTNLNFNQLKDILIKRDFV---LLTKDNYK-----TLK 395

Query: 2728 HITNIDDIYDTIENIMKNYG----NKENAVKNEMIDNILK 2835
             ++ + D    I N + N G    NK+  ++NE I   LK
Sbjct: 396  SLSTLSD--KVIINRLTNDGYKVLNKDEQLQNETIIKNLK 433

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 103/516 (19%), Positives = 213/516 (41%), Gaps = 40/516 (7%)
 Frame = +1

Query: 1186 NQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1365
            +Q+ K    +   L T+   +NA  +       R+ +L +L+ +    +T  + I  +  
Sbjct: 1164 DQKEKVVTELRTKLETVCAELNASKED------RKEELVQLMSEI---DTFKSKILALEE 1214

Query: 1366 AKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 1545
             K + E +C +  Y ++ +N  N+ +L          K++  E+  ++  L S K++  +
Sbjct: 1215 EKSSIERSCDS--YRTQRQN--NEAEL----------KDLRSEMTTLRDSLSSAKNE--M 1258

Query: 1546 YMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQN-SQMESL 1722
              ++D   +L +D +   + + E + +IE                    +++N S  E  
Sbjct: 1259 NSAKDLSLHLQNDTKDLNDRILELEAEIEN-------------------KNENISAYEKS 1299

Query: 1723 KLTINQLKAQL-----DKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFET 1887
            KL I + K+ L       ++K E E S   +++QKL + M+  +QD+++    LN+   T
Sbjct: 1300 KLAIEKEKSNLKIELQSLENKFEKEASVLKSEIQKLKDEMKNKVQDFEKERKMLNEG-ST 1358

Query: 1888 HISKEIKSLKTTLFSQLSGMEQN---NISQETNIQPNLDIIKNEVLTLMETMQEKAELMY 2058
             I++      T L  +LS  E     NI        +LD    E L + E   E+ E+  
Sbjct: 1359 SITQGYSEKVTALELKLSNTEAELSANIKSLERTNADLD----EKLRICEEKLEEKEVEL 1414

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
                +K  N      ++   +I+ ++    +    +   + ++S + N  ++ LK+   K
Sbjct: 1415 CSLKEKESNVLSS-LDLKESEINALKDSQTKEITALNNKIKELSGQINIKEEELKS---K 1470

Query: 2239 NNHQELLN-----------------HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
            NN    LN                   + + Y D+E+ ++  +++ K TL   LE   K 
Sbjct: 1471 NNDISTLNMSAKANKESIDDLKKQLEELQARYSDLEETSTRELQSLKETL--RLEYENKE 1528

Query: 2368 IMQNLTNATSAVINQEMDLFEP----------KRVKWENSFDLINKCDSMNNEFYNNMAT 2517
              +   +     +NQ+ +  E           ++ K E +   + + +S +N + N++ T
Sbjct: 1529 TQKKQLDEMKDSVNQKDETIESLTSKCSELKFEKEKSEKTSLELKELESKHNRYMNDLET 1588

Query: 2518 ---TLSQIKNTVDTSSNSMNK-SISVMKGQVEESEN 2613
                 + +   ++T  N  N  S  ++K Q +  EN
Sbjct: 1589 CNKAKTSLLTEIETIRNQKNNLSEELLKNQKQYKEN 1624

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 90/418 (21%), Positives = 170/418 (40%), Gaps = 9/418 (2%)
 Frame = +1

Query: 1714 ESLKLTINQLKAQLDKQH-KTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETH 1890
            E L +  N+ +A L+K   + E  I+  N+KL+KL++ ++    +    E +LN+  E H
Sbjct: 697  EKLYVKFNKTRADLEKSTIENENVINSLNSKLEKLSKSLEHLETEKVNAETELNQLNERH 756

Query: 1891 ISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCV 2070
             + E++   T +  +      NN SQ+      L+ +K +    +   QE+ +  YK+ +
Sbjct: 757  SALEVELNDTKIALE----SVNNKSQK------LEELKQKNTKAIAVNQEQID-KYKEKI 805

Query: 2071 KKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQ 2250
              +  +        V++I   ++  +   N ++  L  +++EN  LK+ LK+H  K   Q
Sbjct: 806  NGLQQK--------VKEISESKLKAEDGINKMSRELFTLTKENGKLKEDLKSHSKKLEIQ 857

Query: 2251 ELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFE 2430
            E       S   ++EK+  E     +  L + + E+ K I   L    + + NQ+++L  
Sbjct: 858  E---KKYSSETANLEKQLKERGTEVQE-LRERISEDIKRI-DTLEKNVTILSNQKIEL-- 910

Query: 2431 PKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESE 2610
                K  N   LI K      E    +A     ++N  DT +  + +     K  ++   
Sbjct: 911  --ETKLSNQTSLIPKL----TEKLKGLANNYKDLENERDTLAKKILEKEEANKTIMQNLN 964

Query: 2611 NAV-SXXXXXXXXXXXXXXXVNKHTILKDNIE---NSITSTHS----HITNIDDIYDTIE 2766
            + + S                  H   K+N +     +TS ++     I ++    D  E
Sbjct: 965  SEIESLNKEREEMRLDLQYAAEYHQKEKENFDAHTQKLTSENNSKSESIISLQTKLDECE 1024

Query: 2767 NIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDE 2940
              +K Y      +KN +    +K I   S     + S  N +     L+    AI+DE
Sbjct: 1025 RQIKEYKTTNEELKNSLHALNVKCIELESSLESAKQSTDNSDETIEELNDSVIAINDE 1082

 Score = 38.9 bits (89), Expect = 0.092
 Identities = 53/242 (21%), Positives = 105/242 (43%), Gaps = 5/242 (2%)
 Frame = +1

Query: 1510 SDLLSTKSKEGIYMSQDHYKNLNS--DLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXX 1683
            S LL  ++K    +S    KN+    ++E  + E+ +C+  ++                 
Sbjct: 1510 SALLEEQTKLKKSISDLEAKNIKDCGEMEILRKELSKCQESLKVSQRLNEEKDEANKRTE 1569

Query: 1684 XTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRREL 1863
              I S   ++ +LK    +L+ + D+    E +      KL++L E   L +   + +  
Sbjct: 1570 TDIVSLQKEINTLK---EELRTKNDEISCFEADKKEMIAKLKELEESKTLLVHSAQEKNA 1626

Query: 1864 DLNKKFETHISKEIKSLK---TTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 2034
             + ++  T +++EIK LK    T   +L   EQ   S++T +   +DIIK E     +  
Sbjct: 1627 QMIQE-NTSLAEEIKELKLQVNTWTEKLVTSEQLWSSEKTELIKQMDIIKTE---SAKQA 1682

Query: 2035 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
            QE ++L  +  +  I  E+ K  N         RVD +   +++   ++D+ E+ +  K+
Sbjct: 1683 QENSQLNVE--LSAIKEENMKLKN---------RVDDRSEVDDLVILVTDLDEQKSKYKR 1731

Query: 2215 YL 2220
             L
Sbjct: 1732 KL 1733

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 120/616 (19%), Positives = 237/616 (38%), Gaps = 40/616 (6%)
 Frame = +1

Query: 1135 NLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIP-----FRESKL 1299
            N +D A       +G+ +++  E   I      L   I  L DK   +      ++ S+L
Sbjct: 117  NNIDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSEL 176

Query: 1300 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK--DIL 1473
             R  +  L  N +  L+   +   +  E T              NK Q   F  K  D++
Sbjct: 177  NR--KSELERNAQEILLLRKNQEWLEQELT--------------NKNQHFMFYRKKTDLM 220

Query: 1474 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXX 1653
            V +    + K+KSDL   KS + I       K L+   E  +N + E K   +       
Sbjct: 221  VHDAVTNVEKLKSDLKIEKSSKEILS-----KKLDETTEQLQNNLIENKDLKDVLAVEKQ 275

Query: 1654 XXXXXXXXXXXTIQSQNSQMESLKLTINQL--KAQLDKQHKTEL------EISGFNNKLQ 1809
                        I+   +Q++SL+ T+ Q    A+ ++++ +E+      E+S    KLQ
Sbjct: 276  EFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQ 335

Query: 1810 KLTE--IMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQ 1983
             + E  +   ++ D+   ++ L  K          +  ++   +L   + ++IS  + +Q
Sbjct: 336  DMEEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSNSS--DELGSFDDSSISL-SRMQ 392

Query: 1984 PNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNN 2163
             ++ I+K +++      QEK +       +K+ N+   F   +  KI +I   FQ   + 
Sbjct: 393  GDIKILKRQLV------QEKRQK------EKLQNQVESFVIELEHKIPVIN-SFQERTSV 439

Query: 2164 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE---KKTSEFVENFKNT 2334
            + + L+D +     L+   K +  K N  + L   I      +E   ++ ++     +  
Sbjct: 440  LEKELTDTALL---LEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYL 496

Query: 2335 L--------NDHL-EENKKLIMQNL--------TNATSAVINQEMDLFEPKRVKWENSFD 2463
            L        NDHL  E++   ++NL        TN +  VI++ +  F+  +   E + +
Sbjct: 497  LINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNME 556

Query: 2464 LINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXX 2643
            L+    ++  +   N     S   NTVD  +    ++   +    + +EN          
Sbjct: 557  LVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTK 616

Query: 2644 XXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENA---VKNE 2814
                    V++         NS+   H   +  + +   +EN +    N  NA      E
Sbjct: 617  ERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKALTE 676

Query: 2815 MIDNILKEIPSLSKRV 2862
             ++ + KEI  L+ ++
Sbjct: 677  ELNLLHKEISQLNVQI 692

>TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] {ON}
            Anc_8.636 YOR216C
          Length = 476

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 74/329 (22%), Positives = 134/329 (40%), Gaps = 18/329 (5%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            ++ QN Q       +  L   +DKQ+ T  E    NN+  +  E +Q  ++  K  +L++
Sbjct: 38   VELQNDQQ------LENLSGDMDKQNGTTAEPLKVNNEANEQIEKLQEEIRTLK-SQLEI 90

Query: 1870 NKKFETHISKEIKS------LKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMET 2031
             KK E  + KE+         +T  +  L        +Q  N+   +  +K  V + M+ 
Sbjct: 91   QKK-EQEVQKEVPQQETPDVTETQAYKDLKSERDEYENQYNNLLNRISSMKT-VFSKMKE 148

Query: 2032 MQEKAELMYKDCVKKILNESPKFFNVIVEKIDII---RVDFQRFYNNIAENLSDISEENN 2202
             QE+ E      VK+ L+E       +  K D++   R +F++    + E  S++ EE  
Sbjct: 149  SQEELE-----TVKEQLSEYESQNIRLKSKADLLSKERTEFEKTILTLNEEFSNLDEERE 203

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVE---NFKNTLNDHLEENKKLIM 2373
            NL+   K +                  E+++K T++  E   N    LN H E N +L  
Sbjct: 204  NLQIECKKY-----------------KEELDKLTNQLEEASDNHLRELNIHREANAQLEA 246

Query: 2374 QNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNE------FYNNMATTLSQIK 2535
            Q L      + N + DL     +  E   DLI+  +S   E        N +   L +  
Sbjct: 247  Q-LQELVVTLGNNKQDL----SILNEEKKDLISTLESNAIEKDSLQKTINELEAELEKAT 301

Query: 2536 NTVDTSSNSMNKSISVMKGQVEESENAVS 2622
               +      +  I+ ++ Q+++SE++ S
Sbjct: 302  AQFEEEKQQKHMEINALRAQLDKSEDSNS 330

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
            Anc_4.46 YLR309C
          Length = 960

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 107/516 (20%), Positives = 204/516 (39%), Gaps = 81/516 (15%)
 Frame = +1

Query: 1693 QSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLN 1872
            + Q   +ES    +  LK QLD+ +K    +    +K++ L E +    +  +  +  LN
Sbjct: 244  EEQAQLLESQAREVTTLKTQLDESNK---RLGDITSKMKPLEEQLVEKAKTIQELQEQLN 300

Query: 1873 KKF-------ETHISKEIKSLKTTLFSQ-------LSGMEQNNI---------SQETNIQ 1983
            K         +T    EI +LKTT  S+           +QNN            E N Q
Sbjct: 301  KSTSAIELPTKTVTETEITTLKTTPMSKNQKKRNRKKNKKQNNAPTVATKEEEQAEKNPQ 360

Query: 1984 PNLDIIKNEVLTLMETMQ------EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDF 2145
            P+ +    +   L+E         E  +  +KDC      +  + +N     ++ ++   
Sbjct: 361  PSTEEDNADTSGLLERYNTLLKDFEAFQSEHKDC-----KDWEEKYNETKSHLEELK--- 412

Query: 2146 QRFYNNIAENLSDISEENNNL-------KQYLKNHFFKNNHQELLNHHIDSTY------- 2283
                 +++E L+++ EE NNL       K+ L     +   Q  +   I +         
Sbjct: 413  -----DVSEKLAELEEEKNNLGAELSKTKEALTAKNTEVEEQREMMREIGNDLVAAKDQI 467

Query: 2284 --------EDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT-----SAVINQEMDL 2424
                    E+I + T++ VEN KN       EN+K+I +N T  +     +A +  E++ 
Sbjct: 468  KESSLGKNEEIARWTAQ-VENLKN-------ENEKIISENKTKQSELEKNTAALTDEIEK 519

Query: 2425 FEPK------RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 2586
             + K      R+K +N   +      + NE  NN  +   +  N+V T+     K+IS +
Sbjct: 520  LKTKYMDASKRLK-DNEARMNEALSKIQNE--NNRLSNQMRDYNSVKTNVLQKEKTISYL 576

Query: 2587 KGQVEE-SENAVSXXXXXXXXXXXXXXXVNKHTILK-------DNIENSITSTHSHITN- 2739
            + Q++  +E  +                 N+  +LK       DN++ +  S  +++   
Sbjct: 577  ENQIKGYTEEKIKTEKSIDMLKRENGILTNRLDLLKKENQTLHDNVKKNSNSYENYLKEN 636

Query: 2740 ---------IDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGN 2892
                     + D YD ++NI  N   + +++K +  + +  ++   SKR+ + L +   N
Sbjct: 637  GKLSERLSILQDKYDALQNIKSNSNEQTDSIKRQ-CEELNVKLREASKRI-ISLED-ELN 693

Query: 2893 SAQNILSPKKHAIDD-ENPSNEITDGEESRKIQKTE 2997
                I+  K    D      +E  + E++R+ Q TE
Sbjct: 694  DYTTIIQDKTRETDTMRRLLSESQNDEKTRQHQLTE 729

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 118/601 (19%), Positives = 244/601 (40%), Gaps = 53/601 (8%)
 Frame = +1

Query: 1354 TISPAKVTSE-ETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTK 1530
            T S  ++T E +T   L+  ++ K  KN+  L  +  K   ++NI  +L  I   L   K
Sbjct: 773  TTSLKQITEERDTLDALKKENENKIEKNEELLKEYKEK---LQNIETQLQTII--LAKQK 827

Query: 1531 SKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQ 1710
            ++EG+         +N +L +   E QE + + +                   +Q + + 
Sbjct: 828  AEEGV-------NKMNRELFALSREKQELEGNQKIALKD--------------LQKKTAV 866

Query: 1711 MESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQL--ALQDYKRRELDLNK-KF 1881
            +E  K  ++      DK ++ E +I+  N +L  L   ++   + ++ KR+E++  K KF
Sbjct: 867  LEKEKRQLS------DKLNEKEKDITRLNEELATLENTVKSLESEKNEKRKEVEEWKSKF 920

Query: 1882 ETH------ISKEIKSLKTT----------LFSQLSGMEQNNISQETNIQPNL-DIIKNE 2010
            + H      ++ ++KSL T+          L  QL+ +E  N+S ET ++ N+  + +N 
Sbjct: 921  QNHDNLVPKLTDKLKSLATSFKELEKERDSLQEQLTELESANLSHETELKNNIKQMTENN 980

Query: 2011 VLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS 2190
            V    E          K  + KI N      N + +  D     F    N + E++  ++
Sbjct: 981  VTLTTEN---------KGLISKISNLELTIDN-LKKSNDAKSAQFSDDKNELEESIMHLN 1030

Query: 2191 EENNNLK-----------------QYLKNHFFKNNHQ-ELLNHHIDSTYEDIEKKTSEFV 2316
            E+ N ++                   +K+   KN  +  LL   +D+  ED+     + +
Sbjct: 1031 EQLNEIEAEKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLI 1090

Query: 2317 ENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE---NSFDLINKCDSM 2487
            E+         E  K+ + + L N+ +A+I+    L E   +K++     +D + K    
Sbjct: 1091 ES---------ENEKRELSKLLENSKNAMIDSNNKL-EESTLKYDTLLKKYDSLEKNGQA 1140

Query: 2488 NNEFYNNMATTLS-QIK------NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXX 2646
            N + +++    L  Q++       T++TS     K+I  ++ Q+E               
Sbjct: 1141 NEKSFHDQVDELKLQLQEKELQYTTLETSIEEKEKNIQSIQTQLES----------LAAE 1190

Query: 2647 XXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV----KNE 2814
                    N  +    ++EN I   +  + ++ ++Y+  +  +     +  ++    +++
Sbjct: 1191 KERIQGIANTSSEEVVSLENRIKDLNEQLDSVRELYEKSKQELNKKNEEHQSMLAKYESD 1250

Query: 2815 MIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKT 2994
            + D++ K   + S  V L  S       +  L+ +KH    E    EI + EE  +  K+
Sbjct: 1251 LADSLAKADTATSTNVELE-SQIKVMKNELDLNKEKHTEALEILKKEIKNIEEECESTKS 1309

Query: 2995 E 2997
            +
Sbjct: 1310 D 1310

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 113/546 (20%), Positives = 208/546 (38%), Gaps = 34/546 (6%)
 Frame = +1

Query: 1387 TCSTLEYASKAKNIKNKPQLGAFIMKDIL------VKNITMELAKIKSDLLSTK-----S 1533
            T + +E  S+ K +KN+  L      + L      +KNI  E    KSD +  K     S
Sbjct: 1262 TSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEECESTKSDTVVAKNEFAKS 1321

Query: 1534 KEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM 1713
            ++ +   Q+ +       E  +NE+QE +R                     ++Q+     
Sbjct: 1322 QKELKKLQESFSINEKKSEELQNELQELQR---------------------SVQTMKEWE 1360

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLA---LQDYKRRELDLNKKFE 1884
            E++      L+ ++ K   TELE+S    KLQ + E  +     L+  K+   +  KK  
Sbjct: 1361 EAMVKKSTDLETKISK---TELELSKEKKKLQNVEESKRKVVSELESVKKESGEEKKKLV 1417

Query: 1885 THISKEIKSLKTTLFS-----QLSGMEQNNISQE-----TNIQPNLDIIK--NEVLTLME 2028
              I +    LK  +       +L     ++I+QE     + ++  LD  K  NE      
Sbjct: 1418 QEIIQIKADLKIKIHDFEKERKLLNEGSSSITQEYSEKISKLEERLDEAKFENESKGAEV 1477

Query: 2029 TMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDF----QRFYNNIAENLSDISEE 2196
               +KA    +   +KI+ E       + E I     D     Q   N I+E   ++S  
Sbjct: 1478 EKIKKASKNSEMETQKIIEEKDTQITTLRETITSKEKDLDERSQTIKNLISEKEQELSAS 1537

Query: 2197 NNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ 2376
            N NL++ LKN   +      +   + S+ E++ KK    ++  K   +   +   K++  
Sbjct: 1538 NQNLEE-LKNQISE------IKEELKSSKEEMAKKDMMLIDLNKTLASLKGDVKDKVLAI 1590

Query: 2377 NLTNATSAVIN---QEMDLFEPKRVKWENSF-DLINKCDSMNNEFYNNMATTLSQIKNTV 2544
               N T A +    ++ DL   K  K  NS  D I   D    +     A+  S+ K T+
Sbjct: 1591 EKLNETLASLKGNIKDKDLAIEKLEKTLNSLKDDIKDKDQTIEDLKKKKASEESEFKITI 1650

Query: 2545 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 2724
            +     +    + ++ Q+E+ ++++                + K + L++ + N      
Sbjct: 1651 EGKDKELTDLKNKLQTQLEKEKDSLK------KQKEQDDKLIEKSSKLEEELRNK----- 1699

Query: 2725 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQN 2904
                N +D+ + +E       N E  +        LKE  S +     RLS+ +    + 
Sbjct: 1700 --SNNYEDLKEQLEKCQMTKLNLETEIVQ------LKESISSTDADMKRLSSEHDEDKEK 1751

Query: 2905 ILSPKK 2922
            I + +K
Sbjct: 1752 INTLEK 1757

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
            ZIP1Transverse filament protein of the synaptonemal
            complex; required for normal levels of meiotic
            recombination and pairing between homologous chromosome
            during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 98/495 (19%), Positives = 192/495 (38%), Gaps = 18/495 (3%)
 Frame = +1

Query: 1432 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 1611
            N   L AF     +  N+  EL K + D    K +   Y S      +N  +  YK+ ++
Sbjct: 177  NDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQSYASNSD--KINEKVGKYKSCLE 234

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I                   T+ S  +  E+      +LK         +  ISG
Sbjct: 235  TLQERIA------------------TLTSHKNNQET------KLKDLRQNHQLYQRRISG 270

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 1971
            F   ++ L + +    ++ K  + +L KK      KEI+ LK  L    SG     +S+E
Sbjct: 271  FKTSIENLNKTINDLGKNKKEADAELMKK-----GKEIEYLKREL-DDCSGQ----LSEE 320

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKF----FNVIVEKI-DIIR 2136
                     IKN   +L++ M +  E M K  ++   +E        FN   E++ D+  
Sbjct: 321  K--------IKNS--SLIQEMGKNREEMIKS-IENFFSEDKAHHLLQFNKFEERVHDLFE 369

Query: 2137 VDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFV 2316
               Q+ ++ +A++  ++   N  ++         +N + +L    +   E++E+K S   
Sbjct: 370  KKLQKHFD-VAKDTLNVGLRNTTVE-------LSSNTETMLKQQYEDIKENLEQKMSSSK 421

Query: 2317 ENFKNTLNDHLEENKKLIM----QNLTNA-------TSAVINQEMDLFEPKRVKWENSFD 2463
            +    T+N+     K LIM    + LT++        S + N   +L +      +N   
Sbjct: 422  DEMAKTINELSVTQKGLIMGVQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYAS 481

Query: 2464 LINKCDSMNNEFY--NNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXX 2637
            L N   +   E    N     +  +++   T S+  N+ IS +  +  + E+ V      
Sbjct: 482  LENLVKAYKAEIVQSNEYEERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAK 541

Query: 2638 XXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM 2817
                          T   +N+ N +      +  ++++  T ++   NY NK ++ +NE+
Sbjct: 542  NIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKS---NYENKISS-QNEI 597

Query: 2818 IDNILKEIPSLSKRV 2862
            +  ++ E  +L +R+
Sbjct: 598  VKALVSENDTLKQRI 612

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 92/378 (24%), Positives = 166/378 (43%), Gaps = 30/378 (7%)
 Frame = +1

Query: 1018 KHRQVASTKMNDFSSRSHTIF----TITLYKKHQDELFRISKMNLVDLAGSENINRSGAL 1185
            KH  VA   +N    R+ T+     T T+ K+  +++    K NL     S     +  +
Sbjct: 374  KHFDVAKDTLN-VGLRNTTVELSSNTETMLKQQYEDI----KENLEQKMSSSKDEMAKTI 428

Query: 1186 NQRAKEAGSINQSLLTLGRVINALADKSGHIPFR-ESKLTRLLQDSLGGNTKTA--LIAT 1356
            N+      S+ Q  L +G V   L   SG+I     S++    Q+ L   ++TA    + 
Sbjct: 429  NEL-----SVTQKGLIMG-VQEELLTSSGNIQTALVSEMNNTRQELLDDASQTAKNYASL 482

Query: 1357 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 1536
             +  K    E   + EY  + K+++++    +   K+ ++ ++  + A+ + DL+     
Sbjct: 483  ENLVKAYKAEIVQSNEYEERIKHLESERSTLSS-QKNQIISSLGTKEAQYE-DLVKKLEA 540

Query: 1537 EGIYMSQDHYK--NLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQN-- 1704
            + I +SQ   K  +L    E+  NE+++ +  +E                   I SQN  
Sbjct: 541  KNIEISQISGKEQSLTEKNENLSNELKKVQDQLEKLNNLNITTKSNYENK---ISSQNEI 597

Query: 1705 -----SQMESLKLTINQL---KAQLDKQHKTELEISGFNN-KLQKL-TEIMQ-----LAL 1839
                 S+ ++LK  I QL   K    K H T+LE    NN +LQKL  E++Q     L L
Sbjct: 598  VKALVSENDTLKQRIQQLVEIKENEQKDHTTKLEAFQKNNEQLQKLNVEVVQLKAHELEL 657

Query: 1840 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQ---LSGMEQNNISQETNIQPNLDIIKNE 2010
            ++  R   +  +K ET + + +  +K TL  Q   L   +Q+  +++  +Q NL+ ++  
Sbjct: 658  EEQNRHLKNCLEKKETGVEESLSDVK-TLKQQVIVLKSEKQDITAEKLELQDNLESLEEV 716

Query: 2011 VLTLMETMQ-EKAELMYK 2061
               L + +Q +K EL  K
Sbjct: 717  TKNLQQKVQSQKRELEQK 734

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 114/596 (19%), Positives = 225/596 (37%), Gaps = 23/596 (3%)
 Frame = +1

Query: 1129 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK---SGHIPFRESKL 1299
            K NL+D     ++ +   ++Q  KE   + +  L   R   AL  K     HI + +S L
Sbjct: 102  KRNLID-----DLKKDVPMSQPLKEQ-EVREHQLKKDRFERALESKLLGKRHITYAQSDL 155

Query: 1300 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 1479
            +          T    I  +   K  S      LE   +  +++NK Q    + KD+  K
Sbjct: 156  SNKELYINEIKTLRHEIKELRKEKNDSLNNYDNLE--QEMDDLRNKLQE---LEKDLAAK 210

Query: 1480 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXX 1659
            N  ++  K +      + +E I   +    +  S L++ K +V E +             
Sbjct: 211  NKLVDSRKEEDHSACIEERERI---ERKLNDSESKLKTMKGQVHELENSANRKSSL---- 263

Query: 1660 XXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLAL 1839
                      ++S+ +++  +K   +QLK   +K   T  ++    N+L+KLT+ +    
Sbjct: 264  ----------LESKENELRKVK---DQLKELENKADATCSQLDSKKNELRKLTDQLNELE 310

Query: 1840 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT 2019
                 ++  L  K       E+K L T   ++L      N SQ +  +  L   K ++  
Sbjct: 311  NQANEKDSQLKSK-----ESELKKL-TNQLNELENKVNQNGSQSSAKESELKKSKIQITE 364

Query: 2020 LMETMQEK-AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 2196
            L E + EK ++L  K+      NE       +V +++ + +   +  + +     ++   
Sbjct: 365  LEEKINEKNSQLTAKE------NE----LKTLVAQLNQLEIKMNQKDSQLGSKEEELKAI 414

Query: 2197 NNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVE---NFKNTLNDHLEENKKL 2367
            N  L   +K    +   ++     + +  +D+E   S   +   + K+  N  LE   K+
Sbjct: 415  NEKLNADIKIARQQTASRDQRISDLQTKVQDLENDLSRMEKTHNDTKSVANIELETKVKM 474

Query: 2368 IMQ---NLTNATSAVINQEMDLFE-------------PKRVKWENSFDLINKCDSMNNEF 2499
            I     +L  A     N E +L E              + +K      ++   +S     
Sbjct: 475  IKTLEIDLKLAKEKCSNIERELNEKEDKYRFSKSSLGDENIKLNEKISILTTENSQLKSK 534

Query: 2500 YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKH 2679
             N+ +T +S +K   +T  +SM   +   K   E+SE+ V                  K 
Sbjct: 535  LNDESTAISHLKENYETRLSSMRNEVEEYKTSAEKSESEVEELRIRITENSAKVS--EKR 592

Query: 2680 TILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPS 2847
            ++     E  I   ++++    D  + +++I++ Y    N  K E   NI +++ S
Sbjct: 593  SMELKQKEQQINELNNNLKEQKDEINLLKHIIEKYKKDFNQSKTEQ-SNIQRDLNS 647

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 65/289 (22%), Positives = 111/289 (38%), Gaps = 10/289 (3%)
 Frame = +1

Query: 2137 VDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQE-------LLNHHIDSTYEDIE 2295
            +D  R  N I +   D+       +Q ++ H  K +  E       L   HI     D+ 
Sbjct: 97   IDKNRKRNLIDDLKKDVPMSQPLKEQEVREHQLKKDRFERALESKLLGKRHITYAQSDLS 156

Query: 2296 KKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK 2475
             K  E   N   TL   ++E +K    +L N  +  + QEMD    K  + E      NK
Sbjct: 157  NK--ELYINEIKTLRHEIKELRKEKNDSLNNYDN--LEQEMDDLRNKLQELEKDLAAKNK 212

Query: 2476 C-DSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXX 2652
              DS   E ++       + +  ++   N     +  MKGQV E EN+ +          
Sbjct: 213  LVDSRKEEDHS----ACIEERERIERKLNDSESKLKTMKGQVHELENSANRKSSLLESKE 268

Query: 2653 XXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM--IDN 2826
                 V     LK+ +EN   +T S +       D+ +N ++   ++ N ++N+    D+
Sbjct: 269  NELRKVKDQ--LKE-LENKADATCSQL-------DSKKNELRKLTDQLNELENQANEKDS 318

Query: 2827 ILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEE 2973
             LK   S  K++  +L+       QN         + +    +IT+ EE
Sbjct: 319  QLKSKESELKKLTNQLNELENKVNQNGSQSSAKESELKKSKIQITELEE 367

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 139/736 (18%), Positives = 290/736 (39%), Gaps = 73/736 (9%)
 Frame = +1

Query: 943  IYIQNL--QEFHITNAMEGLNLLQRGLKHRQVASTKM-NDFSSRSHTIFTITLYKKHQDE 1113
            + ++NL  ++  +TN ++ L    + +K    + TK  ND + +   I   T  +   + 
Sbjct: 425  LLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNG 484

Query: 1114 LFRISKMNLV-DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRE 1290
                 ++  + D+  +E+   S    Q   E     Q+++ L +  N    KS     R+
Sbjct: 485  PLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQK-NIDLLKSVRELARK 543

Query: 1291 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK-D 1467
             +L    Q S     +   I     A ++ +   + LE   K K + ++      + K D
Sbjct: 544  LELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLE--DKIKTLNDELDCYKSLPKPD 601

Query: 1468 ILVKNITMELAKIKSDL---LSTKSKEGIYMSQDHYKNLNSDLE----SYKNEVQECKRD 1626
              V+   + L +  +DL   L T+       S   + +LN++++    ++   V+EC+ +
Sbjct: 602  TKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNE 661

Query: 1627 ------IEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT-ELEI 1785
                   E                   +Q +   ++ + L  +Q   +  K++ + ++ +
Sbjct: 662  RASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVAL 721

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGM--EQNN 1959
            S   N+L  +   + ++  + K  + D+     T +SKE   LK  L SQL  +  E+  
Sbjct: 722  SNSQNELNYIQSQLNISKTNEKSLKDDI-----TIVSKERNELKE-LVSQLQSLQTEREQ 775

Query: 1960 ISQETNI--QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDII 2133
            I   T +  Q  LD ++ E+  + E ++ K +   K+     L+E   + N    KID I
Sbjct: 776  IFNSTKLDSQTRLDTVERELYDISEKLKNK-DREIKELESNRLSEIEWYQN----KIDAI 830

Query: 2134 RVDFQRFYNNIAENLSDISEENNNLKQYLKN----------HFFKNNHQ------ELLNH 2265
            +     + + + E  ++I E N  +K+  K+          +   NN        E L +
Sbjct: 831  KEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQN 890

Query: 2266 HIDST-------------YEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 2406
             ++ +             Y+    +  EF+EN++NT    +EE KK  ++ +      + 
Sbjct: 891  ELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNT----VEETKKEFIRKI----ETLQ 942

Query: 2407 NQEMDLFEPKRVKWENSFDLINKCDSMN-------NEFYNNMATTLSQIKNTVDTSSNSM 2565
                +L + K +  E   DL N+ D  N       +E    +   L+Q  N ++  SN  
Sbjct: 943  KDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHN-IEEVSNQY 1001

Query: 2566 NKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNID 2745
               +S ++  +E+  +  +               + KH  L   I       H++   +D
Sbjct: 1002 ELKLSTLQNDLEQQASYAN------IAQNNYEQELQKHAELAKTISQLREDAHTYRKKMD 1055

Query: 2746 DIY---DTIENIM-----------KNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNT 2883
             +     T E ++           K+Y ++ +A+K + I+++  +   L  +V L   + 
Sbjct: 1056 SMQANATTNEELLRKNEKLWEEQRKSYEDQIHALK-KRIEDLSSQNKLLFDQVDLLSKSE 1114

Query: 2884 NGNSAQNILSPKKHAI 2931
            N  + Q+  +P +  +
Sbjct: 1115 NSYNQQSSATPNEDLV 1130

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 65/370 (17%), Positives = 139/370 (37%), Gaps = 39/370 (10%)
 Frame = +1

Query: 1477 KNITMELAKIKSDLLSTKSK--------EGIYMSQDHYKNLNSDLESY------------ 1596
            K + ++L+ + ++L +T++K        E   +S + + N+ + L               
Sbjct: 1152 KALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRN 1211

Query: 1597 -----KNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDK 1761
                 + + ++ + D+E                   I+    Q+ + K   N+ K +   
Sbjct: 1212 EANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQD 1271

Query: 1762 ---QHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEI-------KS 1911
               +HK    +   + KL+     ++  L D K+   +LN +F   I K+        K+
Sbjct: 1272 ILTKHKKIDPVE--HEKLEAEIATLKQNLADKKKENEELNDRFN-RIKKQAHERLNSSKA 1328

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLDIIKN--EVLTLMETMQEKAELMYKDCVKKILN 2085
             + TL  Q+  +E  N   ++ ++     I+N  E    M    E    +     + +L+
Sbjct: 1329 TQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLS 1388

Query: 2086 --ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELL 2259
              E    FN  V+  D I        +++   L+ + E  NN              Q  L
Sbjct: 1389 SKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATV--------TGQPDL 1440

Query: 2260 NHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKR 2439
            ++ ++   +  E++  +FV++      + L E  K I    T+  +  +    D+   +R
Sbjct: 1441 SNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDI-SAQR 1499

Query: 2440 VKWENSFDLI 2469
             +WE  ++ I
Sbjct: 1500 EQWEKEYEEI 1509

>CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [2463 bp,
            820 aa] {ON} similar to uniprot|P31111 Saccharomyces
            cerevisiae YDR285w ZIP1
          Length = 820

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 97/502 (19%), Positives = 195/502 (38%), Gaps = 8/502 (1%)
 Frame = +1

Query: 1375 TSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMS 1554
            T +E         ++KN      L      D+L++  T    KI S+L S   KE     
Sbjct: 109  TQQELRPNFTQVKESKNENIMQPLITENSNDVLLEAFT-NTQKICSNLKSQLLKE----- 162

Query: 1555 QDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQME-SLKLT 1731
                +  N  L+   N+ +E  +                      +  Q  Q E SLK  
Sbjct: 163  ----QRENERLKKMLNDFEETNQKTGKKINEYKSLFESLNEKLSVLSHQKIQNEKSLKEF 218

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS 1911
            +   + Q  K  K+++EI    +KL +   I+ +   D  ++            S EI  
Sbjct: 219  VTFQEEQKSKLDKSQIEIESLKSKLNEGKNILDVMKNDLMQK------------SSEIDF 266

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNES 2091
            LK  L  + SG+      +   I   ++   N+++  ++      + +  +  K++   +
Sbjct: 267  LKKEL-DECSGLLSEEKIKSNKINQTIENKNNDLVHYLDKNITNQQNLMDELFKQVSTNN 325

Query: 2092 PKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHI 2271
             K    +++++DI     Q F          +  +++++   ++  +  NN  EL    +
Sbjct: 326  LK---KLLQRLDIALTKMQSF----------VESKSSDILVKIQESYRNNNALEL---SL 369

Query: 2272 DSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE 2451
            ++   +I    S F+EN  N +ND +  N K  + ++ N     I++  + FE   +K E
Sbjct: 370  ENNITNIFNSLSSFIENNANQINDIISSNSKNAIASIDN-----IDKRFNSFE-NSLKSE 423

Query: 2452 NS--FDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSX 2625
            NS    L+ K +   +    ++ ++L +  + VD +    +K +++ K  + + EN V  
Sbjct: 424  NSQLLKLLEKHEQNFSSKLESIDSSLKEYCSEVDVTKKLKDKILALEKYNI-KLENDVEN 482

Query: 2626 XXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV 2805
                           N+H+  +  +E  +TS  + I ++     +    +KN       +
Sbjct: 483  ---------------NQHS--EKRLEQLLTSQRNEIESLKVELKSKNETLKNSTADVFKL 525

Query: 2806 KNEMIDNI-----LKEIPSLSK 2856
            K E+   +     L EI +L K
Sbjct: 526  KEELSVKVAEISRLNEINNLQK 547

>NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.414
            YDR356W
          Length = 962

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 112/597 (18%), Positives = 235/597 (39%), Gaps = 46/597 (7%)
 Frame = +1

Query: 1186 NQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1365
            N    E   +   L+T    +N L  +       +S L+ L   ++GG TK A    IS 
Sbjct: 265  NTMHSEMDKLQSLLITKETTLNELKKQI------DSLLSEL---NVGGETKLAYDDKISS 315

Query: 1366 AKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 1545
             ++ +E          + K IK              +KN   E  K+ +DL   KSK   
Sbjct: 316  LRIDTER---------QEKEIKE-------------LKNKCSEWEKLNTDL-EMKSK--- 349

Query: 1546 YMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLK 1725
                    NLN DL   + ++++ K+++                     Q QN   ++L+
Sbjct: 350  --------NLNDDLRDIEMQLEQSKKEMHEKLSSRER------------QFQNEHDDNLE 389

Query: 1726 LTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR-------RELDLNKKFE 1884
            L   Q K  +D + K   ++S   + + +L +  + +L +Y++       +  DL  + +
Sbjct: 390  LINLQKKQIIDLETKL-TKLSEDASNVDELEKTTKESLNEYRKKYEEERSKNRDLTNRLD 448

Query: 1885 THISKEIKSLKTTLFSQLSGMEQNNISQETNIQP----NLDIIK---------NEVLTLM 2025
               ++E K   +   +Q   ++++N+  +++++     N D+ K         NE+  + 
Sbjct: 449  LMEAREAKG--SNWKTQYEHIQKDNLDLQSSLKTLNVLNTDLTKKLRDLSKRLNELEIVN 506

Query: 2026 ETMQEKAELMYKDCVKKILN---ESPKFFNVIVEKIDIIRVDFQ----RFYNNIAENLSD 2184
            + + E+   +  D V  + N   ES      + E++D I+ D +    +F   + +  S+
Sbjct: 507  DRLTEERNKL-SDTVTSLNNKSEESELQITKLEEELDSIKNDHKEEILKFNEQLEQKTSE 565

Query: 2185 ISEENNNLKQYLKNHF--FKNNHQELLNHH-IDSTYEDIEKKTSEF----------VENF 2325
            +++  N +K   K  F   KN+ +   +   +   Y+ I+K  +E            EN 
Sbjct: 566  LTKATNQIKTLQKQLFDNIKNSTESKTSEDALQKRYKQIKKLQTELDDVTLKLQLEEENH 625

Query: 2326 KNTLNDHLEE--NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMN-NE 2496
            +  LN  + E  NK        N    ++ +E    + +  K +   + +        N+
Sbjct: 626  RKILNSKIRELDNKYSTQTEDLNDQVRLLKKERSFLQAELQKGKEELNALKATQGKEVND 685

Query: 2497 F---YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXX 2667
            +   YN +    S + N  ++S+ S+      + G +EE+++ +                
Sbjct: 686  WIKKYNALNAENSSLLNEQNSSTRSLRNQ---LLGSLEENKDLLGRIEILQSEKLSLQDQ 742

Query: 2668 VNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKE 2838
            V K +  KD  + ++ ST   ++N++     ++   ++ G  E +  +     +L E
Sbjct: 743  VEKLSKSKDAYKETLKST---VSNLNYATRELDTYKRSRGESETSYLDSDESRLLSE 796

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 85/398 (21%), Positives = 158/398 (39%), Gaps = 12/398 (3%)
 Frame = +1

Query: 1702 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 1881
            +S+ ES++     L  +L+   +   ++S    ++Q  ++   L + D + +EL++ K  
Sbjct: 103  SSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQS-SQQRTLKILDERLKELEMVKAA 161

Query: 1882 ETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYK 2061
              H   E K L++T+  +L   +Q  IS + N +  L+  + + L L+++ ++  E    
Sbjct: 162  SNHSDSECKKLRSTIL-ELETKQQTYISNDLNSKSQLER-RTQELNLLQSNKDWLEKELS 219

Query: 2062 DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKN 2241
               ++ L+   K   +I E    IR D  R  N+       + + NN++ +   N   K+
Sbjct: 220  SKNQQYLSYRQKTNTIISE----IRNDLNRIRNDF-----QLEKTNNDVLRQKNNELSKD 270

Query: 2242 NHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMD 2421
              ++LL     S   + EK+        K  L D LE     + + L N   +  + +++
Sbjct: 271  LQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESNYS-DVN 329

Query: 2422 LFEPKRVKWENSFDL------INKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 2583
              + K++  EN   L       +K     NE     + T    K     +S S    I +
Sbjct: 330  SDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGILTSKSNGDFILL 389

Query: 2584 MKGQVEE---SENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH---SHITNID 2745
             K  ++E    E+  +               +N      D +EN + +      H +N  
Sbjct: 390  KKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSN-- 447

Query: 2746 DIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKR 2859
                      KN   KE  VKNE +     EI  LSK+
Sbjct: 448  ---------EKNAKIKELKVKNEKLAEYKDEIHILSKQ 476

 Score = 38.5 bits (88), Expect = 0.12
 Identities = 43/264 (16%), Positives = 106/264 (40%), Gaps = 3/264 (1%)
 Frame = +1

Query: 1573 LNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQ 1752
            L ++L+S  ++ +E + ++E                  +IQ +  ++   K  +++ K +
Sbjct: 1227 LRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKR 1286

Query: 1753 LDKQHKTELEISGFN-NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLF 1929
                 +   ++S  +  KL+   E ++  L+D  ++  D  +KF     +  + LK +  
Sbjct: 1287 SQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKL 1346

Query: 1930 SQLSGMEQNNISQETNIQPNLDIIK-NEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2106
            SQ S +EQ N  ++  +     +   N  +  +E  +          +KK+  ++ +   
Sbjct: 1347 SQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEENSK 1406

Query: 2107 VIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN-HFFKNNHQELLNHHIDSTY 2283
             +  K++   + +      + E +  + EE    +Q  +         Q+ L+  ++S  
Sbjct: 1407 ELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMK 1466

Query: 2284 EDIEKKTSEFVENFKNTLNDHLEE 2355
               E+   +F+E     +N  + E
Sbjct: 1467 RSFEEDKIKFIEEKTREVNQKIRE 1490

>TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] {ON}
            Anc_6.188 YGL086W
          Length = 652

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 81/389 (20%), Positives = 160/389 (41%), Gaps = 27/389 (6%)
 Frame = +1

Query: 1504 IKSDLLSTKSKEGIYMSQDH---YKNLNSDL-ESYKNEVQECKRDIEXXXXXXXXXXXXX 1671
            ++ D++  K K+   +S D    Y+  NSDL +SY  +++  K  +E             
Sbjct: 111  LEEDIVDIKQKKISDISNDQLEKYRKENSDLRDSYDLKIKNLKDQLESYKLDQAGTKDLM 170

Query: 1672 XXXXXTIQSQNSQMESLKLTIN---QLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQ 1842
                  I  Q   + +L+  ++   ++ A     ++T++  +  +  LQ  +E    A+Q
Sbjct: 171  QTYENEITKQTKHISNLQQELSKRDEIIASFKNSNQTQVTQTLGSTSLQLQSEYWGNAIQ 230

Query: 1843 DYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
            +++    +L +K     S EI++LK +L        + N+S E         I+ E+++ 
Sbjct: 231  EHESYIKEL-EKINLQQSNEIENLKLSL------KNEKNLSNE---------IEEELVS- 273

Query: 2023 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENL---SDISE 2193
                           V   LN +  + + +  +++ +  + +R  +N  +N+   SD ++
Sbjct: 274  ---------------VNTKLNNALNYNDDLQAQVNKLLFENERLQSNSIDNINLNSDFAK 318

Query: 2194 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIM 2373
            E N L Q  KN+     + + LNH I+      ++K   F E     L + LE  +  + 
Sbjct: 319  ERNKLLQMEKNYELNIINLKKLNHEIE------QQKLLSFEE--CKLLREELEHLQNQLQ 370

Query: 2374 QNLTNATSAVINQEMDLFEPKRVKWEN-SFDLINKCDSMNNEFYN--------------- 2505
             N  NA    I  E + F+     ++N + DL N+   +N++  N               
Sbjct: 371  NNQNNAN---IKTENNTFKTLADDYKNRTKDLTNELKKLNDQLLNVHKEDNGTSKKRRMS 427

Query: 2506 -NMATTLSQIKNTVDTSSNSMNKSISVMK 2589
             N+    S+  N +  S    NK+I  +K
Sbjct: 428  DNINLNYSKRLNELQLSMAEKNKTIEDLK 456

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 61/324 (18%), Positives = 143/324 (44%), Gaps = 9/324 (2%)
 Frame = +1

Query: 1492 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXX 1671
            ++  ++S++  TK      +SQD    +N++++S K +  +C R +E             
Sbjct: 620  QIFTVESNISPTKFYRSNIISQDVKDKVNAEIDSLKQKKSQCLRRLE-----------TL 668

Query: 1672 XXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT-ELEISGFNNKLQKLTEIMQLALQDY 1848
                  ++ + S +     T+     +L++Q K   +  S   +  Q+L      A +D 
Sbjct: 669  SSNKNDLKERRSDLRRELDTLRDKAYRLNEQRKKHSMTKSNIESLQQRLETYKDEARKDV 728

Query: 1849 KRRELDLNKKFETHISKEIKSL--KTTLFSQLSGMEQNNISQETNI--QPNLDIIKNEVL 2016
             ++  D+  K    +  + K L   T +   ++ +E++ +  +  +  Q NL    NEV+
Sbjct: 729  SQKVKDVEGKISEQLISQAKLLTDMTNVMKSVNSVERDVMEMKIKVFEQQNLQTSLNEVV 788

Query: 2017 TLMETMQEKAELMY---KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
             +    + + +  Y   K+ +K++ N +   F   +++I     D +   N +AE+    
Sbjct: 789  GIFNNREVELQEEYNTKKEIIKRMKNTNE--FKDWMDQIRTYGEDDREALNELAESYERG 846

Query: 2188 SEENNNLKQYLKNHFFK-NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
             + N++   Y+K++  K  +   ++NH  D++   I K+    + + + TL   ++E K+
Sbjct: 847  DKFNSS---YIKDYIEKLESELSMMNH--DTSSVTILKQVESELNHLRETLPTQVKELKE 901

Query: 2365 LIMQNLTNATSAVINQEMDLFEPK 2436
            + ++         + ++ DL EP+
Sbjct: 902  IKLE---------MRKKHDLLEPQ 916

>KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} similar to
            uniprot|P12753 Saccharomyces cerevisiae YNL250W RAD50
            Subunit of MRX complex with Mre11p and Xrs2p involved in
            processing double-strand DNA breaks in vegetative cells
            initiation of meiotic DSBs telomere maintenance and
            nonhomologous end joining
          Length = 1296

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 83/425 (19%), Positives = 166/425 (39%), Gaps = 55/425 (12%)
 Frame = +1

Query: 1720 LKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYK--RRELDL----NKKF 1881
            LK ++  LK   D+   T++ IS   NK+++  + ++    D     +E D     N+KF
Sbjct: 204  LKQSVEHLKTDKDRSTATKVNISKLENKIEEYQKEVKSIEHDLNIITKESDALFSSNQKF 263

Query: 1882 ETHISK--EIKSLKTTLFSQLSGMEQ------NNISQETNIQPNLD-IIKNEVLTLMETM 2034
            +  +SK   +K  KT+   Q+  ++       N+ S+  ++  N   +++ + + L E  
Sbjct: 264  QETLSKLDNLKHNKTSFMEQIQRLQSSIEILPNSKSELEDMLQNFQRLLEEKNIELFEYQ 323

Query: 2035 QEKAELM--YKDC---------VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLS 2181
             EK  L+    DC         ++  L      +     K++ I  +    YN   E+++
Sbjct: 324  SEKERLLSLLNDCRNEQQEVVRLQGELGSKKNQYETSKIKMNTILTELSELYNISKESVT 383

Query: 2182 D-----ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 2346
                  +   N NL+  L  H F+    E     + +++   E++ S ++ +  N L D 
Sbjct: 384  SEVSTMLHTANKNLESLLAKHHFEETTLEEKLSVLRNSFAKKEQQLS-YISSDLNKLADQ 442

Query: 2347 LEE-NKKLIMQNLTNATSAVINQEMDLFEPKRVKW--ENSFDLINKCDSMNNEFYNNMAT 2517
             ++   +L  + ++     V  + ++ +E K  +W  E   D I+      N+   ++  
Sbjct: 443  TKKLRNRLNDKRVSEKDLKVEKEALNNYESKLKQWNTERIVDAISTSIKTKNQDILSLED 502

Query: 2518 TLSQIKNTV----------------DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXX 2649
             L  I+  +                  S ++  K +  +K Q+EE  N VS         
Sbjct: 503  ELEVIQQQITKANQHSDLYAKLSLLKASESTKKKDVETIKKQLEEGANLVSVSFNLEGDL 562

Query: 2650 XXXXXXV--NKHTILKDNIENSITSTHSHI---TNIDDIYDTIENIMKNYGNKENAVKNE 2814
                  +   K   LK    +S  +T   I     +  I + I  I  N  + E+ +K  
Sbjct: 563  LSQFNSILDKKRVDLKKIKNDSDIATKEFIQYENQLQGIEEQIYEIESNITSIESRLKES 622

Query: 2815 MIDNI 2829
            + D +
Sbjct: 623  LPDEV 627

 Score = 38.9 bits (89), Expect = 0.089
 Identities = 61/329 (18%), Positives = 135/329 (41%), Gaps = 17/329 (5%)
 Frame = +1

Query: 1492 ELAKIKSDLLSTKSKEGIYMSQDH---YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXX 1662
            EL+K+ SDL   + +  IY+S +     + L+S  +   NE++  ++DI           
Sbjct: 791  ELSKLTSDLRRVEEELSIYISDEKLETIETLHSKQKRVNNELRALRKDISDLQIQKEDKS 850

Query: 1663 XXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQ 1842
                     I+ +NS + +++  + +      +  + E  I     + + LTE +     
Sbjct: 851  KEYNNLLSLIREKNSNINNMESALQEYLNITKEVCENESIIESSEKESEILTEEVNDLKL 910

Query: 1843 DYKRRELDLNKKFETH--ISKEIKSLKTTLFSQLSGM-EQNNISQ--ETNIQPNLDIIKN 2007
            +       LN+    H  +  E +  K  + SQ++ + E   + Q  E N  P L   + 
Sbjct: 911  EISSASGSLNEGKAKHRQLEVEARERKDKIESQVANVNELVELIQNFEINDAPRLIECEE 970

Query: 2008 EVLTLMETMQEKA------ELMYKDCVKKILNESPKFFNVIVEKIDI--IRVDFQRFYNN 2163
            ++  +  +++ K       E    + V+K+ +   +F N+ +  ID+  ++ + QR  N 
Sbjct: 971  KLTEISNSVESKTAEIKSIEDSINNTVQKLKDSDNEFKNIKL-NIDLLGLKCELQRIENA 1029

Query: 2164 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL-N 2340
            I+    D++       +Y ++        E L+        +I K+    + N KN L  
Sbjct: 1030 ISS--MDVTHAEQERNKYQEDSLRLRTAYEKLSSENAGKLGEI-KQLQNQISNLKNQLQT 1086

Query: 2341 DHLEENKKLIMQNLTNATSAVINQEMDLF 2427
            D+   ++    + +   T +++  ++D +
Sbjct: 1087 DYKNIDEHYQREWIKLQTKSLVTDDIDTY 1115

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 86/472 (18%), Positives = 199/472 (42%), Gaps = 30/472 (6%)
 Frame = +1

Query: 1492 ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXX 1671
            EL    S+L    S++  ++ Q    N NS++E Y+N+++  K+D E             
Sbjct: 811  ELEDALSELKKETSQKDHHIKQLEEDN-NSNIEWYQNKIEALKKDYE------------- 856

Query: 1672 XXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYK 1851
                 ++ S+ + +E L+  +  L+ ++++    ++ +  +N   + + +       D  
Sbjct: 857  -SVITSVDSKQTDIEKLQYKVKSLEKEIEED---KIRLHTYNVMDETIND-------DSL 905

Query: 1852 RRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN---EVLTL 2022
            R+EL+ +K   T    +IK  K    +    ++Q N   + + +   + IKN   E  +L
Sbjct: 906  RKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSL 965

Query: 2023 METMQEKAELMYK-----DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
             + +    E M+      D  KK + +    F    ++I I++ + +      +E  S +
Sbjct: 966  EDKISLLKEQMFNLNNELDLQKKGMEKEKADFK---KRISILQNNNKEVEAVKSEYESKL 1022

Query: 2188 SEENNNL-KQYLKNHFFKNNHQELLNHHID--STYEDIEKKTSEFVENFK------NTLN 2340
            S+  N+L +Q +  +  +NN+++ L  H D   T  ++ ++   +    K      + L 
Sbjct: 1023 SKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLE 1082

Query: 2341 DHLEENKK---------LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNN 2493
            + L+EN+K         L   +L+N+    ++ +  L   +   +  +   +N  +S N 
Sbjct: 1083 NALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVN--NSTNG 1140

Query: 2494 EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVE----ESENAVSXXXXXXXXXXXXX 2661
               NN+  TL + ++ +DT      +   +++ ++     E ++A +             
Sbjct: 1141 PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS 1200

Query: 2662 XXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM 2817
              + +H  + + +        S+I        T+ N ++N  NK+  +++E+
Sbjct: 1201 SIIQQHDDIMEKLNQLNLLRESNI--------TLRNELENNNNKKKELQSEL 1244

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 48/271 (17%), Positives = 118/271 (43%), Gaps = 3/271 (1%)
 Frame = +1

Query: 1573 LNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQ 1752
            L ++LE+  N+ +E + +++                  ++Q +  +++  K  +++ K +
Sbjct: 1226 LRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKR 1285

Query: 1753 L-DKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLF 1929
              D   K E   S    KL+   E ++  L++ +R+  +  +KF     +  + LKT+  
Sbjct: 1286 SQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKL 1345

Query: 1930 SQLSGMEQ-NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2106
            SQ S  EQ N++    N+  N     N  +  ++  +        + ++K+  ++ K   
Sbjct: 1346 SQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASR 1405

Query: 2107 VIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN-HFFKNNHQELLNHHIDSTY 2283
             +  K++     ++   N + E ++ + EE    +Q  +       N Q  L++ ++S  
Sbjct: 1406 ELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMK 1465

Query: 2284 EDIEKKTSEFVENFKNTLNDHLEENKKLIMQ 2376
            +  E+   +F++     +N+ + E ++ + Q
Sbjct: 1466 KSFEEDKIKFIKEKTQEVNEKILEAQERLNQ 1496

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 90/489 (18%), Positives = 193/489 (39%), Gaps = 58/489 (11%)
 Frame = +1

Query: 1474 VKNITMELAKIKSDLLSTKS------------KEGIYMSQDHYKNLNSDLESYKNEVQEC 1617
            +KN+T E   ++  +   K             K+G+   +  +K   S L++   EV+  
Sbjct: 955  IKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAV 1014

Query: 1618 KRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM----ESLKLTINQLKAQLDKQHKTELEI 1785
            K + E                  T Q+   Q       +  TI++L+ QL   H  + ++
Sbjct: 1015 KSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQL---HTYKGQV 1071

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISK--EIKSLKTTLFSQLSGMEQNN 1959
               N    +L   ++   + +  ++  L ++ +   S+  ++ S    L+ Q+       
Sbjct: 1072 KTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQ--IYTA 1129

Query: 1960 ISQETNIQPNLDIIKNEVLTLM---ETMQEKAELMYKDCVKKILNESPKFFNVIVE---- 2118
              +E N   N   + N ++TL    + +  K  +  +D   K+L +     +V ++    
Sbjct: 1130 ADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAERDA--KMLRQKISLMDVELQDART 1187

Query: 2119 KIDIIRVDFQRF------YNNIAENLSDIS---EENNNLKQYLKNHFFKNNHQELLNHHI 2271
            K+D  RV+ +        +++I E L+ ++   E N  L+  L+N+   NN ++ L   +
Sbjct: 1188 KLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENN---NNKKKELQSEL 1244

Query: 2272 DSTYEDIE--------------------KKTSEFVENFKNTLNDHLEENKKLIMQNLTNA 2391
            D   +++                     K   E V  +K    D LE++++L   +    
Sbjct: 1245 DKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKL 1304

Query: 2392 TSAVIN--QEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSM 2565
             S + N  +E++  E +  + E  F+ + +      +       +L++  N++  + N +
Sbjct: 1305 ESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVL 1364

Query: 2566 NKSISVMKGQVEESENA-VSXXXXXXXXXXXXXXXVNKHT-ILKDNIENSITSTHSHITN 2739
              S+S    ++EE +NA V+                 K +  L+  +E S TS  S I  
Sbjct: 1365 ENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTING 1424

Query: 2740 IDDIYDTIE 2766
            +++   T++
Sbjct: 1425 LNEEITTLK 1433

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 35/195 (17%), Positives = 87/195 (44%), Gaps = 5/195 (2%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQD-----YKR 1854
            +++Q    +   + + ++K + + +H+ E+         + L + ++L  ++      +R
Sbjct: 1488 LEAQERLNQPSNINMEEIKKKWESEHEQEVS-QKIREAEEALKKRIRLPTEEKINKIIER 1546

Query: 1855 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 2034
            ++ +L K+FE  + + IKS           MEQ   S E ++     +++ ++   ++  
Sbjct: 1547 KKEELEKEFEEKVEERIKS-----------MEQ---SGEIDV-----VLRKQLEAKVQEK 1587

Query: 2035 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
            Q++ E  Y   +++ L + P   ++  ++ D +R + +          S + EE NN  Q
Sbjct: 1588 QKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIE----------SRLREEFNNELQ 1637

Query: 2215 YLKNHFFKNNHQELL 2259
             +K   F    Q+ +
Sbjct: 1638 AIKKKSFDEGKQQAM 1652

>TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {ON}
            Anc_8.636 YOR216C
          Length = 478

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 64/338 (18%), Positives = 147/338 (43%), Gaps = 4/338 (1%)
 Frame = +1

Query: 1894 SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVK 2073
            + E++S+K     +  G ++   S++ N +  ++++K ++  L   + E+A++      +
Sbjct: 41   ANEVESVK-----EEDGQDEVEESKKDN-ETEVELLKEQIKVLQNQL-EQAKIRNDGDPE 93

Query: 2074 KILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQE 2253
             + +E+ +  N  +EK+   R  ++  YN++ + +S +    +N+K   K H        
Sbjct: 94   SVPSETSEGSNAELEKVKEERDKYESQYNSLLDRISSMKTIFSNMKASEKEH-------- 145

Query: 2254 LLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
                       +  K+    +E    ++N  LEE +    QNL       I  +++  E 
Sbjct: 146  -----------EATKQRLRELEKENESINQQLEEYES---QNLK------IKNKVETIEG 185

Query: 2434 KRVKWENSFDLINK-CDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESE 2610
            ++ + + +  ++N+   S+ NE   +  + + ++++ +  SS+S    IS +K   ++ E
Sbjct: 186  EKKEMKETIAILNREFSSLENEL-EDAQSRIKELESDIKISSSSSLHEISSIK---KDKE 241

Query: 2611 NAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGN 2790
              ++               +N     +DN+ NS+ +  + +   + I + +EN +     
Sbjct: 242  RLLTQIDELTLLLDNNKKDINDLEEERDNLANSVETLKNELQKQESIVENLENEL----T 297

Query: 2791 KENAVKNEMIDNILKEIPSLSKRVPL---RLSNTNGNS 2895
            K  A  N    +   EI SL+ ++      LS TN  S
Sbjct: 298  KLEAEHNSSAQSKKMEIASLTAQLETSVEELSKTNKES 335

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 62/285 (21%), Positives = 114/285 (40%), Gaps = 16/285 (5%)
 Frame = +1

Query: 1348 IATISPAKVTSEETCSTL--EYASKAKNIKNKPQLGAFIMKDILVKNITM--ELAKIKSD 1515
            + TI   K   +ET + L  E++S    +++       +  DI + + +   E++ IK D
Sbjct: 180  VETIEGEKKEMKETIAILNREFSSLENELEDAQSRIKELESDIKISSSSSLHEISSIKKD 239

Query: 1516 ------------LLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXX 1659
                        LL   +K+ I   ++   NL + +E+ KNE+Q+ +  +E         
Sbjct: 240  KERLLTQIDELTLLLDNNKKDINDLEEERDNLANSVETLKNELQKQESIVENLENELTKL 299

Query: 1660 XXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLAL 1839
                          NS  +S K+ I  L AQL+   +   E+S    K  K +E +Q  +
Sbjct: 300  EA----------EHNSSAQSKKMEIASLTAQLETSVE---ELS----KTNKESEALQKKI 342

Query: 1840 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT 2019
            +D +   ++ NKK E    +++         QL  +   N            +I NE LT
Sbjct: 343  KDME-ESIEANKKMEEKFKEQV--------VQLGKLRHEN------------VIVNEQLT 381

Query: 2020 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 2154
                M +K+       ++ I        N+I+  + + R D ++F
Sbjct: 382  KALAMIKKSSTSNNVDIELI-------SNLIISFVTLPRADTRKF 419

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 83/411 (20%), Positives = 170/411 (41%), Gaps = 30/411 (7%)
 Frame = +1

Query: 1474 VKNITMELAKIKSDLLSTKSKEGIY-MSQDHY---KNLNSDLESYKNEVQECKRDIEXXX 1641
            ++ +  EL  + S     K+ +GI  MS+D +   + + + +E YK+  +E  +D     
Sbjct: 841  IEILEKELDNVSSQ--KKKADDGINKMSKDLFALSREMQAIVEKYKSLQKEKSKD----- 893

Query: 1642 XXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTE 1821
                            I  + ++++SL   + + K Q D   K +  IS      ++L E
Sbjct: 894  --DNNHQKEAKLLKEEIARKTTEIKSLNENLGKTKTQHDDLLKEKEHIS------KELVE 945

Query: 1822 IMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ---NNISQETNIQPNL 1992
              +L  Q +      L +K ++ ++   + L+ T  S ++ ME+    N  Q +N++   
Sbjct: 946  C-KLRFQSHDILVAKLTEKLKS-LANNYRDLQATHESLIASMEEIKKENTMQMSNLESKF 1003

Query: 1993 DIIKNEVLTLMETMQEKAELMYKDC--VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 2166
            D +  E     E+ Q + EL+ ++   +K+ ++         + K +  + D++     +
Sbjct: 1004 DSLSQE----KESFQSERELLEENIRKLKETISTLELTKEEAITKFNSSKEDYESQIGLL 1059

Query: 2167 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 2346
             E L  ++ EN      +            L+H+ID    ++E +     +NFK+ L   
Sbjct: 1060 KEQLETVATENGESVNKISE----------LSHNIDDLKGELETQ-----KNFKDDLEAK 1104

Query: 2347 LEENKKLIMQNLTNATSAVINQEMDLFEPKRVK----WENSFDLINKCDSMNNEF----- 2499
            LE +KK++ +  T A    + +E    E +  K     +N  D +   +  N E      
Sbjct: 1105 LEASKKVLKE--TQANEQHLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVE 1162

Query: 2500 ------------YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 2616
                        YN   + L+   N+V   + ++ ++   +KG++EE E A
Sbjct: 1163 EYKKQISDKEKEYNGKLSELNNEINSVQQKNETICQNNEKLKGEIEEIEKA 1213

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 84/485 (17%), Positives = 178/485 (36%), Gaps = 2/485 (0%)
 Frame = +1

Query: 1369 KVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK--EG 1542
            K++ EE     +  SK KN     Q         L K +   L+K   DL+         
Sbjct: 726  KISFEEVEELQKQCSKLKNELGSLQTETEATNGDLTKKLEA-LSKEHEDLMEKYQSLTSS 784

Query: 1543 IYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESL 1722
              + ++ + +L  +L + K  + +  +  +                  TIQ Q   +E L
Sbjct: 785  HLLLKESFSSLEIELGTIKESLNKMTQLRDALETKDKENQALIQECKSTIQKQEEAIEIL 844

Query: 1723 KLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKE 1902
            +  ++ + +Q   + K +  I+  +  L  L+  MQ  ++ YK  + + +K    H  KE
Sbjct: 845  EKELDNVSSQ---KKKADDGINKMSKDLFALSREMQAIVEKYKSLQKEKSKDDNNH-QKE 900

Query: 1903 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 2082
             K LK  +  + + ++  N +       + D++K +     E ++ K      D +   L
Sbjct: 901  AKLLKEEIARKTTEIKSLNENLGKTKTQHDDLLKEKEHISKELVECKLRFQSHDILVAKL 960

Query: 2083 NESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 2262
             E  K              D Q  + ++  ++ +I +EN      L++ F   + ++   
Sbjct: 961  TEKLKSLANNYR-------DLQATHESLIASMEEIKKENTMQMSNLESKFDSLSQEK--- 1010

Query: 2263 HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRV 2442
                 +++   +   E +   K T++  LE  K+  +    ++     +Q   L E    
Sbjct: 1011 ----ESFQSERELLEENIRKLKETIST-LELTKEEAITKFNSSKEDYESQIGLLKEQLET 1065

Query: 2443 KWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVS 2622
                + + +NK   +++   +++   L   KN  D     +  S  V+K   E   N   
Sbjct: 1066 VATENGESVNKISELSHNI-DDLKGELETQKNFKDDLEAKLEASKKVLK---ETQANEQH 1121

Query: 2623 XXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENA 2802
                             +   L+DN+++        +  +++    I +  K Y  K + 
Sbjct: 1122 LKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVEEYKKQISDKEKEYNGKLSE 1181

Query: 2803 VKNEM 2817
            + NE+
Sbjct: 1182 LNNEI 1186

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 139/661 (21%), Positives = 245/661 (37%), Gaps = 62/661 (9%)
 Frame = +1

Query: 1039 TKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKE----- 1203
            TK  D  S++ T     L    QD   +I ++       +EN N +  +NQ + E     
Sbjct: 301  TKFPDLESQNET-----LKSDIQDLTLKIEELQ------NENFNLNSMINQMSNEQNNSN 349

Query: 1204 -AGSINQSLLTLGRVINALADKSGHIPFRESKL-TRLLQDSLGGNTKTALIATISPAKVT 1377
             + SI+ +L TL   IN L  +       +  L T++    +    K  +I++       
Sbjct: 350  NSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQA 409

Query: 1378 SEETCSTLE-YASKAKNIKNKPQ--LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIY 1548
             E   + L    +K  N KN  Q  L  +  K +  ++   EL + + DL +      ++
Sbjct: 410  LENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLF 469

Query: 1549 MS--QDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESL 1722
            ++   D    L  +   + N++     D+                    I+   ++   L
Sbjct: 470  VAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNIEELQAKNMEL 529

Query: 1723 KLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKE 1902
              +I  L   L+           F NK     +   L LQ Y    L+   K        
Sbjct: 530  LNSIRSLSENLENIENANSH-KEFQNKTIADAKEAILTLQ-YHNDILESKVKVLEAERDS 587

Query: 1903 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAEL-MYKDCVKK- 2076
             K L     S  S ++ +++S  T+ + N   I+ ++ TL+E +  KAEL   KD ++  
Sbjct: 588  FKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIE-KLQTLIEEL--KAELKKNKDALESQ 644

Query: 2077 ------------ILNESPKFFNVIV-EKIDIIRVDFQRFYNNIAENLSDISEENNNLKQY 2217
                        I  E  K  N ++ EKI +    F        + L   ++E N   + 
Sbjct: 645  IASFTADKSNLTISLEKEKSSNTLMAEKISLTESAF--------DMLKTENKELNKRFEN 696

Query: 2218 LKNHFFKNNHQ--ELLNHHIDSTYE--------DIEKKTSEFVENFKNTLNDHL-----E 2352
            L+N   K   +  +++N +I    E         I K   +F+   +++LN  L     E
Sbjct: 697  LQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEE 756

Query: 2353 ENKKLIM----QNLTNATSAVINQEMDLFEPKRVKWE-NSFDLINKCDSMNNE------- 2496
            +NK  IM    Q+L N    +++     F  K  + E N+ DLI    S   E       
Sbjct: 757  KNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSIS 816

Query: 2497 ------FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVE--ESENAVSXXXXXXXXXX 2652
                  +Y N    L +I + + T   S N  IS +  ++E  ES++             
Sbjct: 817  NESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSG 876

Query: 2653 XXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNIL 2832
                 ++K     D  +  ++  ++ +     +Y + E  +K   +   +VKN M D I 
Sbjct: 877  NDFSQISKDL---DITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKIS 933

Query: 2833 K 2835
            K
Sbjct: 934  K 934

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 132/644 (20%), Positives = 238/644 (36%), Gaps = 108/644 (16%)
 Frame = +1

Query: 1249 NALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 1428
            +AL  +       +S LT  L+     NT  A   +++ +     +T    E   + +N+
Sbjct: 639  DALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKT-ENKELNKRFENL 697

Query: 1429 KNKPQLGAFIMKDILVKNIT--MELAKIKSDLLSTKS-KEGIYMSQDHYKNLNSDLESYK 1599
            +N        + DI+ K IT   E++ +K+ L   KS K+ +  SQD   +LNS+L    
Sbjct: 698  QNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQD---SLNSELIKTS 754

Query: 1600 NEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTEL 1779
             E  + +  +                     Q Q+ Q E + L  +  K  + K H+ E 
Sbjct: 755  EEKNKLRIMLS--------------------QLQSLQNERMTLLDDTQKKFMSKIHELEN 794

Query: 1780 E-ISGFNNKLQKLTEIMQLALQD-----YKRRELDLNKKFETHISKEIKSLKTTLFSQLS 1941
              +    N   K+TEI +L++ +     + +  +D  KK  + I  E+ S K +L S L+
Sbjct: 795  NNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTS-KNSLISDLN 853

Query: 1942 G----MEQNNISQETN------------IQPNLDIIK--------------------NEV 2013
                 +E  + + +TN            I  +LDI K                     E 
Sbjct: 854  TKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEES 913

Query: 2014 LTLMETMQEKAELMYKDCVKKIL-------------------------NESPKFFNVIVE 2118
            L  +E+  E  + +  D + K+L                         NE  K+   I +
Sbjct: 914  LKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQ 973

Query: 2119 -KIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK-NHFFKNNHQEL------------ 2256
              + I R++  +F  + A+  S+  E+ + L+  L+    F +N QE             
Sbjct: 974  LNVQITRLN--KFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANL 1031

Query: 2257 ------------LNHHIDSTYEDIEKKTSEFVEN------FKNTLNDHLEENKKLIMQNL 2382
                        LN  I     D+EKKTS   EN       ++     LEE+KK I  NL
Sbjct: 1032 QSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKI-DNL 1090

Query: 2383 TNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS 2562
            TN     ++Q ++L        ++S     +  S     +N +      ++  +  +   
Sbjct: 1091 TNQNKLYVDQ-LELLNKDFSSMDSS-----QLSSETKHMFNRLRADRDVLETKLSIAERD 1144

Query: 2563 MNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNI 2742
               + S ++   +E  N                  + +H+ L +N E  I S  + IT  
Sbjct: 1145 SKNNASKLESLRDELANV-------QMKLISSENKLLRHSDLIENHE-KIVSELNQITLF 1196

Query: 2743 DDIYDTIENIMKNYGNKENAV------KNEMIDNILKEIPSLSK 2856
             +  +T+ N +     K   +      +N  + N+  E+ S+ +
Sbjct: 1197 KESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKE 1240

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 70/371 (18%), Positives = 157/371 (42%), Gaps = 9/371 (2%)
 Frame = +1

Query: 1381 EETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 1560
            +E+  TL       N KNK        ++  + N++MEL  +K + L  K  + + + ++
Sbjct: 1197 KESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVK-ESLGDKETDIMLIKEE 1255

Query: 1561 HYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQ 1740
              K     L + +  VQ  K D++                  T + QN+++E      N 
Sbjct: 1256 SNK---WRLRAEELSVQIDKVDLD-SVSKLSTELDALKDDAETKRKQNAELEE---RFNL 1308

Query: 1741 LKAQLDKQHKTELEI-SGFN---NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIK 1908
            LK Q  ++     EI S  N   N+L+     ++LAL   +++ +DL      +  K  +
Sbjct: 1309 LKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQ 1368

Query: 1909 SLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM---QEKAELMYKDCVKKI 2079
             L + + S+L  ++  N S + + +     + +EV +L +++   Q K   +  D     
Sbjct: 1369 KL-SNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDST 1427

Query: 2080 LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELL 2259
            +N            I+ ++ +F+     + E+ ++  E    L++      ++   ++L 
Sbjct: 1428 MN----------AMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEKIEDLQ 1477

Query: 2260 NHHIDST--YEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
            +   D +   E+ +    E+ E ++    + +EE K+ + + +   +   IN+   + E 
Sbjct: 1478 SARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINR---VIEK 1534

Query: 2434 KRVKWENSFDL 2466
            ++ + EN +++
Sbjct: 1535 RKHELENEYEV 1545

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 67/364 (18%), Positives = 141/364 (38%), Gaps = 4/364 (1%)
 Frame = +1

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHI 1893
            E L L ++ L  +L+         +  N + +KL  +        +  E+   K+  T +
Sbjct: 126  EGLNLKVSNLNIELENWKN-----NSNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFL 180

Query: 1894 SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVK 2073
            ++   SL      +     +  +  E N+  N  I   E  T +++M+ K  ++      
Sbjct: 181  NENKSSLSEQWLKEKEEFNKAKLLLEKNLN-NSTIKLEEATTTLKSMEAKVSVLSD---- 235

Query: 2074 KILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQE 2253
            K  + + K+ N I E              N+ +NL    ++ N      K    K+   +
Sbjct: 236  KNNDLTKKYENSIWE------------IKNLKDNLLVTKDDMN------KEIAMKSKLID 277

Query: 2254 LLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
            LL   + ST E++ +       N K T    LE   + +  ++ + T  +          
Sbjct: 278  LLQGQLSSTQEELRQNVEL---NSKFTKFPDLESQNETLKSDIQDLTLKI---------- 324

Query: 2434 KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVE---- 2601
            + ++ EN F+L +  + M+NE  N      S   +++D++  ++   I+++K QV     
Sbjct: 325  EELQNEN-FNLNSMINQMSNEQNN------SNNSSSIDSNLPTLYSKINLLKKQVTQEKL 377

Query: 2602 ESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKN 2781
            E ++  +               ++        +EN +T+    +    +  +TI+N + N
Sbjct: 378  EKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNN 437

Query: 2782 YGNK 2793
            Y +K
Sbjct: 438  YDSK 441

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 79/371 (21%), Positives = 160/371 (43%), Gaps = 28/371 (7%)
 Frame = +1

Query: 1468 ILVKNITMELAKIKSDLLSTK----SKEGIYMSQDHYKNLNSDLESYKNEVQECKRD--- 1626
            IL KN  ++  K++SD    K    ++    +++D  K++   +E+ + E++  K D   
Sbjct: 915  ILEKNDELDKIKLESDATLKKWESLNETNNTLTKD-LKSMTDKMETREKEIETLKNDTTK 973

Query: 1627 ---IEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL---DKQHKTELE-I 1785
               I                   T+++  S  + L+  +  L+A L   DK+ K +   I
Sbjct: 974  IDEINTQLKEAKEKILQKDKEIITLKNDTSAADKLESQLKDLQANLISKDKKSKDDKSLI 1033

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGME---QN 1956
               N K+ KL E   L  +D +   L  N K    ++ ++K L+T L ++    +    +
Sbjct: 1034 DSLNTKITKLEE--SLTKRDKEIITLKTNTKTNDDLTNKLKKLETELSTKEKSYKLLFDS 1091

Query: 1957 NISQETNIQPNLDIIKN---EVLTLMETMQEKAE-------LMYKDCVKKILNESPKFFN 2106
            N S ET I     ++ +   ++  L +T+ +K         L+ K+C            +
Sbjct: 1092 NKSLETEIHSIKKVVASKDSQIKNLNDTLSKKENNLDGKLSLLEKEC------------H 1139

Query: 2107 VIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE 2286
              + K+  + +D  +  N I +    ++E NN+L++ L     K++  E L        +
Sbjct: 1140 SALTKMKTLLLDNSKLKNQIEQ----LTESNNSLEKKLSK---KDDELENL--------K 1184

Query: 2287 DIEKKTSEFVENFKNTLNDHLEENKKLIMQ-NLTNATSAVINQEMDLFEPKRVKWENSFD 2463
             I K  S+ +    N  +  +EEN+KLI +   + A+ + +N+  +    K  K +++  
Sbjct: 1185 GISKIHSDELTTITNERDSFIEENEKLITELKSSRASYSELNKNFNKLSEKMKKLQSA-- 1242

Query: 2464 LINKCDSMNNE 2496
              +  +S++NE
Sbjct: 1243 -SSDDESLSNE 1252

 Score = 40.0 bits (92), Expect = 0.041
 Identities = 112/586 (19%), Positives = 219/586 (37%), Gaps = 72/586 (12%)
 Frame = +1

Query: 1300 TRLLQDSLGGNTKTA---LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDI 1470
            TRL   S    TK++    + TI        +T  T++   K    ++KP        DI
Sbjct: 1344 TRLASSSFELQTKSSQLNTLKTIVSGLNLPHDTMMTIDRELK----ESKPS-------DI 1392

Query: 1471 LVKNITMELAKIKSDL-LSTKSK----EGIYMSQDHYKNL---NSDLESYKNEVQ----- 1611
             V+ I +E+  +K  L + TK+K      +    D +K +   +S  E YK + +     
Sbjct: 1393 NVEKILLEIEHLKRQLEIETKAKIDAENSVAALHDKFKRIQRSDSSSEIYKLKYEASAEK 1452

Query: 1612 ----ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTEL 1779
                E K   E                  +I   +  + + +L I  LK  +    K   
Sbjct: 1453 IRTLESKLSREPLKPLSNVSSNDLFNKRESISKYDEDLRAYRLEILNLKEIMKNSDKG-- 1510

Query: 1780 EISGFNNKLQKLTEIMQLALQDYK--RRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ 1953
             ++    +L++ +    L L   K   ++LD  +     +SK + S K  + + L+ + Q
Sbjct: 1511 -VATLQKRLEEKSLNENLLLDRIKILEKDLDTTEHQNELLSKTLTSQKQQIENNLNEIHQ 1569

Query: 1954 NNISQE-----------------TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 2082
              +  +                 +NI    D IK+    L +   EK  L+ +      L
Sbjct: 1570 YELQLKDYAYALKQSDEDIQQMVSNINFLKDQIKDNEQALFDHENEKNSLIME------L 1623

Query: 2083 NESPKFFNVIVEKIDIIRVDFQRFYNNIAE------NLSDISEENNNLKQYLKNHFFKNN 2244
            N++        + I +   +       I +         +I +  + LKQY+K     N 
Sbjct: 1624 NDTSLELKKSQDAIKLYTSEISHLKERIVDAQDRTKEYEEIDQLRSQLKQYMKIESELNK 1683

Query: 2245 HQELLNHHI-----DSTY--EDIEKKTSEFVE-----NFKNTLNDHLEENKKLIMQNLTN 2388
               +LN  +     DS Y  E++ K+T+ + E       +  + D   +N K + +N++ 
Sbjct: 1684 EISVLNFKLNTLTKDSEYKIEELLKQTNHYTELVEKLGSERDMLDSTGQNLKQLYENVST 1743

Query: 2389 ATSAVINQEMDLF--------EPKRVK--WENSFDLINKCDSMNNEFYNN---MATTLSQ 2529
              S + +    L         E +R++   E+   L+N+    NN+  N+   +  TL +
Sbjct: 1744 EASTLSDNMKSLINENTMLSGEVERLENLLEDKNKLLNEIKYENNDSKNSIKYLQETL-E 1802

Query: 2530 IKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDN-IEN 2706
            ++N     +  + KS+     + +E+ N                  +N    LK N + +
Sbjct: 1803 LRNKQTERNEELLKSLQDQLDEFKENYNEEKQNALEFEEEYRSVDKLNHQLTLKYNTLRD 1862

Query: 2707 SITSTHSHITNIDDIYDTIENIMKNYGNK-ENAVKNEMIDNILKEI 2841
             +  T      +  I++    I +    K E   KN+ +++I+ ++
Sbjct: 1863 RLNDTRERDQWLAKIHELETKISEETELKYEEIKKNKKLEHIIGDL 1908

 Score = 39.7 bits (91), Expect = 0.054
 Identities = 57/289 (19%), Positives = 112/289 (38%), Gaps = 8/289 (2%)
 Frame = +1

Query: 2143 FQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVEN 2322
            F+ F  N  E L  I+  N NL+Q+  NH F     E L  +I+  Y D  K + E +  
Sbjct: 483  FEIFDLNSFEQLC-INYTNENLQQFFNNHMFILEQNEYLKENINWNYIDFGKDSIETINL 541

Query: 2323 FKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRV-KWENSFDLINKCDSMNNEF 2499
             +NT +  +       +  L +  S + N   + F  K +  W+       +   +N+  
Sbjct: 542  IENTKDKSIPTG----ILPLLDEVSILPNSNNNSFYDKLIDSWDKKSKKFKRSKKLNSFI 597

Query: 2500 YNNMATTLS-QIKNTVDTSSNSMNKS-ISVMKGQ----VEESENAVSXXXXXXXXXXXXX 2661
             N+ A  +    +  +  + + +N+  +SV+       ++   N  +             
Sbjct: 598  INHYAGDVEYNTEEWLSKNKDPLNEHLLSVLSNSNNPLIQSFFNTQTSSSNSLMKKKKYK 657

Query: 2662 XXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM-IDNILKE 2838
               ++HT    ++   +  T+ H      I    + I K++  K   + N++  + +L+ 
Sbjct: 658  TTASRHTDQLHSLLKQLNDTNPHFVRC--IIPNNKKIAKSFDRK--LILNQLRCNGVLEG 713

Query: 2839 IPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKI 2985
            I    K  P R+         NILS   +   D   +N +T   ++ +I
Sbjct: 714  IKIARKGYPNRIFFKEFFQRYNILSKTDNT--DSIDNNTMTSSRQNCEI 760

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa] {ON}
            Anc_4.46 YLR309C
          Length = 1065

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 105/537 (19%), Positives = 217/537 (40%), Gaps = 31/537 (5%)
 Frame = +1

Query: 1345 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDI--LVKNITMELAKIKSDL 1518
            LI   +  K+  E++ S +++ S+   + ++ QL     K+    + ++  E  K+ +DL
Sbjct: 469  LIEEYNEFKINHEKSISDIKHTSE---LDDELQLLRSTNKEQEDKIDDLEAEKNKVLADL 525

Query: 1519 LSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS 1698
               K+   +    +  +NL   L +  NE+ E K  I+                   ++ 
Sbjct: 526  GELKA--ALKSKNEEIENLRDMLRTVGNELVEAKDQIKDAGSLNAKEAESLKRELDDLRE 583

Query: 1699 QNS--------QMESLKLTINQLKAQLDKQHK----TELEISGFNNKLQKLTE-IMQLAL 1839
            +NS        ++  LK   + +K + DK       TE +    + K+ ++ E I Q   
Sbjct: 584  KNSAVIQTYETKIADLKKDFDNMKNEKDKLLSNAALTERQRKILDKKISQMEEHISQFQK 643

Query: 1840 Q----DYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 2007
            +    D K ++ DL  K ET++   I   + T+      ++  N    +N Q  +D++K 
Sbjct: 644  EKVELDTKLKDYDLLVKSETYLKTSITQKEKTIAYLEKQVKDYNEKSASNKQA-IDLVKK 702

Query: 2008 EV----LTLMETMQEKAELMYKDCVKKILNESPKFFN---VIVEKIDIIRVDF---QRFY 2157
            E     L +    +E  +L  K+  KK +  S  +     ++ E+I I++  F   Q   
Sbjct: 703  ESEQYKLRMSALQKENRDL--KENSKKNITSSENYIKENGILSERIKILQEKFDHAQNLK 760

Query: 2158 NNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL 2337
            +N  E +  I  +   L   LK     N     L   ++     I++KT E     +   
Sbjct: 761  SNSNEQVESIQRQCEELNVKLKE---SNKRVMSLEDELNDYSNIIQEKTREATTMRQLIS 817

Query: 2338 NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 2517
            + H  +++KL            ++ ++D F  +  + ++ F+L +    M+ E       
Sbjct: 818  DSHNGDSQKL----------RELHDKIDYFTDENKRLKSEFELSS--GKMSRELQE---- 861

Query: 2518 TLSQIKNT-VDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNK-HTILK 2691
              +Q KN+ + TS +++  S   +  ++E  ++                  + K ++ LK
Sbjct: 862  --AQAKNSKLQTSIHALTLSEQRLNAEIENLKSVNESIRKKSTVNGEDTDELEKSNSSLK 919

Query: 2692 DNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRV 2862
            + +  + T        + D+ + IEN+M     K N   N+ ++ I K   ++S ++
Sbjct: 920  EALSKADTK-------VRDLQENIENLM-----KANNDTNKKLERITKSYRTVSNQL 964

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 84/441 (19%), Positives = 194/441 (43%), Gaps = 24/441 (5%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            ++ ++ + + L L + ++    D+  K+  +    N+ L+++TE  +  L+   ++ ++ 
Sbjct: 418  LKEEHEKSDQLALQLEKITKDFDELKKSHND----NSNLKEITENFE-KLKLSNQKLIEE 472

Query: 1870 NKKFETHISKEIKSLKTT--LFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEK 2043
              +F+ +  K I  +K T  L  +L  +   N  QE  I  +L+  KN+VL  +  +  K
Sbjct: 473  YNEFKINHEKSISDIKHTSELDDELQLLRSTNKEQEDKID-DLEAEKNKVLADLGEL--K 529

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISE-------ENN 2202
            A L  K+                 E+I+ +R   +   N + E    I +       E  
Sbjct: 530  AALKSKN-----------------EEIENLRDMLRTVGNELVEAKDQIKDAGSLNAKEAE 572

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNL 2382
            +LK+ L +   KN+          +  +  E K ++  ++F N  N   E++K L    L
Sbjct: 573  SLKRELDDLREKNS----------AVIQTYETKIADLKKDFDNMKN---EKDKLLSNAAL 619

Query: 2383 TNATSAVINQEMDL-------FEPKRVKWENS---FDLINKCDSMNNEFYNNMATTLSQI 2532
            T     ++++++         F+ ++V+ +     +DL+ K ++           T++ +
Sbjct: 620  TERQRKILDKKISQMEEHISQFQKEKVELDTKLKDYDLLVKSETYLKTSITQKEKTIAYL 679

Query: 2533 KNTV---DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIE 2703
            +  V   +  S S  ++I ++K + E+ +  +S                 ++  LK+N +
Sbjct: 680  EKQVKDYNEKSASNKQAIDLVKKESEQYKLRMSALQ-------------KENRDLKENSK 726

Query: 2704 NSITSTHSHITNIDDIYDTIENIMKNYGNKEN--AVKNEMIDNILKEIPSLSKRVPLRLS 2877
             +ITS+ ++I     + + I+ + + + + +N  +  NE +++I ++   L+  V L+ S
Sbjct: 727  KNITSSENYIKENGILSERIKILQEKFDHAQNLKSNSNEQVESIQRQCEELN--VKLKES 784

Query: 2878 NTNGNSAQNILSPKKHAIDDE 2940
            N    S ++ L+   + I ++
Sbjct: 785  NKRVMSLEDELNDYSNIIQEK 805

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 120/639 (18%), Positives = 243/639 (38%), Gaps = 85/639 (13%)
 Frame = +1

Query: 1240 RVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 1419
            +VI  L  +   +    +KL +  +++L    K          K++SE    T ++   +
Sbjct: 1337 KVIEKLEKEKEALSLELNKLRKSSKENLDDRDKKIKDLEGKETKLSSELNQLTNKFKEDS 1396

Query: 1420 KNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDL---- 1587
            K  KN+  +     +  ++ +   EL K     L  K K+ I   ++  K ++S+L    
Sbjct: 1397 K--KNQENIQHLEEEKKIITDQRAELQKNSKMDLEKKEKK-IRDLENSVKRISSELSKLQ 1453

Query: 1588 ---ESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLD 1758
               ++ K EV+  K+D++                   +  Q S+    ++T+ +     D
Sbjct: 1454 KSSQNDKEEVESVKKDLQEKVQAFEKERKLLNEGSDAVTKQYSE----RITVLE-----D 1504

Query: 1759 KQHKTELEISGFNNKL-------------------QKLTEIMQLAL------QDYKRREL 1863
            K H+TELE+   N +L                   +K+ E+  L        +  K+ E 
Sbjct: 1505 KVHQTELEVQRKNKELESAKSAADEASGELRNQLEEKVVEVSSLKSTIGEQEKAIKKLES 1564

Query: 1864 DL-------NKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
            DL       NKK E  ++ E+++LK  L  + + +E N            + +++ + TL
Sbjct: 1565 DLTDSRESGNKKIE-DLNGELEALKKALSDKQAEIEANKSDLNKRAGERKE-LEDTIATL 1622

Query: 2023 METMQEKAELMYK-----DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
             + ++  ++ + +     D  KK      K  +  +EK+++   D ++   + ++ L+ +
Sbjct: 1623 QKKVENSSKALQQLENSTDSSKKNQENLIKEKDTNIEKLEVAAKDLRKKDEDKSKQLAAL 1682

Query: 2188 SEENNNLKQYLKNHF---------FKNN--HQELLNHHIDSTYEDIEKKTSEFVENFKNT 2334
              E +++K+ L+ +          FK+     E L   +D     +E+   +F E  +  
Sbjct: 1683 ESEKSSMKENLEKNVKEKDESIAQFKSQVADMESLKKELDENTNKLER--MKFEEKSRIE 1740

Query: 2335 LNDHLEENKKLIMQNLTNATSAVINQEMDL----FEPKRVKWENSFDLINKCDSMNNEFY 2502
                + E KK I + L   +    N   +L     E KR + E     I K + + +E  
Sbjct: 1741 KLTEITEEKKKIQKELEKRSEDAQNSRTELEQKTDELKRYEAEKKL-TIGKLEKLLSEKE 1799

Query: 2503 N----------NMATTLSQIKNTVDTSSNSMNKSISVMKGQVE---ESENAVSXXXXXXX 2643
                       +++ +   +K  ++  S  ++ S S+ +   E   E +           
Sbjct: 1800 RIIAKFEAEIADLSKSNKDLKTELEQHSKKLSNSSSIEEKNQELKSELKTLKKDSDALKA 1859

Query: 2644 XXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY-------DTIENIMKNYGNKENA 2802
                    +NKH   ++    S+   HS  + ++  Y         IE   K +  KE  
Sbjct: 1860 DLEEVRGSINKH---EEARRLSMEGKHSLESELEQAYKRLQSSNTLIEEKQKEFEEKEKR 1916

Query: 2803 VKNEM------IDNILKEIPSLSKRVPLRLSNTNGNSAQ 2901
            +K E       +D +  E     K      +NTN  S++
Sbjct: 1917 MKKESEQLKSELDKLRLEASEPKKENGKETNNTNEGSSE 1955

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 97/482 (20%), Positives = 185/482 (38%), Gaps = 27/482 (5%)
 Frame = +1

Query: 1003 LQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSG 1179
            L+  +K  Q  + K+ +   +   +F   L K+ Q+ E  +++     +   S N  ++ 
Sbjct: 838  LESKIKDLQKKTDKLTNEFGKKEKVFEGILEKRDQNLEALQVNIKKAEERIASLNSEKNA 897

Query: 1180 ALNQRAKEAGSINQSLLTLGRVINALADK--SGHIPFRE-----SKLTRLLQD--SLGGN 1332
             +    KE+G       +   +I+ + +K  S    ++E       L+R L +  S   N
Sbjct: 898  LI----KESGEWKSKFQSHDNLISKMTEKLKSFSESYKELQNERDSLSRSLHEASSNSSN 953

Query: 1333 TKTAL---IATISPAKVT-SEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELA 1500
              TAL   +AT+S  KV  + E    LE  S      N               ++ +E+ 
Sbjct: 954  ELTALKNELATLSAEKVKLNSEKQELLEQVSSL----NSSYESLSKRHQDETSDLNVEVE 1009

Query: 1501 KIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE-CK---RDIEXXXXXXXXXXXX 1668
            K+K  +   K      +  D  K     +    N +QE CK     IE            
Sbjct: 1010 KLKETVSHLK------VQVDELKTSRDQITENANNLQEQCKIFEGQIENQEAEKKEAEKR 1063

Query: 1669 XXXXXXTIQSQNSQMESL---KLTINQLKAQLDKQ-HKTELEISGFNNKLQKLTEIMQLA 1836
                    Q   + +E L   K  +N  K   +K+ +K + ++ G   KL+ +TE  Q  
Sbjct: 1064 YMELKQNFQVSTTDLEKLAKEKQELNDAKGSNEKELNKLKKDLEGKEQKLKSITERAQ-E 1122

Query: 1837 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL 2016
            L+     + + N   E  + + IK+L+          ++  IS    ++  LD +KN+  
Sbjct: 1123 LEKTLDEQRNSNADSERKLKENIKALEH--------QKKEAISNSKELENELDQLKNKHK 1174

Query: 2017 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF--YNNIAENLSDIS 2190
            +L E   +  E +                     K  ++ V+ +R   +NN+ +  + + 
Sbjct: 1175 SLDEQNTKSVEEL---------------------KTRVLEVEKERDEKHNNVQKIENKLQ 1213

Query: 2191 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYE---DIEKKTSEFVENFKNTLNDHLEENK 2361
            EE+ +L+   K+     +  ++L   +DS  +   D+  + +   ENF     D  E  +
Sbjct: 1214 EESKSLESLQKSQESNKSKLKVLQDKLDSLLQEKNDLVSEKNNLKENFAKVKEDFEESQR 1273

Query: 2362 KL 2367
            K+
Sbjct: 1274 KI 1275

>TPHA0H02980 Chr8 (712882..715305) [2424 bp, 807 aa] {ON} Anc_7.21
            YAL047C
          Length = 807

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 89/447 (19%), Positives = 184/447 (41%), Gaps = 42/447 (9%)
 Frame = +1

Query: 1696 SQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNK 1875
            SQ++++E LK TI + KA LD+    +  +     K+  + E+++L  Q+ K   LD   
Sbjct: 238  SQSNEIEQLKKTIKEQKASLDENESVQANL---REKITSVNEMLKLLKQENKET-LDYAN 293

Query: 1876 KFETH---ISKEIKSLKTTLFSQL---SGMEQNNISQETNIQPNLDIIK-NEVLTLMETM 2034
            ++  H   ISK +  L T L  +L   S   +  + +  +I  +  ++K N +++ +  +
Sbjct: 294  EYLEHSEQISKNVDELITILIEKLYKISDRRKKTLEKARSISSSFVMVKMNALISSLRRI 353

Query: 2035 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
             +  +L Y     +  NES K  +   EK  I  +         +     I  + N+ K 
Sbjct: 354  LD--DLKYYQKYFEYHNESTKLDDN-AEKKQITFIANSTDIQLPSHEAEPIDNQVNSAKY 410

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYE----DIEKKTSEFVENFKNTLNDH--LEEN------ 2358
              + H       EL +  ID+  E    DI  + ++F+      + D   +EE+      
Sbjct: 411  IEQIH-----SGELDSSRIDTRLENAILDIHSEYADFLHGINIKMQDASLVEESLVSKFS 465

Query: 2359 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENS----------------FDLINKCDSMN 2490
            K++ + N   +   ++ Q+ D    + +K++N                  +L N+ D  +
Sbjct: 466  KQMSILNRLASQYQILKQQHD----EDLKYQNIKLIGLNNELENKEKLIIELQNENDDRS 521

Query: 2491 NEF--YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXX 2664
            N    YN +  T+   K       N++N   + ++  ++E+ NA                
Sbjct: 522  NIVMKYNKLLKTIDDEKKLFKIKENNLNTLNNELEHDLDENRNANKNLMGIVEQLNHELE 581

Query: 2665 XV-----NKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNI 2829
             +     +K   +K+N  N +   +S  ++  D+     N++KNY   +N  +N  +   
Sbjct: 582  HLKLDSSDKFDTMKNNYYNMMQKYNSLNSDYKDLRYENANMIKNYETIQN--ENYQLKKT 639

Query: 2830 LKEIPSLSKRVPLRLSNTNGNSAQNIL 2910
            L+ + +    + +R  +   N  Q+++
Sbjct: 640  LETVET-DHNIIIRYESEFNNFKQHLI 665

>YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON}
            CNM67Component of the spindle pole body outer plaque;
            required for spindle orientation and mitotic nuclear
            migration
          Length = 581

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 64/283 (22%), Positives = 126/283 (44%), Gaps = 17/283 (6%)
 Frame = +1

Query: 1504 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXX 1683
            IK  L +++ +E   +SQ  +KN  ++ E  +NE++  K +I+                 
Sbjct: 303  IKGFLCASQQEELSRISQ-RFKNAKAEAEDLRNELENKKIEIQ----TMREKNNTLIGTN 357

Query: 1684 XTIQSQNSQM--ESLKLTINQLKAQLDKQHKTELEISGFNNKL---QKLTEIMQLALQDY 1848
             T+  QN  +  +  KLTI++ +       + ++++   N +L   +K  E  + +L+D 
Sbjct: 358  KTLSKQNKILCDKFDKLTIDEKEILKGCNEEIKIKLERLNERLGSWEKSKEKYETSLKDK 417

Query: 1849 KRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLME 2028
            ++   D  KK  T +SKE+ +L++  F  L G     I+ +  +Q   DI   E   LM 
Sbjct: 418  EKMLADAEKKTNT-LSKELDNLRSR-FGNLEGNTSERITIKNILQSRPDISAEECNFLMV 475

Query: 2029 TMQEKAEL-MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR---FYNNIAENL-SDISE 2193
               + A L   ++ VK+I+      +  +  KI ++ +  +      +N A+ L   +  
Sbjct: 476  EQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYS 535

Query: 2194 ENNNLKQYLKN---HFFKNNHQELLNHH----IDSTYEDIEKK 2301
            +  NLK++       F      + ++HH    +D  Y+ I +K
Sbjct: 536  QEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYDHILEK 578

>YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Subunit
            of MRX complex, with Mre11p and Xrs2p, involved in
            processing double-strand DNA breaks in vegetative cells,
            initiation of meiotic DSBs, telomere maintenance, and
            nonhomologous end joining
          Length = 1312

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 107/555 (19%), Positives = 225/555 (40%), Gaps = 20/555 (3%)
 Frame = +1

Query: 1234 LGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 1413
            L  +I ++   S ++ + +   ++L+ DS     K     ++S     + E  +   Y  
Sbjct: 423  LSDLIKSITVDSQNLEYNKKDRSKLIHDSEELAEKLKSFKSLSTQDSLNHELENLKTYKE 482

Query: 1414 KAKNIKNK---PQLGAFIMKD----ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK- 1569
            K ++ +++   P+L   I +     I+++N   ++ K +  ++ T  +  +Y      K 
Sbjct: 483  KLQSWESENIIPKLNQKIEEKNNEMIILEN---QIEKFQDRIMKTNQQADLYAKLGLIKK 539

Query: 1570 NLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKA 1749
            ++N+ L+  +   ++ + D                      Q  + +M+  KL IN  K 
Sbjct: 540  SINTKLDELQKITEKLQNDSRIRQVFPLTQE---------FQRADLEMDFQKLFINMQK- 589

Query: 1750 QLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLF 1929
                       I+  N K+ +L      AL +    E DL    ++   K I+ L   L 
Sbjct: 590  ----------NIAINNKKMHELDRRYTNALYNLNTIEKDLQDNQKSK-EKVIQLLSENLP 638

Query: 1930 SQLSGMEQNNISQETNI--QPNLDIIKNEVLTLMETMQEKAELMYKD-----CVKKILNE 2088
               +  E N++ +ET +  +  L+ +K    TL E  ++  E+  +D     C +K  NE
Sbjct: 639  EDCTIDEYNDVLEETELSYKTALENLKMHQTTL-EFNRKALEIAERDSCCYLCSRKFENE 697

Query: 2089 S--PKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 2262
            S   K    +  K D    +F++   +  +N     +E  +  + L+ H    N    +N
Sbjct: 698  SFKSKLLQELKTKTD---ANFEKTLKDTVQN----EKEYLHSLRLLEKHIITLNS---IN 747

Query: 2263 HHIDSTYEDIEKKTSEFVENFKNTLND-HLEENKKLIMQNLTNATSAVINQEMDLFEPKR 2439
              ID++ + +EK   E  +  K+ L++  ++  K    + L  +    + ++    E + 
Sbjct: 748  EKIDNSQKCLEKAKEE-TKTSKSKLDELEVDSTKLKDEKELAESEIRPLIEKFTYLEKEL 806

Query: 2440 VKWENSFDLINKCDSMNNEFYNNMATT--LSQIKNTVDTSSNSMNKSISVMKGQVEESEN 2613
               ENS   I++  S+ N   + + T   L   +  ++ S   + K+IS ++ + +E   
Sbjct: 807  KDLENSSKTISEELSIYNTSEDGIQTVDELRDQQRKMNDSLRELRKTISDLQMEKDEKVR 866

Query: 2614 AVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNK 2793
              S               +      K NI++SI S   +I +ID     +E  + +  NK
Sbjct: 867  ENSRMINLIKEKELTVSEIESSLTQKQNIDDSIRSKRENINDIDSRVKELEARIISLKNK 926

Query: 2794 ENAVKNEMIDNILKE 2838
            ++  ++ ++D +  E
Sbjct: 927  KDEAQS-VLDKVKNE 940

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 69/322 (21%), Positives = 141/322 (43%), Gaps = 13/322 (4%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            +  +  +++ ++  + Q     D     E E+S      +K+ E     LQ+     L+L
Sbjct: 1321 LDEERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEE----NLQETVNSSLEL 1376

Query: 1870 NKKFETHISKEIKSLKT---TLFSQ---LSGMEQNNISQET--NIQPNLDIIKNEVLTLM 2025
            NKK    +++E+ SLK+   TL +Q   +S  + + I+ ET  +++ + ++ K E++T  
Sbjct: 1377 NKK----LTEEVNSLKSQLETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELIT-- 1430

Query: 2026 ETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI-----S 2190
             T++E+ +   ++  KK+L E  K +           +D ++  +   E   +I     +
Sbjct: 1431 -TLKEEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIA 1489

Query: 2191 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
            +   NLK+ ++        +E +N  I+   +++E+                 E  KKL 
Sbjct: 1490 DAEENLKKRIRLP-----SEEKINRVIEKRRKELEE-----------------EYEKKLK 1527

Query: 2371 MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 2550
             Q LT  T+       ++    RVK++N    + K   +  +  + M TTL + K +   
Sbjct: 1528 RQGLTTETAIEEELRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLE 1587

Query: 2551 SSNSMNKSISVMKGQVEESENA 2616
            S  S +++  +   Q E +E A
Sbjct: 1588 SQASPSRTPDLESSQKENTEGA 1609

>CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} similar to
            uniprot|Q12234 Saccharomyces cerevisiae YOR216c RUD3
          Length = 459

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 66/307 (21%), Positives = 141/307 (45%), Gaps = 4/307 (1%)
 Frame = +1

Query: 1705 SQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFE 1884
            SQ ++L   ++ +K    K  ++E E+           E+++  LQ+Y+ + L+L  K  
Sbjct: 108  SQYQTLLSRLSSMKTIFSKMKESEAEL-----------EVVKEQLQEYENQNLNLKNKVS 156

Query: 1885 --THISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMY 2058
              T   KE++   TTL  +L  +E    S +  ++ +   IK     L   ++ K+E+  
Sbjct: 157  LLTKEKKELEETATTLNKELESLESEQESNDDKLKESQTRIKE----LEHQLEAKSEIS- 211

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
            K    ++  E+ +  + + E + +I        +N  ++LS   EE  +LKQ ++N   +
Sbjct: 212  KSESGRLKKENEQLNSQVQELLVVI--------DNNKQDLSASKEEIEDLKQNVEN--LE 261

Query: 2239 NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLND-HLEENK-KLIMQNLTNATSAVINQ 2412
            N   +L N      + D+E +     +  K  L++ +LE N  +  +     A +A I+ 
Sbjct: 262  NEKVKLQN-----AFNDMELQLDAVEKANKEQLDEKNLEINALRTQLDQAIEAKNAEIS- 315

Query: 2413 EMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKG 2592
            +M+  E K    +    L  K +  + E     A+ ++++++     +  + K+++++K 
Sbjct: 316  KMEELEKKLAAMKQDVTLKEKFEKESKEH----ASQIAKLRHETIVLNEHLTKALAMLK- 370

Query: 2593 QVEESEN 2613
            Q  +SE+
Sbjct: 371  QSSDSES 377

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 107/536 (19%), Positives = 218/536 (40%), Gaps = 10/536 (1%)
 Frame = +1

Query: 1012 GLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL-FRISKMNLVDL-AGSENINRSGAL 1185
            G+K+ +V   KM   S R++    I  Y+K+ +EL  +++ +N   +   +E      AL
Sbjct: 457  GVKNHEVEDLKMQLESLRNNNSDVIKNYEKNLNELNKKVADVNEKKVKLENETKTLQTAL 516

Query: 1186 NQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1365
             +  +E   + ++L      I+ +  +S             L D L          ++  
Sbjct: 517  AKSHQEKDELKKNLSESKEFISKIRKES-----------NTLADQLREYNFLKKNESVMK 565

Query: 1366 AKVT-SEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEG 1542
              +T  E+T S LE   +  N+K +    +  ++D  ++N  +      S  L T +KE 
Sbjct: 566  LSITQKEKTISYLEQQIRDYNVKEETTKNS--LRDAKLENEHL------SKKLDTLTKEN 617

Query: 1543 IYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESL 1722
              + +D  KN +  LE Y  E  +    ++                     + N Q++S+
Sbjct: 618  ESLKKDVKKN-DGSLEQYIKENGKLSERLDILQEKYDTLQNMK-------SNSNDQVDSI 669

Query: 1723 KLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF----ETH 1890
            +    +L  +L + +K    I    ++L + T I+Q      + RE +  ++     E  
Sbjct: 670  RRQCEELNVKLKESNK---RILSLEDELNESTSILQ-----ERTRETNTMRRLLADSEND 721

Query: 1891 ISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLME-TMQEKAELMYKDC 2067
               ++K L+      L   E++ +  E  +Q +      E+  L E  M+ K+E+     
Sbjct: 722  RGIKLKELQEKFAITLE--EKSKLQSELTLQTSRK--TREIQELRELNMELKSEI----- 772

Query: 2068 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNH 2247
                LN   K     +E +  +  + QR  +  AE+  ++    ++LK+ L     K   
Sbjct: 773  --HTLNLKIKQQQSEIEHLSSVNRNMQRKSSASAESSGELDNVVSSLKEALSRSEKKIRD 830

Query: 2248 QELLNHHIDSTYEDIEKKTSEFVENFK--NTLNDHLEENKKLIMQNLTNATSAVINQEMD 2421
             E +N  +    +D+ KK     +N+K  +T  + L+E    +  + +N+++  ++    
Sbjct: 831  TENINEELKDLNKDLNKKLDRLSKNYKTVSTQLNLLKEGNSPVPPSRSNSSTFTLS---- 886

Query: 2422 LFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK 2589
                     +N+ D +++  S+ NE  +N  +T        DT S  +N+ I+ +K
Sbjct: 887  ---------DNASDSVSRRPSLVNESSSNTVST--------DTRS-ELNEKIAYIK 924

>Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON}
            (19685..21463) [1779 nt, 593 aa]
          Length = 592

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 43/166 (25%), Positives = 81/166 (48%)
 Frame = +1

Query: 1903 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 2082
            ++++  T+ S L G   N    E NI  + D+I  + L   E + +  EL+  D   K L
Sbjct: 430  VEAVDKTIISLLQG--DNKDILEKNIPMSADVISKKYLKEAEVVTQ--ELV--DITLKRL 483

Query: 2083 NESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 2262
            +   K  + + + ++  R+ F+     +A+N SD+S++  +L  +L+     +    L++
Sbjct: 484  HLKFKELDRLEDTLEKERIKFEEQTKQLADNRSDLSKQITDLNSHLEK-LSVSKKLVLIS 542

Query: 2263 HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 2400
              +DST + +EK+     E      N  L++ K L ++ LTNA  A
Sbjct: 543  EQVDSTIKVVEKEEQTAAEEAD---NKELQKKKNLELEALTNAAPA 585

>Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {ON}
            complement(51521..57427) [5907 nt, 1969 aa]
          Length = 1968

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 75/389 (19%), Positives = 159/389 (40%), Gaps = 27/389 (6%)
 Frame = +1

Query: 1294 KLTRLLQDS-LGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDI 1470
            KL  +L DS    N    L+   S  +    E  STL+   +A   +NK       +K+I
Sbjct: 1466 KLQEVLNDSDKKMNNLVHLVKQASAKETLQSEQISTLQLNLEASESRNKD------LKNI 1519

Query: 1471 LVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXX 1650
            +V N                 K+ I  +  +  + ++ L  Y + + E ++D+       
Sbjct: 1520 IVSN-----------------KKQIEDNMKYINDADTQLTEYSHALAEAEQDVRNMANII 1562

Query: 1651 XXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQH------KTELE-----ISGFN 1797
                         I    ++ + +++ I +   +L K         +ELE     +    
Sbjct: 1563 EKLKDSNSDKEKLIWDYETKKDEMEIKIQEGNFELKKSQDMIKLLSSELEHFKERLKAEQ 1622

Query: 1798 NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEI-------KSLKTTLFSQLSGMEQN 1956
            +K +++ EI +L      + EL L+ K+ET + KE+       + LK    S+L+ + Q 
Sbjct: 1623 DKTKEVDEIEKL------QEELMLHTKYETELKKEVSKLNYALEMLKNDSESKLNDLTQQ 1676

Query: 1957 N-----ISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 2121
            N     + Q+ + + +L +  N+ +++     +  +    + + ++LNE     ++++ +
Sbjct: 1677 NEHYVLMLQQLSNEKDLIVESNKEISMQLDNLKTDQKSLNENIDRLLNEK----SLLISE 1732

Query: 2122 IDIIRVDFQRF---YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDI 2292
             + +    Q+     +++ E  S++    N+L + LK    +    E L   ++   E  
Sbjct: 1733 TETLNSSLQKTREDLDSVMEERSELLNNKNHLGEALKLQQEQVRRNEDLIGKLE--LESA 1790

Query: 2293 EKKTSEFVENFKNTLNDHLEENKKLIMQN 2379
            E K+  + E  KN     +EEN+ ++  N
Sbjct: 1791 EFKSGYYEEKDKNI--SLIEENQSVLSSN 1817

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 87/461 (18%), Positives = 169/461 (36%), Gaps = 29/461 (6%)
 Frame = +1

Query: 1687 TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELD 1866
            ++   N   E+L    N+    L K  +++L+      K  K      L L  YK  +L 
Sbjct: 19   SLSEDNLMNEALASADNESYKDLPKDIQSKLK------KFDKYESKYPLLLTAYKNEKLK 72

Query: 1867 LNKKFE-----THISKEIKSLKTTL------FSQLSGMEQNNISQETNIQPNLDIIKNEV 2013
            +    +     T +S ++  ++ TL      +++ + M    I + +  +  L+    +V
Sbjct: 73   IESLLKILTEYTPVS-DLNDVEITLPNFFKDYNEKNNMLNEEIRRLSKFENELETSNEKV 131

Query: 2014 LTLMETMQEKAELMYK-----DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENL 2178
             TL  T+ EK E +       D +   + E     + +  ++D        F   I E  
Sbjct: 132  ATLEATVTEKHEKLNASNSKIDLLCAQIKEDESKISELQAQLDDNASKISGFETQIMEKD 191

Query: 2179 SDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEEN 2358
            S ISE    L+  LKN   K    E ++    +T  +    T+      KN   ++ ++N
Sbjct: 192  SMISE----LEDKLKNAIAKTEALEEISKSDPATVSN----TTTTSNKKKNKKKNNKKKN 243

Query: 2359 KKLIMQNLTNA-TSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIK 2535
                  N TNA T+   N   + ++     +E   +    C        N + T  S+++
Sbjct: 244  NNNHNNNATNADTNTTDNDMSEKYDKLIADFEKLTEEHANCSETQGSLQNQLNTKSSEVE 303

Query: 2536 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSIT 2715
               D   +  N+ +   K +++E   + +               + +     DN++N I+
Sbjct: 304  EVRDMLRDVGNELVEA-KDKIKEFNQSSNANDELISKNSNLENEITRIKEENDNVKNEIS 362

Query: 2716 STHSHITNIDDIYDTIENIMKNYGNKENAVKNE------MIDNILKEIPSLSKRVPLRLS 2877
            +      N+     T++    N      ++KN+       I  + KE   L   V    +
Sbjct: 363  AARQENENLKTEISTLKTDTDNLNGHIQSIKNDNNKLENEIQLVKKENSKLETEVKTSKN 422

Query: 2878 NTNGNSAQ------NILSPKKHAIDDENPSNEITDGEESRK 2982
             T+  S+Q       ++  +K  I  E    E  + +E  K
Sbjct: 423  ETDKLSSQLNQVKNKLIQKEKTVIYLEKQIKEYAENQEPVK 463

>TBLA0G03150 Chr7 (832779..834314) [1536 bp, 511 aa] {ON} Anc_3.149
            YOL069W
          Length = 511

 Score = 48.9 bits (115), Expect = 6e-05
 Identities = 69/284 (24%), Positives = 122/284 (42%), Gaps = 24/284 (8%)
 Frame = +1

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQL-ALQDYKRRELDLNKKFETHISKEIK 1908
            I+ L+A +D       +I  + N   +L E   L  L+     ELD NK  + +I+K  K
Sbjct: 157  ISDLQANIDTFILNVEKIQLYKNNQNELLEKANLNELEQASSNELDNNKNDDDNITKNNK 216

Query: 1909 SLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL--METMQEKAEL---MYKDCVK 2073
            +   + F     + +   S E NI   +++ K E + L  +  +QEK       YK   K
Sbjct: 217  ANTNSNFDIDVDLNKLIKSFELNISTFVELNKLEEINLKQLREVQEKVTTEYSKYKTEKK 276

Query: 2074 KILNESPKFFNVIVE----------KIDIIRVDFQRFYNNIAENLSDIS-EENNNLKQYL 2220
              LN+     N +++           ++I + D     NNI +  S +S + N+N K  L
Sbjct: 277  IFLNDLTNLSNYLIDLTSQRDKMAKNLNINKAD---LVNNIEDLNSQLSLKSNDNEKLIL 333

Query: 2221 KNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ---NLTNA 2391
            K + FK   Q  L   I   Y+ +     E   + +  L   L E K  + +    +  +
Sbjct: 334  KLNNFKTTIQ-TLQTFISELYDILGINFMELSNSHEKDL--RLTETKSQLQKRSNKIEES 390

Query: 2392 TSAVINQEMDLFEPKRVKWENSFDLINKCD----SMNNEFYNNM 2511
               VI++++++ E +  +  +   L+N+ +    S NNE  NN+
Sbjct: 391  FRIVIDKQLNILEEQVTEMRSDLRLLNEKNRLEKSKNNEITNNL 434

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 73/382 (19%), Positives = 139/382 (36%), Gaps = 1/382 (0%)
 Frame = +1

Query: 1084 ITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 1263
            I LYK +Q+EL   + +N ++ A S  ++ +   +    +    N              +
Sbjct: 174  IQLYKNNQNELLEKANLNELEQASSNELDNNKNDDDNITKNNKAN-------------TN 220

Query: 1264 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 1443
             +  I    +KL +  + ++    +   +  I+  ++   +   T EY+      K K +
Sbjct: 221  SNFDIDVDLNKLIKSFELNISTFVELNKLEEINLKQLREVQEKVTTEYS------KYKTE 274

Query: 1444 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 1623
                  K I + ++T  L+    DL S + K          KNLN +     N +++   
Sbjct: 275  ------KKIFLNDLT-NLSNYLIDLTSQRDKMA--------KNLNINKADLVNNIEDLNS 319

Query: 1624 DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNK 1803
             +                   TIQ+  + +  L   +     +L   H+ +L ++   ++
Sbjct: 320  QLSLKSNDNEKLILKLNNFKTTIQTLQTFISELYDILGINFMELSNSHEKDLRLTETKSQ 379

Query: 1804 LQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQ 1983
            LQK              R   + + F   I K++  L+  +    S +   N        
Sbjct: 380  LQK--------------RSNKIEESFRIVIDKQLNILEEQVTEMRSDLRLLNEKNRLEKS 425

Query: 1984 PNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNV-IVEKIDIIRVDFQRFYN 2160
             N +I  N    L    + +  L  ++    I NE   F    I+++ID I+ DF+    
Sbjct: 426  KNNEITNN----LNRKFKTEIHLEQQNLDNYITNEIENFKKKNIIDQIDKIKHDFEMESK 481

Query: 2161 NIAENLSDISEENNNLKQYLKN 2226
             I E  SD+    +N   YL N
Sbjct: 482  MIEERYSDLI---SNATIYLNN 500

>Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250W
            (REAL)
          Length = 1312

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 118/604 (19%), Positives = 228/604 (37%), Gaps = 29/604 (4%)
 Frame = +1

Query: 1087 TLYKKHQDELFRISKMNLVDLAGSENI----------NRSGALNQRAKEAGSINQSLLTL 1236
            +L +  Q    R+S  N  D+A + +           + S    Q AKE   I      +
Sbjct: 367  SLKEDFQQRFHRLSNENNTDMAQTNDEMSQFQTRISQDLSNTAEQFAKE---ILLKETNV 423

Query: 1237 GRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 1416
              ++ ++   S ++ + +   T+L++D+     +  L+   S       E  +   Y  K
Sbjct: 424  SELVKSITVDSQNLEYNKKDRTKLIRDTEELTEEVRLLKNSSTQDDLDHELENLNTYKGK 483

Query: 1417 AKNIKNKPQLGAFIMKDILVKNITM-----ELAKIKSDLLSTKSKEGIYMSQDHY-KNLN 1578
             +  +N+  +     K I  KN  M     ++ K +  ++ T  +  +Y       K+LN
Sbjct: 484  LQAWENENTIPKLTQK-IEEKNNEMIILENQIEKFQDRIMKTNQQADLYAKLGLIRKSLN 542

Query: 1579 SDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLD 1758
            +     +N +++ K D +                    Q  + +++  KL IN  K+   
Sbjct: 543  TKSGDLQNIIEKLKTDPKIRQIFPIMQD---------FQKSDLEIDFQKLFINMQKS--- 590

Query: 1759 KQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQL 1938
                    I+  N ++ +       AL +    E DL     +   K  + L   L    
Sbjct: 591  --------IAINNKEMHEFDRKYTNALYNLNTIEKDLRDSQHSQ-QKVTQILNENLPEDC 641

Query: 1939 SGMEQNNISQETNI--QPNLDIIKNEVLTLMETMQEKAELMYKD-----CVKKILNES-- 2091
            +  E N++ +ET +  +  L+ +K    TL E  ++  E+  +D     C +K  NES  
Sbjct: 642  TIDEYNDVLEETELSYKTALENLKMHQTTL-EFNRKALEIAERDSCCYLCSRKFENESFK 700

Query: 2092 PKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHI 2271
             K    +  K D        F   + E + +  E  ++L+  L+ H    N    L   I
Sbjct: 701  SKLLQELKTKTDA------NFEKTLKETVQNEKEYLDSLR-LLEKHIISLNS---LQQKI 750

Query: 2272 DSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV--INQEMDLFEPKRVK 2445
             +  E ++K   E       T  D LE     +  +   A S +  + ++ +  E +  +
Sbjct: 751  KNAQESLDKAKEE--TKASKTKLDSLETKSTTLKDDKEFAESEIRPLIEKFNYLEREIKE 808

Query: 2446 WENSFDLINKCDSMNNEFYNNMATT--LSQIKNTVDTSSNSMNKSISVMKGQVEESENAV 2619
             E+S   I+   S+ N   + + T   L   +  ++ S   + KSIS ++ + +E     
Sbjct: 809  LEHSSKTISDELSIYNTGEDGIQTVDELRDQQRKMNDSLRELRKSISDIQMEKDEKVREN 868

Query: 2620 SXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKEN 2799
            S               +      + NI+NSI    ++I  ID   + +E+ + +  NK N
Sbjct: 869  SRMINLIKEKELNVSEIESSLTRRQNIDNSIKLKKANIKEIDSRIEALESQIISLQNKRN 928

Query: 2800 AVKN 2811
              +N
Sbjct: 929  EAQN 932

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 48/292 (16%), Positives = 122/292 (41%), Gaps = 9/292 (3%)
 Frame = +1

Query: 1471 LVKNITMELAKIKSDLLSTKSKEG-IYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 1647
            L+K   + +++I+S L   ++ +  I + + + K ++S +E+ ++++   +         
Sbjct: 874  LIKEKELNVSEIESSLTRRQNIDNSIKLKKANIKEIDSRIEALESQIISLQN-------- 925

Query: 1648 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKL-TEI 1824
                             +N     L +T N+   Q++ + K   +++   ++ Q +  + 
Sbjct: 926  ----------------KRNEAQNFLDITKNERDLQINNKQKIVADVNRLIDRFQTIHNDA 969

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ------NNISQETNIQP 1986
            +    + +   +  + K+ E++   ++K LK  L S+L+ + +      ++ ++E N++ 
Sbjct: 970  VNFESRGFNELQTTV-KELESN-KVQMKELKEQLDSRLNELNEEKRKLADSSNEEKNLKQ 1027

Query: 1987 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 2166
            NL++I+ +                     ++ N   +   + V+  +  R  +Q     +
Sbjct: 1028 NLELIELK--------------------SQLHNIESEISELDVQNAEAERDKYQEESLRL 1067

Query: 2167 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKK-TSEFVE 2319
              N   +S EN      +K      N  + L H + + Y+D+EK    E+VE
Sbjct: 1068 RTNFEKLSSENAGKLGEMKQ---LQNQIDSLTHQLRTDYKDVEKSYHKEWVE 1116

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
            plaque spindle pole body (SPB) component, ortholog of
            human kendrin; involved in connecting nuclear
            microtubules to SPB; interacts with Tub4p-complex and
            calmodulin; phosphorylated by Mps1p in cell
            cycle-dependent manner
          Length = 944

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 95/509 (18%), Positives = 209/509 (41%), Gaps = 24/509 (4%)
 Frame = +1

Query: 1519 LSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS 1698
            L  K+K       D +     + E  + ++ E +R ++                   ++S
Sbjct: 207  LDAKNKIVNSRKVDDHSGCIEEREQMERKLAELERKLKTVKDQVLELENNSDVQSLKLRS 266

Query: 1699 QNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLT-EIMQLALQDYKRRELDLNK 1875
            +  ++++L   +N+LK+  +++  T+LE     N+L+K T E+ +L +   K  E+DL  
Sbjct: 267  KEDELKNLMNELNELKSNAEEKD-TQLEFK--KNELRKRTNELNELKI---KSDEMDLQL 320

Query: 1876 KFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELM 2055
            K + + SK +K     L ++ S     N SQ +  +  L ++KN++  L E +  K    
Sbjct: 321  KQKQNESKRLKDELNELETKFS----ENGSQSSAKENELKMLKNKIAELEEEISTKNS-- 374

Query: 2056 YKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFF 2235
                  +++ +  K  +++ +   +     QR  + +     ++ + N+ L++ ++    
Sbjct: 375  ------QLIAKEGKLASLMAQLTQLESKLNQRD-SQLGSREEELKKTNDKLQKDIRIA-- 425

Query: 2236 KNNHQELLNHHIDSTYEDIEKKTSEFVENF---------KNTLNDHLEENK----KLIMQ 2376
                +E ++   D    D++KK  +   +            T+ D+  E+K    K++  
Sbjct: 426  ---REETVSK--DERIIDLQKKVKQLENDLFVIKKTHSESKTITDNELESKDKLIKILEN 480

Query: 2377 NLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSS 2556
            +L  A       E +L E +   ++ S   +    +  NE  +N+A   SQ+KN ++ +S
Sbjct: 481  DLKVAQEKYSKMEKELKE-REFNYKISESKLEDEKTTLNEKISNLAAENSQLKNKIEDNS 539

Query: 2557 NSMN-------KSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNI-ENSI 2712
             + +       K +  ++  +EE + +                  +K   LK  I ENS 
Sbjct: 540  TATHHMKENYEKQLESLRKDIEEYKESAKDSE-------------DKIEELKIRIAENSA 586

Query: 2713 TSTHSHITNIDDIYDTIENIMKNYGNKENAVKN--EMIDNILKEIPSLSKRVPLRLSNTN 2886
              +     +I    + I ++ +N   +E+ + +   +ID   K+   L        SN  
Sbjct: 587  KVSEKRSKDIKQKDEQISDLTQNLKLQEDEISSLKSIIDRYKKDFNQLKS----EQSNIQ 642

Query: 2887 GNSAQNILSPKKHAIDDENPSNEITDGEE 2973
             +    IL+ +   I+ E+    + D ++
Sbjct: 643  HDLNLQILNLENKLIESEDELKSLRDSQK 671

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 85/402 (21%), Positives = 165/402 (41%), Gaps = 15/402 (3%)
 Frame = +1

Query: 1369 KVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIY 1548
            + TS    ++ E+ +    +K+  +L   +  + LV + ++ L+   S+    K +    
Sbjct: 5    ETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLVLSNSLNLSNNNSNNSINKKQLDFS 64

Query: 1549 MSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKL 1728
              +  ++ +NS  E  KNE+    ++                      Q  + ++E  K 
Sbjct: 65   ELEKRFEVINSINEQLKNELYTKNKE-----------------YFQIKQECDVKIEDYKS 107

Query: 1729 TINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIK 1908
             +N+LK +L K      EI    N  QK+  + + ++ +    +    K FE   + E K
Sbjct: 108  NLNELKHRLSK------EILQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLESK 161

Query: 1909 SLKTTLFSQLSGMEQN---NISQETNIQPN------LDI-IKNEVLTLMETMQEKAELMY 2058
             L+T  + Q++ M+     N    T I  N       D+ + N   +   +++   +L  
Sbjct: 162  FLET--YDQMNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNI 219

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFK 2238
            K  V K+         +  E + II++      N   +NL+  S  NN       N+ F+
Sbjct: 220  KKVVYKLQERLETVSTMNKELLKIIKLSENEEMNISLQNLN--SNNNNLYNDTHSNNDFE 277

Query: 2239 ---NNHQELLNHHIDSTYED--IEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
               NN  ++    I   YE   +EKK ++F+ + ++ L  +L+ N    ++N TN  + +
Sbjct: 278  FDINNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKL-PYLQNNS---VENETNNGNKI 333

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQ 2529
              Q++ + E   +K EN    I       N+F + + T L Q
Sbjct: 334  EEQKI-IHEHDSLKLENQSLKIKL-----NDFESTVKTLLQQ 369

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 69/331 (20%), Positives = 137/331 (41%), Gaps = 26/331 (7%)
 Frame = +1

Query: 1687 TIQSQNSQ----MESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR 1854
            +I+ QNSQ    +E    +I++ K ++    +  ++     N++    ++++  +     
Sbjct: 455  SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNS 514

Query: 1855 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNN-----ISQETN----IQPNLDIIKN 2007
               +LNK  E      +K+L+    +Q S +E+NN     IS  +N    ++   D++  
Sbjct: 515  TVTELNKSMEIKREPTLKNLELQKTNQ-SLLEKNNQLSIEISNASNENKILKEKFDLLIK 573

Query: 2008 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
                L E   E +       + K  NE+ K   ++  K      + ++ + +      ++
Sbjct: 574  SYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKC--KNLEKSFKDRESKFQEL 631

Query: 2188 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 2367
              ENNN+K  LK    + N           T++        F +N KN++  +   NK+L
Sbjct: 632  EIENNNVKDELKKVLSEYN-----------TFKSTRGTIDSFNQN-KNSIGINENTNKQL 679

Query: 2368 IMQNLTNATS-------AVINQEMD---LFE--PKRVKWENSFDLINKCDSMNNEFYNNM 2511
            + + L    S        +  QE D   L E    ++KW       +K D MN      M
Sbjct: 680  LKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQ-----DKIDEMN----TTM 730

Query: 2512 ATTLSQIKNTVDTSSNSMNKS-ISVMKGQVE 2601
               +S + ++ ++++   NK+ I  +K Q+E
Sbjct: 731  EVKISNLASSAESAAMLKNKNEIDELKKQIE 761

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 64/322 (19%), Positives = 126/322 (39%), Gaps = 45/322 (13%)
 Frame = +1

Query: 2158 NNIAENLSDISEEN------NNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVE 2319
            N+I +   D SE        N++ + LKN  +  N +          Y  I+++    +E
Sbjct: 54   NSINKKQLDFSELEKRFEVINSINEQLKNELYTKNKE----------YFQIKQECDVKIE 103

Query: 2320 NFKNTLNDHLEENKKLIMQNLTNATSAV------INQEMDL-------FEPKRVKWENSF 2460
            ++K+ LN+      K I+QN  N    +      IN+ ++        FE          
Sbjct: 104  DYKSNLNELKHRLSKEILQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLESKFL 163

Query: 2461 DLINKCDSMNNEFYNNM--ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA-VSXXX 2631
            +  ++ + M N+ Y N   AT +++ + + ++    ++ + +  +  +E +E   +    
Sbjct: 164  ETYDQMNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVV 223

Query: 2632 XXXXXXXXXXXXVNKHTI-----------------LKDNIENSITSTHSH------ITNI 2742
                        +NK  +                 L  N  N    THS+      I NI
Sbjct: 224  YKLQERLETVSTMNKELLKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDFEFDINNI 283

Query: 2743 DDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKK 2922
            DDI    E I + Y   E ++  +  ++ L +I S   ++P   +N+  N   N    ++
Sbjct: 284  DDI--KTELIKEKY---EKSLLEKKFNDFLFDIES---KLPYLQNNSVENETNNGNKIEE 335

Query: 2923 HAIDDENPSNEITDGEESRKIQ 2988
              I  E+ S ++ +  +S KI+
Sbjct: 336  QKIIHEHDSLKLEN--QSLKIK 355

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
            (REAL)
          Length = 1316

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 107/545 (19%), Positives = 214/545 (39%), Gaps = 62/545 (11%)
 Frame = +1

Query: 1390 CSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 1569
            C T E A K ++ KN     +F   D+  KN   EL  +K+     K K   + +++   
Sbjct: 449  CDTEELAEKIRSFKN-----SFTEDDL--KN---ELENLKT----YKEKLQTWENENIIP 494

Query: 1570 NLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMES------LKLT 1731
             LN  +E   NE+   +  IE                   I   N Q +       +K +
Sbjct: 495  KLNQQIEEKNNEMIILENQIEKFQDR--------------IMKTNQQADLYAKLGLIKKS 540

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLN-KKFETHISKEIK 1908
            +     +L K  +T L     N+K++++  IMQ   QD++  +L+++ +K   ++ K I 
Sbjct: 541  VGAKSDELQKIIQTLLN----NSKIRQIFPIMQDFKQDFQGSDLEMDFQKLFINMQKNIA 596

Query: 1909 SLKTTLFSQLSGMEQNNISQE-TNIQPNLDIIKNEVLTLMETMQEKAELMYK----DCV- 2070
                     ++  E + I ++ TN   N + I+ ++    ++ Q+  +L+ +    DC  
Sbjct: 597  ---------INNKEMHEIDRKYTNALYNFNTIEKDLQENQQSKQKVTQLLNENLPEDCTI 647

Query: 2071 ---KKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKN 2241
                 +L ES   +   +E + + +   +  +N  A  +++         +  +N  FK+
Sbjct: 648  DEYSDVLEESELSYKTALENLKMHQTTLE--FNRKALEIAERDSCCYLCSRKFENDSFKS 705

Query: 2242 NHQELLNHHIDSTYEDIEKKT----SEFVENFK----------------NTLNDHLEE-- 2355
               + L    D+ +E   K T     E++++ +                N   +HLE+  
Sbjct: 706  KLLQELKIKTDANFEKSLKDTVQNEKEYLDSLRLLDKHIISLSSINEKINNSREHLEKAN 765

Query: 2356 ----NKKLIMQNLTNATSAVINQ----EMDL--------FEPKRVKWENSFDLINKCDSM 2487
                + KL +  L   ++ + N     E D+        +  K +K     DL N   S+
Sbjct: 766  EETKSSKLKLYELETKSTTLRNDKEFAESDIRPLIERFTYVEKEIK-----DLENNSKSI 820

Query: 2488 NNEF--YNNMATTLSQI------KNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXX 2643
            ++E   Y+     +  +      +  ++ S   + K I  ++ + +E     S       
Sbjct: 821  SDELSIYSTSGDGIQTVDELRDQQRKMNDSLRQLRKHILGIQMEKDEKVKESSRIISLTK 880

Query: 2644 XXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMID 2823
                    +      K NI+NSI S   +I +ID   + +E+ + +  NK +  KN ++D
Sbjct: 881  EKELKVSEIESSLTQKQNIDNSIKSKEVNIKDIDSRVEALESRIVSLQNKRDESKN-VLD 939

Query: 2824 NILKE 2838
             +  E
Sbjct: 940  QLKNE 944

 Score = 38.1 bits (87), Expect = 0.15
 Identities = 54/281 (19%), Positives = 120/281 (42%), Gaps = 3/281 (1%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            ++    + +++KL I+QL+ ++D+ HK   E+S    +L ++T            +    
Sbjct: 212  LKLDKDRSKAMKLNIHQLQTKIDQYHK---EVSQIEFQLSEIT--------GQSDKLFKS 260

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAE 2049
            N+ F+  +SK +++LK    S       + + + +N    +D+ K ++  L++       
Sbjct: 261  NQDFQKILSK-VENLKNAKIS-----ISDQVKRLSNSIDIIDLSKPDLQNLLD------- 307

Query: 2050 LMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNL-KQYLKN 2226
                            F  V+++K + ++ D +   +N+ +  S +   +N+L ++  + 
Sbjct: 308  ---------------NFSKVLMDKNNQLK-DLEASTSNLKDRQSSLQNRSNSLIRRQGEL 351

Query: 2227 HFFKNNHQELLNH--HIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 2400
               K  +++ LNH   +   ++   +  S+   N    +N  + + K  I  +LTN T+ 
Sbjct: 352  EAGKETYEKNLNHLSSLKEAFQHRFQDLSDIKNNDMAQINHKMSQFKAFISHDLTN-TAK 410

Query: 2401 VINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTL 2523
               +E+ L E    +   S  +    DS N E+     T L
Sbjct: 411  KFEEEIQLKETSLSELVKSITV----DSQNLEYNKKDRTKL 447

 Score = 37.0 bits (84), Expect = 0.35
 Identities = 60/280 (21%), Positives = 113/280 (40%), Gaps = 20/280 (7%)
 Frame = +1

Query: 1540 GIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMES 1719
            GI M +D     +S + S   E +    +IE                   I+  +S++E+
Sbjct: 860  GIQMEKDEKVKESSRIISLTKEKELKVSEIESSLTQKQNIDNSIKSKEVNIKDIDSRVEA 919

Query: 1720 LKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETH--I 1893
            L+  I  L+ + D+            N L +L     L +   ++   D+N+  + +  I
Sbjct: 920  LESRIVSLQNKRDES----------KNVLDQLKNERDLQISSKQKNVADVNRLIDRYQTI 969

Query: 1894 SKEIKSLKTTLFSQLSGMEQ---NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 2064
             KE+   ++  F++L    +   +N  Q   ++  LD+  NEV       +EK +L   +
Sbjct: 970  YKEVIDFESKGFNELQTTVKELGSNKVQMQELKEQLDVKMNEV------NEEKRKLADSN 1023

Query: 2065 CVKKILNES-------PKFFNVIVE--KIDIIRVD-----FQRFYNNIAENLSDISEENN 2202
              +K L ++        +F N+  E  ++D+   +     +Q     +  N   +S EN 
Sbjct: 1024 NEEKNLRQNLELIGLKSQFQNIESEINRLDVQNAEAERDKYQEESLRLRTNFEKLSSENA 1083

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKK-TSEFVE 2319
                 +K      N  + L H + + Y+DIEK    E+VE
Sbjct: 1084 GKLGEMKQ---LQNQIDSLTHQLRTDYKDIEKNYHKEWVE 1120

>NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa] {ON}
            Anc_5.267
          Length = 1876

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 84/466 (18%), Positives = 187/466 (40%), Gaps = 48/466 (10%)
 Frame = +1

Query: 1495 LAKIKSDLLSTKSKEGIYMSQ-----------DHYKNLNSD-LESYKNEVQECKRDIEXX 1638
            ++++K D++   +KE + + Q           +H K+L +  ++  K + Q C  D+E  
Sbjct: 1385 ISRLKHDIIQHGNKERLLIEQLDHLQTELQSSEHQKDLYATTMKQQKEQYQNCLEDLE-- 1442

Query: 1639 XXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF--NNKLQK 1812
                               +  +Q+    L + Q +  +         +SG   N KLQ 
Sbjct: 1443 -------------------TNENQLSEYSLALKQAEDNIQS-------MSGIIENQKLQN 1476

Query: 1813 LTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ------------- 1953
              +  Q+  ++ ++ ELD+  + ++   K+I+ L   L S ++ +++             
Sbjct: 1477 KQKDKQIWEKEIEKNELDMELQEKSIELKKIQDLNQMLVSDIAHLKERLATVQDNSKYIN 1536

Query: 1954 --NNISQETNIQPNLD-IIKNEVLTL---METMQEKAELMYKDCVKKILNESPKFFNVIV 2115
              N++ +E N     +  +K EV TL   ++++  ++E    + +K++ + S    NV+ 
Sbjct: 1537 EINDLKEELNRNLQSETALKKEVSTLNYELKSLSNESEGKISELLKQVEHYS-NLANVLS 1595

Query: 2116 EKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 2295
             + DI     +       E L+ +     N++          +  E L   I  T +D E
Sbjct: 1596 NERDISDASQKELSKRHDELLAKVQTLTANIESLTNEKTQLISQVEQLRTSIGKTTDDFE 1655

Query: 2296 KKTSE------FVENFKNTLNDHLEENKK--LIMQNLTNATSAVINQEMDLFEPKRVK-W 2448
            K  +E       ++  + TL    E+N +   +M+ L N  + V+  E+D  +   +  +
Sbjct: 1656 KSLNEKDSISIRIKYLEETLELQREQNSRNGELMKKLQN-DAEVLKSELDGEKKNNISLY 1714

Query: 2449 ENSFDLINKCDSMNNEFYNNMATTLSQIK------NTVDTSSNSMNKSISVMKGQVEESE 2610
            E +  LIN  +S  N+   N+   LS  K      + +      + K  ++   +V++++
Sbjct: 1715 EENQTLIN-VNSQLNKKMGNLEEKLSDPKEKDAWLSKIHELEELVKKETNLKYEEVKKTK 1773

Query: 2611 NAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDD 2748
            N                  +N     +  +E +  + ++HI  +++
Sbjct: 1774 NLERVINELTERNGKQTDIINLANRERQGMEKTAMNYNNHINELEE 1819

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 75/391 (19%), Positives = 158/391 (40%), Gaps = 5/391 (1%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            I S ++Q + L   IN+    + + ++T+ E+S    + QKL E M++ L+ +     +L
Sbjct: 1071 IISVSNQRDEL---INEQNNAVSELNRTKKELSSIKLEYQKLEEEMKI-LKSHSEETQNL 1126

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNL-DIIKNEVLTLMETMQEKA 2046
             K  +   S+ +++L+  L  ++S  E  +    +N+Q  +   +K  +    +  +++ 
Sbjct: 1127 QKGQQEDTSR-VRNLEKRLSEEISLNEYLSRKLSSNLQEEMHPSLKGNIFFSEDVSKDQL 1185

Query: 2047 ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN 2226
               + D   K+ + +    + I EK D+I    +     +A +  D       LK+ LK 
Sbjct: 1186 IAYFNDMKLKLDDATKDLEHQIEEKKDLI-AKLRFTETRLASSSFDSQMRRAQLKK-LKE 1243

Query: 2227 HFFKNNHQELLNHHIDSTYED---IEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATS 2397
               K N    L   +++  ++   +EK   E VE  K  L   LE       +N+ +A  
Sbjct: 1244 IVEKTNPSLDLARELENVTDEGVNVEKLILE-VEYLKRQL--ELETKAHYDAENVASAL- 1299

Query: 2398 AVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD-TSSNSMNKS 2574
                                F  I + DS ++ F      +  ++K       S  +   
Sbjct: 1300 -----------------HEKFTRIQRVDSSSDIFKLKYEASEERVKGLEQKLKSTPLKDR 1342

Query: 2575 ISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIY 2754
             ++  G + ++  ++S               V  H +    ++ ++   H+ I+ +   +
Sbjct: 1343 TNIPVGDIFKNRESIS----------KYEEDVKFHKLENYKLQENLVDCHNTISRLK--H 1390

Query: 2755 DTIENIMKNYGNKENAVKNEMIDNILKEIPS 2847
            D I+     +GNKE  +  E +D++  E+ S
Sbjct: 1391 DIIQ-----HGNKERLL-IEQLDHLQTELQS 1415

>TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1303

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 85/375 (22%), Positives = 154/375 (41%), Gaps = 6/375 (1%)
 Frame = +1

Query: 1513 DLLSTKSKEGIYMSQDHYKNLNSDLESYKNE---VQECKRDIEXXXXXXXXXXXXXXXXX 1683
            DL+ T   E  Y+  D  + L  D+ S  NE   V + K D E                 
Sbjct: 709  DLVETMKHEKEYL--DSLRKLEKDVNSLFNERELVNKLKTDFESNKTKSDKLRAEVKIQD 766

Query: 1684 XTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRREL 1863
              I+S   ++E++  TI  L   +++    + EIS  NN LQ +T+ ++L          
Sbjct: 767  AHIKSLKEKLETVTSTIRPL---IEENFHLQKEISSLNNDLQNITDELKL---------- 813

Query: 1864 DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQE- 2040
              N   +  ++ E    K TL +Q    ++  IS    +Q   +    E  TL   +++ 
Sbjct: 814  -YNISSDGLLTLEELQSKQTLCNQTLREKRKKISL---LQDGRESRAKEKATLSGIIKDR 869

Query: 2041 --KAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
              K E M  D +KK   E+ +  N+ +E++  I V    F  ++    + I+E N N+ +
Sbjct: 870  SLKVEKMKNDLLKKESLENER--NLKLEEVSNIEVRLNSFEKDVKLLQNKITEINANITK 927

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 2394
                H      +  LN       ++I +  S+ ++ FK TL + ++E      +   NA 
Sbjct: 928  LKDQH-----DKAALNK------KEIIEGLSKTMDQFK-TLQNSIKE-----FELTGNAD 970

Query: 2395 SAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS 2574
                N+E+   E  + K +N    I++  +  ++    +  + S+ KN +D   N    S
Sbjct: 971  LKACNEEL---EDYKSKLKNINVAIDQKTANLSKLKEELIDSNSRKKNLMD---NLELHS 1024

Query: 2575 ISVMKGQVEESENAV 2619
            + V     E+  N +
Sbjct: 1025 LKVKLSNTEKEINCI 1039

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 95/437 (21%), Positives = 176/437 (40%), Gaps = 23/437 (5%)
 Frame = +1

Query: 1720 LKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISK 1899
            LK ++  LK   D+   T+  I     KLQ   E  +  +++ + + +D+ K+     S 
Sbjct: 205  LKQSVEHLKVDKDRSKATKFNIE----KLQHKCEQFKKTVKEIESQLVDITKQ-----SD 255

Query: 1900 EIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKI 2079
            E+          L+ +E        N++ N + I +++  L ET+      +    V++I
Sbjct: 256  EVFKTNQDFQKVLAHLE--------NLKRNREYISHQINRLSETIN-----VISLPVEEI 302

Query: 2080 LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQY---LKNHF--FKNN 2244
                  F      K D I+   +   + + +N++ I E++N L +    LK+++  + NN
Sbjct: 303  EQNLVIFDRDTATKDDQIK-QLENDISELKQNVNQIQEQSNILLEKQGKLKSYYDIYINN 361

Query: 2245 HQELLN--HHIDSTYEDIEKKTSEFVENFKNTLNDHLE-ENKKLIMQNLTNATSAVINQE 2415
               L N   ++   Y +I K+ S+  E F+  LNDHL+ EN  L+  N T       + E
Sbjct: 362  LSSLKNLKENVSRQY-NINKEFSD--ETFQTALNDHLDKENNHLLQLNNT------FSNE 412

Query: 2416 MDLFEPKRVKWENSFDLI--------NKCDSMN-NEFYNNMATTLSQIKNT---VDTSSN 2559
            ++    K+   +  +DL+        NK D +  +E  +N+ T L +I  T   ++    
Sbjct: 413  LEGLNSKKSTLD--YDLVVQLQQQEYNKKDKIKASEKLDNIHTELIKITCTEEELNVEKE 470

Query: 2560 SMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITN 2739
            ++ K I  +K         ++                N H +L   +E  +  T   IT 
Sbjct: 471  NLTKYIDKLK---------IADGNDTATDVNLEIKKENDHMLL---LEKELEETQEMITK 518

Query: 2740 ID---DIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNIL 2910
             +   D+Y  +  I K+   K+      +  NIL   P +     +   N          
Sbjct: 519  ANKQSDLYAKLALIKKSSSEKQMLFDKNL--NILSMNPVILSEPIIIDENIEITFNTFFK 576

Query: 2911 SPKKHAIDDENPSNEIT 2961
            + +K+  DD N    IT
Sbjct: 577  NLQKNLEDDNNKLQSIT 593

 Score = 39.3 bits (90), Expect = 0.068
 Identities = 94/497 (18%), Positives = 188/497 (37%), Gaps = 46/497 (9%)
 Frame = +1

Query: 1000 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLY------KKHQDELFRISK---------- 1131
            L  R      + S  +N+  ++++  F + L       K++ D L ++ K          
Sbjct: 680  LCSREFDSTGLKSKLLNELKAKTNQQFELDLVETMKHEKEYLDSLRKLEKDVNSLFNERE 739

Query: 1132 -MNLVDLAGSENINRSGALNQRAK----EAGSINQSLLTLGRVINALADKSGHIPFRESK 1296
             +N +      N  +S  L    K       S+ + L T+   I  L +++ H+    S 
Sbjct: 740  LVNKLKTDFESNKTKSDKLRAEVKIQDAHIKSLKEKLETVTSTIRPLIEENFHLQKEISS 799

Query: 1297 LTRLLQDSLGGNTKTALIAT---ISPAKVTSEETCSTLEYASKAKNI-----------KN 1434
            L   LQ+ +    K   I++   ++  ++ S++T        K K I           K 
Sbjct: 800  LNNDLQN-ITDELKLYNISSDGLLTLEELQSKQTLCNQTLREKRKKISLLQDGRESRAKE 858

Query: 1435 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIY-MSQDHYKNLNSDLESYKNEVQ 1611
            K  L        ++K+ ++++ K+K+DLL  +S E    +  +   N+   L S++ +V+
Sbjct: 859  KATLSG------IIKDRSLKVEKMKNDLLKKESLENERNLKLEEVSNIEVRLNSFEKDVK 912

Query: 1612 ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 1791
              +  I                              +   I +LK Q DK        + 
Sbjct: 913  LLQNKIT----------------------------EINANITKLKDQHDK--------AA 936

Query: 1792 FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 1971
             N K  ++ E +   +  +K  +  + K+FE   + ++K+    L    S ++  N++ +
Sbjct: 937  LNKK--EIIEGLSKTMDQFKTLQNSI-KEFELTGNADLKACNEELEDYKSKLKNINVAID 993

Query: 1972 TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVI-VEKIDIIRVDFQ 2148
                 NL  +K E++      +   + +    +K  L+ + K  N I VE  +  R  +Q
Sbjct: 994  QKTA-NLSKLKEELIDSNSRKKNLMDNLELHSLKVKLSNTEKEINCIDVENAERQRDKYQ 1052

Query: 2149 RFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKK--------- 2301
               + +      +S +N      +K      N  + L+H + + Y+DI+ K         
Sbjct: 1053 EEISRLRNLYEQLSADNAGKLGEIKQ---LQNQIDSLSHQLHTDYKDIDNKYKTEWAKLQ 1109

Query: 2302 TSEFVENFKNTLNDHLE 2352
            T  FV    NT +  L+
Sbjct: 1110 TKTFVTEDINTYSKALD 1126

>Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON}
            similar to Ashbya gossypii ACR068W
          Length = 1854

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 89/422 (21%), Positives = 173/422 (40%), Gaps = 46/422 (10%)
 Frame = +1

Query: 1492 ELAKIKSDLLSTKSKEGIYMS-----QDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXX 1656
            + ++++ DLLST+ ++ +  S     Q+ Y+N  +DL + + ++    RD+         
Sbjct: 1384 QCSQLEQDLLSTEKQKQLLQSSVKHHQNQYENCINDLHATEAQM----RDLVHSLKQSEE 1439

Query: 1657 XXXXXXXXXXTIQSQNSQME----SLKLTINQLKAQLDKQHKTELEISGFNNKLQ----- 1809
                       ++SQN Q E     L+  +  L+ QL +++    +++  N  L      
Sbjct: 1440 DIQTMTDLIQKLRSQNKQKEVLIWDLEKALGHLEGQLGERNIELQKLNSLNQVLSDDLNH 1499

Query: 1810 -----KLTEIMQLALQDYKR--RELDLNKKFETHISKEIKSL-------KTTLFSQLSGM 1947
                 K+TE     L +  R   ELD + + ET + KEI +L       +    S++  +
Sbjct: 1500 FKDRIKVTEDNSKYLAEIGRLKTELDASLRTETELKKEISNLTYHRNAFQADSESKIVNL 1559

Query: 1948 EQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELM------YKDCVKKILNESPKF--- 2100
             Q N   E  +Q +L   K+    +   +Q K + +        D +  +  E  K    
Sbjct: 1560 VQQNSHYEKFLQ-DLGAQKDASEQVQNALQAKVKSLGLKVDRLNDDLNVLTQEKEKLEQE 1618

Query: 2101 FNVIVEKIDIIRVDFQRFYN---NIAENLSDISEE-NNNLKQYLKNHFFKNNHQELLNHH 2268
             N +  K+    VDF++  N   NI   L  + E      +Q  +N  F    QE +   
Sbjct: 1619 RNYLKAKLQDSNVDFEKSVNDRDNIFNELEFLRESLALQQQQTERNEAFVEKLQEEIQLA 1678

Query: 2269 IDSTYEDIEKKTSEFVENFK-NTLNDHLEENKKLIMQNL--TNATSAVINQEMDLFEPKR 2439
             D+  ++ EK    F EN      N  L ++ + +  +L  T+  +A +++  +L    +
Sbjct: 1679 KDAFTQEKEKNIELFEENQSLGKSNLQLRQHVEKLEHDLSDTSEKNAWVDRIHELESKLK 1738

Query: 2440 VKWENSFDLINKCDSMNN--EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESEN 2613
             + E  F+ + K  ++    E  N+ A   ++  +       S+ K +  + G+VE  E 
Sbjct: 1739 EESELKFEEMKKSQTLYRTLEELNSAADNQNKAISIAAKDRESVEKQLFEVGGRVEGMEK 1798

Query: 2614 AV 2619
             +
Sbjct: 1799 HI 1800

>TBLA0I01170 Chr9 (245439..252158) [6720 bp, 2239 aa] {ON} 
          Length = 2239

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 61/298 (20%), Positives = 126/298 (42%), Gaps = 24/298 (8%)
 Frame = +1

Query: 1741 LKAQLDKQHKTELEISGFN----NKLQKLTEIMQLALQDYKRRELDLNKKFETHI----S 1896
            + A + + +  E   S FN    N + K+++   L +   KR+    N    T+      
Sbjct: 1833 ITADIAEANSDEYGTSMFNTSDLNLINKVSQTEPLEISSPKRKITTNNDHPATNSLNIKH 1892

Query: 1897 KEIKSLKTTLFSQLSGMEQ------NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMY 2058
            KE+++  T+L      +E+      N +  +T++  N D++ N  L + E + ++++ M 
Sbjct: 1893 KELQASMTSLDKLKKSIEKARMVASNGVDADTSVYSNDDLLVNSSL-VREDLPQRSKTMN 1951

Query: 2059 KDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISE------ENNNLKQYL 2220
                 K     PKF +  +  ID+  ++  R +     ++   +       + N ++ Y 
Sbjct: 1952 SVTRSKKEKLKPKFKSKSISDIDVKEINNMRHFTPPPRSMQRPTSGVVSMRDVNEMETY- 2010

Query: 2221 KNHFFKNNHQELLNHHIDSTYEDIEK----KTSEFVENFKNTLNDHLEENKKLIMQNLTN 2388
             N  + N +Q+ +N + D++ E +E+    KT    + FK  +N+              N
Sbjct: 2011 -NEMYPNYNQDNMNINTDNSDEVMEQPKSGKTKNIFKPFKTMVNN-------------MN 2056

Query: 2389 ATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS 2562
            A  A   +    ++ +   ++N   + +  + M NEF N+ A T S  +   +  SNS
Sbjct: 2057 ANIAAAQERNRQYQYEDEYYDNRNYVYDDDEIMGNEFQNDNAETSSFERMNKNIDSNS 2114

>Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)
          Length = 690

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 81/389 (20%), Positives = 163/389 (41%), Gaps = 16/389 (4%)
 Frame = +1

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS 1911
            I+ L+ Q D  ++   E+   + K++   E  +    D  + E  +N   +   S+E  S
Sbjct: 318  ISNLQNQNDTLYEKYQEVLKISQKIKTTREKWKALKSDSNKYENYVNAMKQK--SQEWPS 375

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL--METMQEKAELMYKDCVKKILN 2085
                + S+ S  E++  + +TNI     I++ + ++    E    + E + K+ + KI  
Sbjct: 376  KLEKMKSECSVKEEDIKALQTNIDELHKILRKKGISTEKFELENHEREKLTKE-LDKINL 434

Query: 2086 ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLS--DISEEN-----NNLKQYLKNHFFKNN 2244
            +S K  + I  +    +++ +  + ++ + L   D+S +N     N L   + + F K N
Sbjct: 435  QSDKLTSSIKSR----KLEAEGIFKSLLDTLRQYDLSIQNLIRSRNQLGHNVNDSFLKIN 490

Query: 2245 HQE-LLNHHIDST--YEDIEKKTS---EFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 2406
              E LL+  + S+  Y+ +    S   E ++NF   LND ++E  K I ++       + 
Sbjct: 491  IPENLLDRELHSSISYQQLFPNGSGINESIKNFILKLNDEIQERIKTIEKDNVTLEKDIK 550

Query: 2407 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 2586
            N + D+ E  +V      +L             +    ++Q +  ++     +N S  +M
Sbjct: 551  NLKHDINEKTQVNERLELELSEANSKFELSKQEDERLLVAQ-RIEIEKMEKKINDSNLLM 609

Query: 2587 KGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 2766
            K +V ++E  V+                 K   LK N+       H  + ++ D+    +
Sbjct: 610  KTKVSDAEEMVTSTEL-------------KLEELKVNLNRKRYKLHQRVIHVIDVTSKFK 656

Query: 2767 -NIMKNYGNKENAVKNEMIDNILKEIPSL 2850
             NI  +  N EN      + NI+KE+ +L
Sbjct: 657  INIQSSLENSEND-----LGNIIKELQNL 680

>KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly
            similar to uniprot|P31111 Saccharomyces cerevisiae
            YDR285W ZIP1 Synaptonemal complex (SC) protein that
            connects homologous chromosomes partially during zygotene
            and entirely during pachytene potential Cdc28p substrate
            synaptonemal complex protein
          Length = 755

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 118/616 (19%), Positives = 241/616 (39%), Gaps = 34/616 (5%)
 Frame = +1

Query: 1252 ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 1431
            AL      +  ++ K +  + DS   N  T+    +  A   ++  CS L+   + +  K
Sbjct: 94   ALQQPDDVVSEKDEKESHSINDSSTINDNTSSNDVLLEAFTNTQRICSNLKIELQKQQQK 153

Query: 1432 N----------KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ--DHYKNL 1575
            N          K ++ A   K  + KN+   L      L  +KS+    +++  D YK L
Sbjct: 154  NLQQKELIDQYKAEILAVTEKIHVHKNLLSLLEDQIKGLKHSKSENDSLIAELGDSYKLL 213

Query: 1576 NSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL 1755
            N  ++S   E +  K                      T+Q Q S  +SL+  + Q   +L
Sbjct: 214  NEKVKSSIAESEALK---------------------ITLQQQKSLQKSLESALQQKNKEL 252

Query: 1756 DKQHKTELEISG-FNNKLQKLTEIMQLALQDYKRRELDLNK---KFETHISKEIKSLKTT 1923
            D + K   E SG  + +  K TE++Q      K    ++ +   K E   +  + +L+  
Sbjct: 253  DYKKKELDECSGQLSEEKIKYTELLQQLSTSKKEITAEIQECFNKVEATSNTRVDTLQNY 312

Query: 1924 LFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAEL-MYKDCVKKILNESPKF 2100
            + S+L  + +N      +I   L +  N+     +T +  +EL + KD V      + + 
Sbjct: 313  VNSRLQAICENIKEANVDIAKGLGMDLNQ-----KTEKLISELGVVKDSVSTAATSTTE- 366

Query: 2101 FNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDST 2280
              +I+ +++ + V       NI   L +++  N  L        F ++   LL   +  +
Sbjct: 367  --IIMHEVNKLYVTLPHI-ENIVSELKEMTANNGTLTMEFITSAFLSSVDTLLK-TLQVS 422

Query: 2281 YEDIEKKTSEF---------VENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
             E ++K               E F+N +N   EE    ++Q  T   S + +++ ++ E 
Sbjct: 423  MESLQKLPDAICTLDNKITSAEGFENEINALKEEVHTTMLQK-TETVSMLRSKDHEIEEL 481

Query: 2434 KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESEN 2613
                     +L++K   +  E  ++    L    +++  S+ +  + I+ +K   +E+E 
Sbjct: 482  NN-------NLLSKIKEL--EELSDKNAILQTEFSSITVSNEAYVREITRIK---KENEE 529

Query: 2614 AVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNK 2793
            A++               + K     ++ +  I S     T   D  ++I++  +N   +
Sbjct: 530  AITSLDSKLTAQTEISSILQKD---MNDTKKEIDSLKKKHTQALDENNSIKHKYENLQQQ 586

Query: 2794 ENAVKNEMIDNILKEIPSLSKRVPLR--------LSNTNGNSAQNILSPKKHAIDDENPS 2949
             + +  E++ +  KE+        LR         SN   NS + + + K HA++ E  +
Sbjct: 587  FHKINVELVQSKAKELEFGEINRNLREQFEELESASNHTSNSFKRV-NDKVHALEKEKSA 645

Query: 2950 NEITDGEESRKIQKTE 2997
              +   +   KI++ E
Sbjct: 646  LNLEKLDLMDKIEELE 661

>Smik_4.410 Chr4 complement(744262..747228) [2967 bp, 988 aa] {ON}
            YDR166C (REAL)
          Length = 988

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 61/270 (22%), Positives = 113/270 (41%), Gaps = 3/270 (1%)
 Frame = +1

Query: 2026 ETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENL-SDISEENN 2202
            + M ++ + +  D  +     + K FNV     D+ + D     NN  + L SDI +++ 
Sbjct: 86   QEMSKELQNLPNDSTRLKYLVNSKQFNVKAFLRDMHKQDSFNDLNNSLDKLDSDIQDQSK 145

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNL 2382
            NLKQ +  +F K      + + +D  Y++ ++KT+E  E      N    E+       L
Sbjct: 146  NLKQLVGKNFTK---YVKIKNKLDQIYKEFDEKTNEKDEANSPKENQINVESLNRKADEL 202

Query: 2383 TNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQ--IKNTVDTSS 2556
              AT+  +   MD ++ K + ++ +   I +     N+FY N+  +L      N  +   
Sbjct: 203  IRATTFKLKPLMDNYQ-KILNYQATKKFIEQ-----NKFYFNLPKSLKNCLTNNDFNEFM 256

Query: 2557 NSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHIT 2736
               +K + V  G  + S+ + S                   TI K+ I NS+ +++    
Sbjct: 257  IQYSKGLVVRHGFSQSSDTSQSLIIKRIWSQVESIL-----TIYKNLIWNSLINSN---F 308

Query: 2737 NIDDIYDTIENIMKNYGNKENAVKNEMIDN 2826
            N+D   +TI ++     N EN + N    N
Sbjct: 309  NVDQPQETILSLFSKLLNLENFINNNQNKN 338

>KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1.110
            YNL250W
          Length = 1306

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 87/416 (20%), Positives = 171/416 (41%), Gaps = 49/416 (11%)
 Frame = +1

Query: 1474 VKNITMELAKIKSDLLS-TKSKEGIYMSQDHYKNLNSDLESYK-------NEVQECKRDI 1629
            ++    ++  I+S +L  T   + ++ S   ++ + S +E+ K       NE++     I
Sbjct: 233  IEQFRQQVKNIESQILDITGQSDRLFKSNQTFQEVLSKVENLKTLKLATSNEIERLSATI 292

Query: 1630 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQH-------KTELEIS 1788
            E                  T+Q Q S+++  +  INQLK QL   +       + E E++
Sbjct: 293  ELLDLPKDELSSLLDNFSLTLQQQESKLDQTQYEINQLKNQLQNAYIEKDDLIRKEAELT 352

Query: 1789 GFNNKLQKLTEIMQLALQDYKRR-ELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS 1965
               +  ++L       ++++K++  LDL+  + T   + ++  K TL S    ++    S
Sbjct: 353  SKRHDYEQLKHDRLTLIEEFKQKFPLDLSSDYPTECLRLLRDYKKTLESDAQMVKAEGES 412

Query: 1966 QETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDI-IRVD 2142
            +   I+ ++                 AE +Y++ V     ++ K    I +K D+  R+D
Sbjct: 413  KLAKIENHV-----------------AEQVYEETV-----QNQKLEYCIRDKTDLKKRID 450

Query: 2143 F----QRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQE-------LLNHHIDSTYED 2289
            +     +  +   E L D  +    L   L N F K N  E       L N  I S  E+
Sbjct: 451  WLETELKSSDVSEETLEDEKKALTELNGQLAN-FEKGNASEEVIKLLKLKNMDILSAEEE 509

Query: 2290 IEK------KTSE-------------FVENFKNTLNDHLEE--NKKLIMQNLTNATSAVI 2406
            +EK      KT++              +E  K T+ D LEE   K  I Q L    +   
Sbjct: 510  LEKIQEQILKTNQQTDLFAKLGLIKKSIEEKKGTVTD-LEETLQKNDISQILPTPLN--- 565

Query: 2407 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS 2574
            N+++DL      +++  +  + K  +++N   ++    LS+I   +D+S+  + ++
Sbjct: 566  NEDLDL------EFKKFYISLQKDIALSNIVLHDKENKLSEITFRLDSSNADIERN 615

 Score = 35.8 bits (81), Expect = 0.78
 Identities = 58/320 (18%), Positives = 128/320 (40%), Gaps = 21/320 (6%)
 Frame = +1

Query: 1717 SLKLTINQLKAQLDKQHKTELEISGFNN---KLQKLTEIMQLALQDYKRRELDL------ 1869
            +L   +N+ K  L      E +I    N   +++KL E+    ++++   +  L      
Sbjct: 711  TLVTAVNEEKEFLHNLRTMEKDIISLRNIKEQVKKLEELKPCLVEEHTSTKASLEEIENS 770

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGMEQNNI--SQETNIQPNLDIIKNEVLTLMETMQEK 2043
            N+K +       K+L+ T+   +   ++ N+  ++   +   L++  N   TL    + +
Sbjct: 771  NRKLKEKREVCEKTLRRTIEQIVDNSKELNLLEAEFKGLSKQLEMYNNSSGTLQTVDELR 830

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNL---KQ 2214
            AE   K+    +L +  K  N + E+ +    +     N + E    I E  +++   K 
Sbjct: 831  AEQKQKN---DLLRKLRKDINDLQEERERKTKEHNSLINMVKEKTLSIREMESSVASEKN 887

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ----NL 2382
              + +  K      + HHI S   +IEK   E  +  K +  +  +   KL+ +    ++
Sbjct: 888  IQREYSAKKTELNDIEHHIQSIKSEIEKTKGE--KEKKQSQYNRQKLGLKLLTEKSQTDI 945

Query: 2383 TNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS 2562
             N T A  ++   + +  R   +  F+ + KC             T+ Q  +T+      
Sbjct: 946  INITKA-CDKLGGILDKVRQYEQQDFNALEKCQD-----------TIKQADSTLKNIEKQ 993

Query: 2563 MNKSISVM---KGQVEESEN 2613
            +N+    +   + ++++S N
Sbjct: 994  LNEKTEYLYMGRQKLQDSNN 1013

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 115/571 (20%), Positives = 219/571 (38%), Gaps = 70/571 (12%)
 Frame = +1

Query: 1033 ASTKMNDFSSRSHTIFTITLYKKHQDEL-FRISKMNLVDLAGSENINRSGALNQRAKEAG 1209
            + T++N  S+ +     +T Y    ++L   I+K+N    A +E       L    KE  
Sbjct: 897  SDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTL---IKERD 953

Query: 1210 SINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVT--SE 1383
            S+ Q L    + I +LA ++  +    S +  +  D+        L+  +   +    S+
Sbjct: 954  SLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQ 1013

Query: 1384 ETCSTLEYASKAKNIKNKPQLGAFIM----------KDILVKNITMELAKIKSDLLSTKS 1533
            ET +  +     KN+K   +  A             KD     +T E    + + L+   
Sbjct: 1014 ETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTK 1073

Query: 1534 KEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM 1713
            +E +Y+ +   K+LN D  + + EV   +   E                   I++   + 
Sbjct: 1074 EENLYLDES-IKSLNEDKRTLQEEVSRLRESEELAKKNSSAISEQEWQQK--IETYQQES 1130

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQD-------------YKR 1854
            E  KL   Q+         T  EI     +L+     +QL  Q+                
Sbjct: 1131 EKWKLMCQQMS------ENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAH 1184

Query: 1855 RELDLNKKFETHISKEIKSLKTT---LFSQLSGMEQNNISQETNIQPNLDI------IKN 2007
             +L+ +K     ++ E+  LKT    L  +L+  E N++  E+N    L +       K+
Sbjct: 1185 EKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKS 1244

Query: 2008 EVLTLMETMQEKAELMYKDCVKKI--LNESPKFFNVIVE----KIDIIRVDFQRFYNNIA 2169
              L L  ++ + +E +  D  K++  L E+P   +V VE    +++ ++ +F+     + 
Sbjct: 1245 LELELRHSV-DSSEKLIADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLI 1303

Query: 2170 E-NLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 2346
            E   S+++E     K+ L N+   N + E L   ++   E+ E+KT + +E  K  L  H
Sbjct: 1304 EKTTSELTERFEREKKELMNN---NANLEELRKPLE---EEWERKTLQRIEEAKENLKKH 1357

Query: 2347 L----------------------------EENKKLIMQNLTNATSAVINQEMDLFEPKRV 2442
            +                            E+   L +  L+N T+  + +E+   E  + 
Sbjct: 1358 IRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADELEKEVR--EEIKT 1415

Query: 2443 KWENSFDLINKCDSMNNEFYNNMATTLSQIK 2535
            + E  F+L+ K          +M TTL + K
Sbjct: 1416 RLEEDFELLKKKAFEEGRQQASMKTTLLERK 1446

 Score = 41.6 bits (96), Expect = 0.014
 Identities = 76/373 (20%), Positives = 142/373 (38%), Gaps = 17/373 (4%)
 Frame = +1

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDY---KRRELDLNKKFE 1884
            ES    IN L   +D+   T   I+  N +++   +    A  +    KR  L L ++  
Sbjct: 530  ESHVQKINVLNKTIDRNQST---INMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQIS 586

Query: 1885 THISK----EIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAEL 2052
            T  ++      KS +     QL   E +  + +     N   +  E  T ME  Q     
Sbjct: 587  TKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFD 646

Query: 2053 MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHF 2232
              +   KK+L    +   + V KI    +  +R    ++  ++ +SEEN +L   L    
Sbjct: 647  KIQQESKKLLQLETRNKELEV-KISGKELHRKRSEETLSSKITFLSEENKSLHNDLA--- 702

Query: 2233 FKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIM---QNLTNATSAV 2403
            FK    +      +   +  ++   E  E  KN  N  +E N KL +   ++L+N    V
Sbjct: 703  FKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPV 762

Query: 2404 ------INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSM 2565
                  +  E++  +      E+   L       N  FYNN   +     + + + + ++
Sbjct: 763  GTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEAL 822

Query: 2566 NKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNID 2745
            +K    ++ Q+ E+EN                   ++ T L++ + NS++ +   I  + 
Sbjct: 823  SKQHETLQNQITETEN--QSKGIQLEHQTIIDRLTSEKTALEEKL-NSLSHSEEKIAEMK 879

Query: 2746 DIYDT-IENIMKN 2781
              YD  I+ I  N
Sbjct: 880  GEYDAQIQKIESN 892

>NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8.331
            YDR150W
          Length = 2447

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 56/269 (20%), Positives = 116/269 (43%), Gaps = 11/269 (4%)
 Frame = +1

Query: 1801 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
            KLQ + +    AL+D  +    +N+K    + KE ++ K T + +L     +  +Q   +
Sbjct: 85   KLQAINQEKSKALEDKTKENEKINEKLNKAL-KEYRNSKDTNW-ELENKLMDISNQFKQV 142

Query: 1981 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 2160
            + +L I   E+  + +++ +K   + K  ++K         + ++ K ++ R  FQ    
Sbjct: 143  KNDLKIKDLELEKINKSLNDKMAEVEKINLEK---------DGLINKSNVERTSFQNEIK 193

Query: 2161 NIAENLSDISEENNNLKQYLK------NHFFKNNHQELLNHHIDSTYEDIE---KKTSEF 2313
            ++  N+SD+++EN+ L   +K      N   +N  ++     +    ED +   K   E 
Sbjct: 194  SLKRNISDLNDENDQLNDRIKKATVDSNIIIENKRKQTEIETLKQNLEDAKIKIKTQEEN 253

Query: 2314 VENFKNTLNDHLEENKKLI--MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSM 2487
            +   + T   H ++NK ++    +L NA   V   +        VK   SF   N    +
Sbjct: 254  LNKLQQTKLSHEDDNKSIVSDRSSLLNAFEEVHKPDQKSITITDVK---SFADENNYVLL 310

Query: 2488 NNEFYNNMATTLSQIKNTVDTSSNSMNKS 2574
             N+ YN +  ++  +  T+   +  + KS
Sbjct: 311  PNKDYNELKNSVQPL--TLQEMATKLEKS 337

>Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {ON}
            YJR134C (REAL)
          Length = 705

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 108/508 (21%), Positives = 193/508 (37%), Gaps = 58/508 (11%)
 Frame = +1

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLT-INQ 1740
            Y+ LN  ++   NEV + K  IE                   ++ +  ++   +L   NQ
Sbjct: 129  YERLNKRIDDLTNEVSK-KPQIETTDSSFFKLIKEKDDLIDQLKKEGEKLAETELRQSNQ 187

Query: 1741 LKAQLDKQHKTELEISGFN----------NKLQKLTEIMQLALQDYKRRELDLNKKFETH 1890
            +KA   K    E E+S  N          N+LQ L   +Q  L +   +  D +K+ E  
Sbjct: 188  IKALKTKVKNLEYEVSSLNDDSTQNVENYNELQSLYHNIQEQLTETTSKLKDTDKQKE-- 245

Query: 1891 ISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCV 2070
                       L   L G  +      TN+Q +LD ++    TL+E  +EKAE   +   
Sbjct: 246  -----------LLEVLKGSIKEKDDLITNLQQSLDHMR----TLLE--EEKAEFQME--- 285

Query: 2071 KKILNESPKFFNVIVE-KIDIIRVDFQRFYNNIAENLS-----DISEENNNLKQYLKNHF 2232
            KK L E+       +E K++ +R++     N+     S     D  + ++ +KQY  + +
Sbjct: 286  KKALQEATIDQVTSLETKLEQLRIELDSCSNDSNGKSSGGDFVDNDDGSSEVKQYTSSQY 345

Query: 2233 FKNNHQELLNHHIDST---YEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
                   LL   ++S+   +  IE   +  + + +N L   ++E KK   +  T   S  
Sbjct: 346  M------LLKEQLESSKVNWNSIEYALNSKIVDLENHLASTIKEKKKFEEEYQTALRST- 398

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 2583
                 D  E +R   E     I++   +  +       TL     +++   N + K   +
Sbjct: 399  -ETLSDHLEKER---EGHLKAISQVKELERQI-----ETLKLSLQSINDDYNLLKKKYDI 449

Query: 2584 MKGQVEESENAVSXXXXXXXXXXXXXXXV---NKHTILKDNIE--------NSITSTH-S 2727
             + Q E++E+ V                    N    + +NIE        NS+ S   S
Sbjct: 450  QRAQFEKNEDGVKLHQETSDRKIIEKIPAELTNSLNSMNENIEDEWTLPQENSMLSLSIS 509

Query: 2728 HITNIDD------IYDTIENIMKNYGNKENAVKNE--MIDNILKEIPSLS---------- 2853
             +  ++D      I D   +++ N  ++    KN    ID+I +E   L           
Sbjct: 510  KLGQLEDDSSLKPISDQSHDMICNEESEHFDRKNIDFSIDDIPEEAADLQAIKEGESMKS 569

Query: 2854 --------KRVPLRLSNTNGNSAQNILS 2913
                    +R   +LSN+NGN + +++S
Sbjct: 570  LNNTSIPYRRASFQLSNSNGNISAHLVS 597

>Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON}
            (70806..73295) [2490 nt, 830 aa]
          Length = 829

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 110/549 (20%), Positives = 213/549 (38%), Gaps = 54/549 (9%)
 Frame = +1

Query: 1135 NLVDLAGSENINRSGALNQRAKEAGSINQSL---LTLGRVINALADKSGHIPFRESK-LT 1302
            NL +L+  + + R+   +   K A  + +     L +  V N    K  +I  R S+ L 
Sbjct: 78   NLDELSDKKVLGRASLQSSTPKSAHRMKEDFEDELEITEVRNVSPIKK-NISSRSSEFLA 136

Query: 1303 RLLQDSLGGN-----TKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 1467
            + L +    N     T+ +    +  A   +++ CS+L+     +  +N          D
Sbjct: 137  KQLDNDKATNDRFESTEASSNDVLLEAFTNTQKICSSLKQELSKQQQENSKLKLHVKSYD 196

Query: 1468 ILVKNITMELAKIKSDL--LSTKSK---EGIYMSQDHYKNLNSDLESYKNEVQECKRDIE 1632
               K I  +    K  L  L  KSK   E   ++   +++L    ++   ++  CK D++
Sbjct: 197  NESKKILEKFTDYKKSLTLLEEKSKWLLEQKKINDTKFQDLKRSNKAVTEKLTNCKNDVD 256

Query: 1633 XXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQK 1812
                               I  +  ++E LK  ++    QL ++            K++ 
Sbjct: 257  NLKVSLIKMKNSKAEVENEIARKVKEIEYLKKELDNCSGQLSEE------------KIKN 304

Query: 1813 LTEIMQLA-LQDYKRRELDLNKK------------FETHISK-----------------E 1902
             + +M+ + L+D+  ++LD   K             ET +SK                 +
Sbjct: 305  SSLLMEFSRLRDHSSKQLDETAKKMNELYNNMVGYLETELSKRINDKLDSSNEKILEKID 364

Query: 1903 IKSLKTTLF--SQLSGMEQNNISQETNIQPNLDIIK--------NEVLTLMETMQEKAEL 2052
            +  L+T +   SQ+S  EQ+    E      L+ I+        N  +TL  ++ E +E 
Sbjct: 365  VNKLETVILYESQMSQYEQHFKQFEATEMKALENIQSVYKANSENLKVTLTSSVTEVSES 424

Query: 2053 MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHF 2232
            +     K I +E     N+ +EK+D + V+  +F N + +   +   + N+L Q + +  
Sbjct: 425  IESLKDKMISHE-----NLSIEKVDNLSVELSQFKNQVFD-CKEYDSKINSLSQEISD-- 476

Query: 2233 FKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQ 2412
                    L      T   +  K +EF E  K  + +   + +K I+ N T  TS + N 
Sbjct: 477  --------LKLQKTQTLSLLGTKEAEFEEASKKLI-EQTAQLEKYIISNDTMTTS-IKNL 526

Query: 2413 EMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKG 2592
              +L E      E + D +   + +N   Y N     + I NT+++ +  + K I+    
Sbjct: 527  GNELKEA-----EINIDRLKDEEKVNLSNYENKIAAHTAISNTLNSENEMLKKRIA---- 577

Query: 2593 QVEESENAV 2619
            Q+EE+   +
Sbjct: 578  QLEEASTTI 586

 Score = 38.1 bits (87), Expect = 0.14
 Identities = 89/416 (21%), Positives = 167/416 (40%), Gaps = 38/416 (9%)
 Frame = +1

Query: 1420 KNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK 1599
            +NI++  +  +  +K  L  ++T     I+S  L  K      +S +   NL+ +L  +K
Sbjct: 397  ENIQSVYKANSENLKVTLTSSVTEVSESIES--LKDKMISHENLSIEKVDNLSVELSQFK 454

Query: 1600 NEVQECKR---DIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDK--- 1761
            N+V +CK     I                    + ++ ++ E     + +  AQL+K   
Sbjct: 455  NQVFDCKEYDSKINSLSQEISDLKLQKTQTLSLLGTKEAEFEEASKKLIEQTAQLEKYII 514

Query: 1762 -QHKTELEISGFNNKLQKLTEIMQLALQDYKRREL-DLNKKFETH--ISKEIKSLKTTLF 1929
                    I    N+L K  EI    L+D ++  L +   K   H  IS  + S    L 
Sbjct: 515  SNDTMTTSIKNLGNEL-KEAEINIDRLKDEEKVNLSNYENKIAAHTAISNTLNSENEMLK 573

Query: 1930 SQLSGMEQNNIS-QETN---------IQPNLDIIKNEVLTL----METMQEKAELMYK-- 2061
             +++ +E+ + + QE N         I   L+ +  EV+ L    +E  +E   L  K  
Sbjct: 574  KRIAQLEEASTTIQEENTKKKDRYQKINDQLNKLNVEVVQLKAHELELEEENRRLKTKFE 633

Query: 2062 ---DCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHF 2232
               +  ++  NE  ++     +KI ++  D Q   +   E L D  E+      +LK   
Sbjct: 634  EERNGYEETYNEVKRY----KQKIILLESDKQEIVSEKLE-LQDSIEQLKKTIDHLKKEN 688

Query: 2233 FKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN---TLN----DHLEENKKLIMQNLTNA 2391
             K      +N+ + +  E    K  E  ENFKN   +LN    + L + K    + +++ 
Sbjct: 689  LKKEKINTINNDLKTNGE----KHPEISENFKNPYVSLNIKDAESLSDTKS--QKIISSQ 742

Query: 2392 TSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT--TLSQIKNTVDTS 2553
             ++   ++      K  +  + FDL     SMN++    M +   + Q++N+ + S
Sbjct: 743  YTSFPQRQQSKLNKKDEEGNDEFDL---SSSMNDDLEMTMPSPVAIKQVRNSRNCS 795

>Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON}
            YOR216C (REAL)
          Length = 485

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 57/242 (23%), Positives = 110/242 (45%), Gaps = 17/242 (7%)
 Frame = +1

Query: 1708 QMESLKLTINQLKAQLDKQHKTELEISGFNNKL---QKLTEIMQLALQDYKRRELDLNKK 1878
            Q+E++    ++ K Q +        +    NK+   QK  E +Q  L +Y+ + L L KK
Sbjct: 123  QLENVIKERDEFKTQYNTLLSKISSMKSIFNKMKESQKQLEEVQEQLTEYESQNLKLKKK 182

Query: 1879 FE-THI-SKEIKSLKTTLFSQLSGMEQNNISQET---NIQPNLDIIKNEVLTLMETMQEK 2043
             E T I + E++S   T+  +L  +E+   S E      +  ++ +++E   ++ET  ++
Sbjct: 183  LEATKIENSELQSTIVTINKELENLEKEQESAEDIFLEYESKIEALQDEQRNMIETHSKE 242

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
             +   KD  K  L+   +   +I+E              N+ ++ SD+ +E ++LKQ L+
Sbjct: 243  LKASRKD--KDQLSVQVQELMIILE--------------NLKQDKSDLKDERDDLKQALE 286

Query: 2224 NHFFKN-------NHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLE--ENKKLIMQ 2376
             H  +        N  EL    + S  E+  ++    V+  ++ L+  LE   N   I++
Sbjct: 287  LHESEKTALQNSVNDLELKIEELVSKREEESREKDLEVKALRSQLDTELEAHNNDITILE 346

Query: 2377 NL 2382
            NL
Sbjct: 347  NL 348

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 48/265 (18%), Positives = 122/265 (46%), Gaps = 18/265 (6%)
 Frame = +1

Query: 1579 SDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS---QNSQMESLKLTINQLKA 1749
            S ++S  N+++E ++ +E                   +++   +NS+++S  +TIN+   
Sbjct: 146  SSMKSIFNKMKESQKQLEEVQEQLTEYESQNLKLKKKLEATKIENSELQSTIVTINKELE 205

Query: 1750 QLDKQHKTELEI-SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTL 1926
             L+K+ ++  +I   + +K++ L +  +  ++ +  +EL  ++K +  +S +++ L   L
Sbjct: 206  NLEKEQESAEDIFLEYESKIEALQDEQRNMIETHS-KELKASRKDKDQLSVQVQELMIIL 264

Query: 1927 FSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN 2106
               L   + +   +  +++  L++ ++E   L  ++ +  EL  ++ V K   ES +   
Sbjct: 265  -ENLKQDKSDLKDERDDLKQALELHESEKTALQNSVND-LELKIEELVSKREEESREKDL 322

Query: 2107 VIVEKIDIIRVDFQRFYN------NIAENLSDISEENNNLKQY---LKNHFF---KNNHQ 2250
             +      +  + +   N      N+ + + D+ E+ +  ++Y    K H     K  H+
Sbjct: 323  EVKALRSQLDTELEAHNNDITILENLKKEIEDMKEDVSMKEKYEEESKQHVLQIGKLRHE 382

Query: 2251 E-LLNHHIDSTYEDIEKKT-SEFVE 2319
              +LN H+      ++K + SE V+
Sbjct: 383  AIILNEHLTKALAMLKKSSDSESVD 407

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 2/91 (2%)
 Frame = +1

Query: 310 IFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKL 489
           +++ + G L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 490 FDTLELQQND--YVVKCSFIELYNEELKDLL 576
           +D ++   ND  + V  S IE++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL225C (CNM67) and
            YDL239C (ADY3)
          Length = 862

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 85/515 (16%), Positives = 204/515 (39%), Gaps = 36/515 (6%)
 Frame = +1

Query: 1186 NQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISP 1365
            N++ K+ G I+Q   TL      LA+    +   ESK   ++   L          T+  
Sbjct: 212  NRQLKKDGEISQLNRTLNDKDMQLAELKKQL---ESKTGEVISQELKAANAHQRAKTLEN 268

Query: 1366 AKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 1545
                 +     LE A +   ++ + +    + KD+    +  +  K+++ L S ++   +
Sbjct: 269  ELEQQKNKVRVLEKAMETTAMEVEAERTR-LNKDLEQVTLEYKKYKVETGLRSNETSNTL 327

Query: 1546 YMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS--------- 1698
               +   K L  DLE   NEV E + +I                    +           
Sbjct: 328  QQIKGKNKILKDDLEKKTNEVNELRDNISTKEKEVSNLKNLLADLKVLVNELRADKSTVD 387

Query: 1699 -----QNSQMESLKLTINQLKAQLDK-QHKTELEISGFNNKLQKLTEIMQLALQDYKRRE 1860
                 Q  ++E+    +N L+ + D+ +++ + EI+     ++   +  Q+ L++ + + 
Sbjct: 388  VQLDIQKKELEAASSKLNSLRVEFDQLKNEKDTEINTLKADIENNWKKKQVRLEEVEAKC 447

Query: 1861 LD----LNKKFETH--ISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
             D    L K +ET+  +S ++K   T +      +++  + +++           + L  
Sbjct: 448  NDLTALLQKSYETNKELSVQLKRKDTEIGKINDQLKRTTVEKDS---------LRDFLEK 498

Query: 2023 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDII---RVDFQRFYNNIAENLSDISE 2193
             +  +     +  D  KK    +  +  ++ EK +I+           NN+ + +  +  
Sbjct: 499  AKWFEIPVGTILLDLFKKQRRPANGYKTILSEKYEIVGFRLTSDDELLNNLRQKVGSLEN 558

Query: 2194 ENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKT------SEFVENFKNTLNDHLEE 2355
             NN L++ L++     N QE+      S   DI K +      S  ++  ++ ++   ++
Sbjct: 559  SNNLLQEELESKI--KNTQEMFGSQEASMKNDIIKLSEDLKARSAMIDKLQSVIDSLQKD 616

Query: 2356 NKKLIMQNLTNATSAV-INQEMDLFEPKRVKWENS--FDLINKCDSM---NNEFYNNMAT 2517
               L+ +   +    + ++Q +   +  +++ +N+   +L  K   +   N+E    M  
Sbjct: 617  AAALLKEKDESVNKNIELSQHIAQLQEDQLQRDNTTFLELCQKNQEILQYNHEMMEKMHV 676

Query: 2518 TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVS 2622
              +++++ V  +SN +  SIS  +  ++E +  ++
Sbjct: 677  MEAELRSVV-KASNDLQFSISEKEAVLKEKQQIIT 710

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 72/312 (23%), Positives = 129/312 (41%), Gaps = 18/312 (5%)
 Frame = +1

Query: 1693 QSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLN 1872
            Q  ++Q+  L   + QLK QLD+ +    ++S     L+                + D  
Sbjct: 743  QESDTQVSDLDEKLAQLKTQLDEANSKVEDLSTKKTTLE--------------AAKADCL 788

Query: 1873 KKFETHISK--EIKSLKTTLFSQLSGMEQNNISQETNIQP------NLDIIKNEVLTLME 2028
            KK  +H  +   +K+  T L  QL+ + +   + E  I        NL   K+ +  +M 
Sbjct: 789  KKLASHEGQVNSLKNRTTQLEKQLATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMN 848

Query: 2029 TMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNL 2208
             +Q++ E        K L E+ K      EK+ I ++  QR  +   ENL +  ++    
Sbjct: 849  KLQKEGE--------KKLQEAEK------EKVRITQLLSQR--DRDIENLRNELQDQGTQ 892

Query: 2209 KQYLKNHFFKNNHQELLNH---------HIDSTYEDIEKKTSEFVENFKNTLNDHLEENK 2361
            K+ L     ++ H  LL             DS    +++K     E+ K+T N+H    K
Sbjct: 893  KKKL-----EDEHAGLLKEIADLKSQCASQDSLIPKLKEKLKTLAESLKDTQNEHATLQK 947

Query: 2362 KL-IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN 2538
            ++  +Q  ++A    +N E+     +++K EN   LI++ D +  E     A T +  K 
Sbjct: 948  QVGNIQATSHAEITQLNAEL-----QKLKDENVI-LISRKDELTQELEKLQAQTAAGEKQ 1001

Query: 2539 TVDTSSNSMNKS 2574
            T D +  +  KS
Sbjct: 1002 TSDIALLNTQKS 1013

>KAFR0J02360 Chr10 (448781..450274) [1494 bp, 497 aa] {ON} Anc_6.289
            YMR198W
          Length = 497

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 86/435 (19%), Positives = 167/435 (38%), Gaps = 40/435 (9%)
 Frame = +1

Query: 1396 TLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNL 1575
            T+ + S   N K     G  IM   ++K++T +     S   S KS   I +++   + +
Sbjct: 8    TISFQSDVSNNKRLKISGEMIMTQPMLKDVTNKFNNNNSIRYSDKSS--IELAKSKERKI 65

Query: 1576 NSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXT-IQSQNSQMESLKLTINQLKAQ 1752
              D+  +KN + E ++DI                   T +      +  L+  IN    +
Sbjct: 66   LRDINHFKNSILEIEKDITLYRDSKIPNLSELLLDQDTNLNELQEDLSHLENDINFTALE 125

Query: 1753 LDKQHKT------------ELEISGFNNKL------------QKLTEIMQLALQDYKRRE 1860
            ++K  K              +EIS F N+L             +L EI +L      + E
Sbjct: 126  IEKLIKNHEFNNINLQLLHSIEISSFENQLMDGVYTKKRDMENQLIEIDELKPDASLQCE 185

Query: 1861 LDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQE 2040
            ++  +     +SK+I+S+        S   + N  ++T +  N +  K+E    ++ +  
Sbjct: 186  MNEFQDSVKQLSKDIQSINN------SNSVKCNEFEQTELVANFESFKSEKSKRLDRLLS 239

Query: 2041 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYL 2220
            +  ++  D + ++ +E+    N+I E    ++        N       I E +N +   L
Sbjct: 240  EQRVLC-DQLDQLRDENLVKTNLISE----LQSKMFDLTKNSETLTLTIEELDNLIIPKL 294

Query: 2221 KNHF----FKNNHQELLNHHID----STYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ 2376
            +N F     K + ++   + ID    ST  +I K+ S+       T N   + N+     
Sbjct: 295  QNEFNAKQIKFDKEKSQKNQIDMEAQSTKIEINKQRSKLYCEKSTTRNLQFQINELTNNI 354

Query: 2377 NLTNATSAVINQEMDLFEPKRVKW--ENSFDLINKCDSMNNE-----FYNNMATTLSQIK 2535
             L   T+A+ ++   +    +     E     I  C   N++      YN++      ++
Sbjct: 355  TLIGITNAIEDKRFHIVVDPQTNLIDEEILPFIKSCKLNNHKTITILHYNSIEYLKQLLE 414

Query: 2536 NTVDTSSNSMNKSIS 2580
            N  DTS  S+  S+S
Sbjct: 415  NPTDTSPYSVTYSLS 429

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 62/301 (20%), Positives = 133/301 (44%), Gaps = 34/301 (11%)
 Frame = +1

Query: 1576 NSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL 1755
            NS +E Y+N+++  K+D E                  ++  + +++E L+  +  L+ ++
Sbjct: 834  NSSIEWYQNKIEVLKKDNE--------------SIICSMNDKQAEIEKLQHKVKSLEKEI 879

Query: 1756 DKQHKTELE----ISGFNN--KLQKLTEIMQLALQDYKRRELDLNKKFETHIS--KEIKS 1911
            D ++K  L     I G  N   L+K  E  +++L D   +  +  + +ET+    K++ S
Sbjct: 880  D-ENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHS 938

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM--------QEKAELMYKDC 2067
                     S   +N  +++++++  + ++K ++  L   +        +EKAE   K  
Sbjct: 939  KFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKIS 998

Query: 2068 VKKILNESPKFFNVIVE-KIDIIR--VDFQRFYNNIAEN--------LSDISEENNNLKQ 2214
            + +  N+  +      E K+  I+  +D Q  Y N A+N         +D+S+  + L++
Sbjct: 999  ILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELRE 1058

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYEDIE-------KKTSEFVENFKNTLNDHLEENKKLIM 2373
             L  +  + N   L  + ++ST ++ E       K   E +E+  + + D   +NK L  
Sbjct: 1059 QLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYD 1118

Query: 2374 Q 2376
            Q
Sbjct: 1119 Q 1119

 Score = 40.4 bits (93), Expect = 0.031
 Identities = 83/460 (18%), Positives = 182/460 (39%), Gaps = 56/460 (12%)
 Frame = +1

Query: 1405 YASKAKNIKNKPQLGAFIMKDIL--VKNITMELAKIKSDLLSTKSK------------EG 1542
            Y + AK++K          KD    +KN+T E + ++  +   K +            +G
Sbjct: 926  YETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKG 985

Query: 1543 IYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM--- 1713
            +   +  ++   S L++   EV+  K + E                  T Q+   Q    
Sbjct: 986  MKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQK 1045

Query: 1714 -ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETH 1890
               +  TI++L+ QL   H   ++++       +L   ++   + +  +   L ++ E+ 
Sbjct: 1046 HADVSKTISELREQL---HTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESS 1102

Query: 1891 ISK--EIKSLKTTLFSQLSGMEQNNIS-QETNIQPNLDIIKNEVLTLMETMQEKAELMYK 2061
             S+  ++ S    L+ Q+      +    +TN +P L+ I   +    + +  K  +  +
Sbjct: 1103 NSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAER 1162

Query: 2062 DCVKKILNESPKFFNVIVE----KIDIIRVDFQRF------YNNIAENLSDIS---EENN 2202
            D   K+L +     ++ ++    K+D  R++ ++       + +I E L+ ++   E N 
Sbjct: 1163 DA--KMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNI 1220

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDI---------------EKK-----TSEFVEN 2322
             L+  L+N+   N  + +L   +D   +DI               EK+     T E V  
Sbjct: 1221 TLRNELENN---NEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHR 1277

Query: 2323 FKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKR--VKWENSFDLINKCDSMNNE 2496
            +K    D LE+++++   +       + + ++ L E  R   + E  F+ + +      +
Sbjct: 1278 WKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLK 1337

Query: 2497 FYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 2616
                   TL++  N +  +   + KS+     ++EE ENA
Sbjct: 1338 TSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENA 1377

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 80/448 (17%), Positives = 186/448 (41%), Gaps = 38/448 (8%)
 Frame = +1

Query: 1393 STLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKN 1572
            ST ++  K    KN+  L      D ++  I  EL  ++SD    K+K  +   ++    
Sbjct: 209  STNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKN--DE 266

Query: 1573 LNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQ-NSQMESLKLTINQLKA 1749
            L+  L+    E++     +                    ++SQ N+  E L  T     +
Sbjct: 267  LSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGLETS 326

Query: 1750 QLDKQHKTEL------------EISGFNNKLQKLTEIM-----------QLALQDY--KR 1854
               K+H +E             E++   ++  +L+ I+             +  D+   +
Sbjct: 327  NDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGSSTSRSSSDFILLK 386

Query: 1855 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 2034
            ++L   K+ + H+  +I+S    L  ++  +  N+  + T+   N   + N  L L  T 
Sbjct: 387  KQLIKEKRAKEHLQNQIESFILELEHKVPII--NSFKERTDTLEN--ELNNAALLLEHTS 442

Query: 2035 QEK----AELMYKDCVKKILNESPKFFNVIVEKIDIIR-VDFQRFYNNIA-ENLSDISEE 2196
             EK     EL  K   +K+         +I +++D+ R V +    N+++ ++   + +E
Sbjct: 443  NEKNAKIRELSAKS--EKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKE 500

Query: 2197 N----NNLKQYLKNHFFKNNHQELLNHHIDS--TYEDIEKKTSEFVENFKNTLNDHLEEN 2358
                  N+ Q   +   + + Q+++   +    +  ++++K +E ++  +N L D LE N
Sbjct: 501  EIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN-LADRLESN 559

Query: 2359 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN 2538
            +    Q+L    S  IN+  +     + + E    L +K + +  E  N+ A   ++  +
Sbjct: 560  ENESKQSLQKIESETINEAKEAILTLKAEKE---QLESKVEELEKECENSKALLSNEETS 616

Query: 2539 TVDTSSNSMNKSISVMKGQVEESENAVS 2622
             ++++   +N++   ++ Q+++ ++ +S
Sbjct: 617  HLNSTIQQLNETKRNLECQIQDLQSNIS 644

 Score = 37.4 bits (85), Expect = 0.27
 Identities = 111/553 (20%), Positives = 223/553 (40%), Gaps = 10/553 (1%)
 Frame = +1

Query: 949  IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 1128
            IQ  +E + TNA    +L Q   K  + +     DFS+R   I  +T  K   +E   + 
Sbjct: 919  IQEYKELYETNAK---SLKQMHSKFEESSK----DFSNR---IKNLTNEKSSLEEKISLL 968

Query: 1129 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRL 1308
            K  + +L    ++   G   ++A+    I+  L    + + A+  +       ESKL+++
Sbjct: 969  KEQIFNLNNELDLQNKGMKEEKAEFRKKIS-ILQNNNKEVEAVKSEY------ESKLSKI 1021

Query: 1309 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN-KPQLGAFIMKDILVKNI 1485
             +D      +  + A  +      E      ++A  +K I   + QL  + ++   V  +
Sbjct: 1022 QKDL----DQQTIYANTAQNNYEQE----LQKHADVSKTISELREQLHTYRVQ---VNTL 1070

Query: 1486 TMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXX 1665
            T+   +++S L   K  E  + SQ   K L   LES  + +++     +           
Sbjct: 1071 TLSRNQLESTL---KENERSWTSQR--KALIEQLESSNSRIEDLTSQNKLLYDQIELYTT 1125

Query: 1666 XXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNK-LQKLTEIMQLALQ 1842
                   T  +    + S+ L++ + +  LD    T++ ++  + K L++   +M + LQ
Sbjct: 1126 ADKGVTDT--NDKPALNSILLSLRRERDILD----TKVTVAERDAKMLRQKISLMDIELQ 1179

Query: 1843 DYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
            +  R +LD N + E      I      +  +L+   Q N+ +E+NI      ++NE    
Sbjct: 1180 E-ARTKLD-NSRLEEEKRPTIIQQHEDIMEKLN---QLNLLRESNIT-----LRNE---- 1225

Query: 2023 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENN 2202
            +E   E+  ++  +  K   + +P     I  ++  ++   Q     +     ++     
Sbjct: 1226 LENNNEEKRVLQSELDKLKQDIAP-----IESELAALKYSMQEKEQELRLTKEEVHRWKK 1280

Query: 2203 NLKQYLKNHF-FKNNHQELLNHHIDSTYEDIEKKT---SEFVENFKNTLNDHLEENKKLI 2370
              +  L+ H    ++  E L H IDS    +++KT   +E  E F N L    +E  K  
Sbjct: 1281 RSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERF-NRLRRQAQERLKTS 1339

Query: 2371 MQNLTNATSAVINQEMDLFEPKRVKWENSFDLIN-KCDSMNN---EFYNNMATTLSQIKN 2538
              +L   T     ++++  +  ++K E S D  N K + + N   E  NN    + +++ 
Sbjct: 1340 KLSLDTLT-----EQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQ 1394

Query: 2539 TVDTSSNSMNKSI 2577
              + SS      +
Sbjct: 1395 DAENSSKEFKTKL 1407

>TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1915

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 94/451 (20%), Positives = 192/451 (42%), Gaps = 48/451 (10%)
 Frame = +1

Query: 1288 ESKLTRLLQDSLGGNTKTAL-IATISPAKVTSEETCSTLEYASKAKNIKNKPQL-GAFIM 1461
            + K+  L+      +TKTAL I  +   KV +E+T    +  + +K  +N+ QL   F  
Sbjct: 1422 DKKINSLVHSLKQSDTKTALLIDNLERLKVDTEKTNEHNDVLT-SKLKQNETQLTNTFNQ 1480

Query: 1462 KDILVKNITMELAKIKSDLLSTKSK-EGIYMSQDHYKNLNS-------DLESYKNEV--- 1608
             D    N   ++A++   L   ++  +G+    D  K+ N        D+E  +N++   
Sbjct: 1481 LD----NSNHKIAELSHALNQAENDVQGMAKLIDDLKSTNKEMDKSIWDVEMQRNDISTK 1536

Query: 1609 -QECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELE- 1782
             QEC  D++                   +    S + ++   + +L+ +L    K E E 
Sbjct: 1537 LQECMVDLQKKDDQINILKSSIDHYKGEMIKMESNLTNVD-ELERLREELHSFSKIETEY 1595

Query: 1783 ---ISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFET------HISKEIKSLKTTLFSQ 1935
               IS  N  L+ L    +  + +  R       K E       +I  E + +       
Sbjct: 1596 KKTISNLNYNLETLQNDYEANVAELLRENSHYTSKLEQLTLDRDNIIAENQDISKRYSES 1655

Query: 1936 LSGMEQNNISQE--------TNIQPNLDIIKNEVLT----LMETMQEKAELM----YKDC 2067
            +  + QNN+ +E         N++  L  +  E++T    L +T+ E  +L+    Y + 
Sbjct: 1656 I--VTQNNLIKELDDIRDFCANLEKKLSSMDIELVTTKDKLYKTITENTDLLNNKAYLED 1713

Query: 2068 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNH 2247
              K+  E  +  + ++EK+ +   D +  Y+++ +   D+SEEN  +    K +   NN 
Sbjct: 1714 ALKLQGEQIERSSQLIEKLQMEVNDSKLKYDDLKQKKIDVSEENTTIN---KLNMKLNND 1770

Query: 2248 QELLNHHI-DSTYEDI-EKKTSEFVENFKNTLN---DHLEENKKL--IMQNLTNATSAVI 2406
             +LL   + D++ +D+   + +E  +   +  N   + ++ENK L   +++L N  +  +
Sbjct: 1771 IKLLEKQLADTSEKDLWSSRLNELQDQLTSETNMKYELIKENKVLGNDLEDLKNLNTKQM 1830

Query: 2407 NQEMDLFEPKRVKWE-NSFDLINKCDSMNNE 2496
             + + +   +R K E +S + INK  ++  +
Sbjct: 1831 -EIIKIANEERKKLEGDSMEYINKVSNLEKQ 1860

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 4/125 (3%)
 Frame = +1

Query: 214 INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTS 393
           + T  DT +  ++  + ++  KV    A++   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 394 TGKTYTMTGDEKLYNGELSDA---AGIIPRVLLKLFDTLELQQ-NDYVVKCSFIELYNEE 561
              +  M G +   + E  D+   +G++ +    +F+ ++    ++Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 562 LKDLL 576
           + DLL
Sbjct: 193 VFDLL 197

>Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {ON}
            YPL174C (REAL)
          Length = 871

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 55/275 (20%), Positives = 123/275 (44%), Gaps = 3/275 (1%)
 Frame = +1

Query: 1693 QSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLN 1872
            +S  S+++  +   +QL+A ++    +E ++    + L KL E +++   D K R     
Sbjct: 119  ESLTSELDVSEQQKDQLRAAIENLSISESDLLSQTSGLNKLVEALKVENDDMKIR----- 173

Query: 1873 KKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAEL 2052
               E  IS ++ +        +  +  NN   +  ++         +    + ++E  +L
Sbjct: 174  -LEEFAISTDLSNNTVAQNFDVKKLWDNNRLLQGLLEQTTASYNEAMKVQEDLLEENTQL 232

Query: 2053 MYKDCV--KKILNESPKFFNVIVEKIDIIR-VDFQRFYNNIAENLSDISEENNNLKQYLK 2223
            + ++    KKI +++ +     V   D+ + ++ Q   +NI + L++ +    N  + LK
Sbjct: 233  LEENTALSKKISDQTLRLEQTNVTISDLAQQLEAQSKSSNIVDKLTNDNILLTNDIKSLK 292

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
                +   +E LN H+  TYE++E++ +  + N ++ L     ENK+++  N     +A 
Sbjct: 293  KQIKEVCAKEKLNEHLRFTYEELEQELNLQLSNLQSAL-----ENKQILANNYIE-ENAR 346

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNN 2508
            +   + L E +        +L  K +++N E Y N
Sbjct: 347  LKSMLKLSESQATDKCQGLEL--KVNTLNEELYQN 379

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar to
            uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 63/299 (21%), Positives = 120/299 (40%), Gaps = 3/299 (1%)
 Frame = +1

Query: 1975 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 2154
            N++   + ++ + L++   + EK +       +  LNE        ++  D    +F+R 
Sbjct: 241  NLRDRYNDLEIKFLSIQNELDEKKQEFESSTAR--LNEEIHTLKSTIDDKDATISEFKRK 298

Query: 2155 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 2334
              N  + L+ I ++N N  Q L  H  K          ID   EDI +K +  V ++K  
Sbjct: 299  LGNAEDQLASIDDQNGNQNQKLL-HDLKEREDA-----IDGLKEDIIEKENAIV-HYKEE 351

Query: 2335 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 2514
            + D   + K+      + +  A + +E + F  KR   + +F           EF +   
Sbjct: 352  IQDKQNQLKE------SESKYAEVQKEFEDF--KRELKKQTF-----------EFEDGKK 392

Query: 2515 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKD 2694
            +T  Q++  +      + K +  ++GQ+E+ E                     KH  ++ 
Sbjct: 393  STSRQLQE-LSVEKIQLEKQVCNLRGQIEKLEQQHRLTQSENDGLRTKL----KH--IES 445

Query: 2695 NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVK---NEMIDNILKEIPSLSKRV 2862
            +++N  + T      I D+   +E+  KN G   N +K   +E+I N  K    LS+ V
Sbjct: 446  DLKNEKSRTE---VKIKDLTSDLEDARKNLGEANNTIKELHHEIIKNATKSKDQLSEEV 501

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 99/494 (20%), Positives = 191/494 (38%), Gaps = 32/494 (6%)
 Frame = +1

Query: 1555 QDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTI 1734
            +D Y +L     S +NE+ E K++ E                   I +  S ++    TI
Sbjct: 243  RDRYNDLEIKFLSIQNELDEKKQEFE----------SSTARLNEEIHTLKSTIDDKDATI 292

Query: 1735 NQLKAQLDKQHKTELEISGFN-NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKE--I 1905
            ++ K +L         I   N N+ QKL       L D K RE  ++   E  I KE  I
Sbjct: 293  SEFKRKLGNAEDQLASIDDQNGNQNQKL-------LHDLKEREDAIDGLKEDIIEKENAI 345

Query: 1906 KSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEV---------------LTLMETMQE 2040
               K  +  + + ++++  S+   +Q   +  K E+                 L E   E
Sbjct: 346  VHYKEEIQDKQNQLKESE-SKYAEVQKEFEDFKRELKKQTFEFEDGKKSTSRQLQELSVE 404

Query: 2041 KAELMYKDC-VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLS----DISEENNN 2205
            K +L  + C ++  + +  +   +   + D +R   +   +++    S     I +  ++
Sbjct: 405  KIQLEKQVCNLRGQIEKLEQQHRLTQSENDGLRTKLKHIESDLKNEKSRTEVKIKDLTSD 464

Query: 2206 LKQYLKNHFFKNNHQELLNHHI--------DSTYEDIEKKTSEFVENFKNTLNDHLEENK 2361
            L+   KN    NN  + L+H I        D   E++ +K  E ++  K+ +   L+E  
Sbjct: 465  LEDARKNLGEANNTIKELHHEIIKNATKSKDQLSEEVVEKDKE-IDQLKHRV-QRLDEEL 522

Query: 2362 KLIMQNLTNATSAVINQEMD-LFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN 2538
            +     L  AT    N+E+D   E +R++        NK +         +A    + + 
Sbjct: 523  RTSQAELDKATK---NREVDHELEIRRLQ--------NKHEIEQESLKRELAHMTDEKER 571

Query: 2539 TVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITS 2718
             VD     +      ++   +E+EN +S                 + T+   NI+  I  
Sbjct: 572  LVDLHRLDIETWERQIEALRKENENLISREHKESNNI--------EITLQDKNIQ--IRR 621

Query: 2719 THSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSA 2898
              + I  +++  + I N +++    ++  K+EM D  L+ I  L  RV L  + +  +S 
Sbjct: 622  LEADIVQLNEERNDILNKLRSLEQAKDRYKSEMKD-ALETISRL--RVDLENNKSLKDSK 678

Query: 2899 QNILSPKKHAIDDE 2940
             +++  K   + DE
Sbjct: 679  DSLIERKYEKLKDE 692

>KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {ON}
            Anc_5.414 YDR356W
          Length = 1040

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 113/559 (20%), Positives = 213/559 (38%), Gaps = 25/559 (4%)
 Frame = +1

Query: 994  LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 1173
            LN +    K   V  +K  +     H +  +T  +K+ D L  ++++N      SE +  
Sbjct: 440  LNNIDNSDKRHLVEHSKEIERVKADH-LLEMTQLEKNYDSL--LTELNSSKAELSEKLE- 495

Query: 1174 SGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKT--AL 1347
             GA ++ AK    +N   +   R+IN+                + L+D +   T    +L
Sbjct: 496  -GAESELAKCKEELNSKKIEHERLINS-----------HETNVKSLKDQIYDQTTQIRSL 543

Query: 1348 IATISPAKVT-SEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLS 1524
             +T+         +  + L   +K   + ++ Q    I +D  V+ IT  L    +DL  
Sbjct: 544  ESTVDDLSADIGRKEAALLLLQTKYDELSDRYQSNNEISQD--VEKITRSLENQINDLNH 601

Query: 1525 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQN 1704
              +   I +S       +++L S  NE+      I+                   I  + 
Sbjct: 602  KLNHANILLSTK-----DAELSSTSNELSSATTSIKKLTAQ--------------IHDKT 642

Query: 1705 SQMESLKLTINQLKAQL-DKQHKTELE----ISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
             ++E  +  I+QL++QL +K  K   E    I   N ++  LTE ++ A  ++ R  L  
Sbjct: 643  EKIEQSRAKISQLESQLFNKTIKASKESLKTIETKNAQIDDLTEQLEKAKSEFDRA-LKT 701

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGME-----QNNISQETNIQPNLDIIK--NEVLTLME 2028
            N   E  IS++ +     L  ++ G+      +     E   Q N DI +  +   TL +
Sbjct: 702  NNILEEQISRKYQDQIKDLEDEVDGLSNTLRIRTREENERIKQLNEDIQEWQDRYDTLND 761

Query: 2029 TMQEKAELMYKDCVKKILN---ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEEN 2199
            T+Q +          + L+   E       + EK   I        + + +  + I EEN
Sbjct: 762  TLQSQISKRSHSTRAEQLSFKRERESLLQEVAEKDGEI--------DKLKQKNTSILEEN 813

Query: 2200 NNLKQYLKNHF-FKNNHQELLNHHID------STYEDIEKKTSEFVENFKNTLNDHLEEN 2358
            +NL+ YLK+     +  ++L+  + D           +EK+  E  E+   T  D L  +
Sbjct: 814  DNLRDYLKSSSKLSSGFEQLMTKYKDMKRTFAERVASLEKENLELEESLHRTRIDALSRD 873

Query: 2359 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN 2538
                    +  +  V     DL +  R+K+ N     N    MN+     +  T  +++ 
Sbjct: 874  S-------SGPSPNVDRTHADLADYYRIKYHNEVTHNNDMKVMNDYLNLVLRATTQKLRT 926

Query: 2539 TVDTSSNSMNKSISVMKGQ 2595
             +      ++ S ++  GQ
Sbjct: 927  DLRRVKRELSTSGALFSGQ 945

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 76/379 (20%), Positives = 152/379 (40%), Gaps = 32/379 (8%)
 Frame = +1

Query: 1255 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKNIK 1431
            +   S  +  ++ +L  L  D  GG+ +   +A   S  +V SEE      Y       K
Sbjct: 893  IESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEE------YDEIENETK 946

Query: 1432 NKPQLGAFIMKDILV---KNITMELAKIKS-----DLLSTKSKEGIYMSQDHYKNLNSDL 1587
            NK QL   + + I+      + ++ +K+ S     +++S+K K+     +   K   +DL
Sbjct: 947  NKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKK----DRTATKKAENDL 1002

Query: 1588 ESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQH 1767
            +  +N+ +E   DIE                     S N ++  + +   +L+A++ K  
Sbjct: 1003 KRLENQCREASNDIE---------------------SCNLEISKISVLNTELEAKIYKLD 1041

Query: 1768 KTELEISGFNNKLQKLTEIMQLALQ-------DYKRRELDLNKKFE------THISKEIK 1908
             +  E      ++++  E ++  L+       D+K  E+++N + E      +HI KEIK
Sbjct: 1042 TSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIK 1101

Query: 1909 SLKTTLFS--------QLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 2064
              K  L S         L  + +  + +E   + + ++   EV      M      M  D
Sbjct: 1102 YNKDELNSLKIRDITQTLQALNEGKLPEEN--EDDFEVQDEEVQREQREMSSDPNAMDID 1159

Query: 2065 CVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNN 2244
                   ++ + F V     +I  +D   + N  +  L   SE        L++   ++ 
Sbjct: 1160 -----EEQAAEQFQVQQTDGEIDSMDIDEYENETSNGLPKFSEAQ------LQSIQIEDV 1208

Query: 2245 HQEL--LNHHIDSTYEDIE 2295
              ++  LNH++D+ + DI+
Sbjct: 1209 ELQIDELNHYVDNAHVDID 1227

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 75/354 (21%), Positives = 147/354 (41%), Gaps = 11/354 (3%)
 Frame = +1

Query: 1483 ITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXX 1662
            I +E+AK + D+ S+ ++  + + Q+  K L +D +    E +E   D E          
Sbjct: 882  IEVEIAKRRLDIESSSTE--LKLKQEQLKELETDRDGGSVEDRELA-DAESKLQVLSEEY 938

Query: 1663 XXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQ 1842
                     I+++    + L   IN LK ++ K   T+L++   N+K+  + E + + + 
Sbjct: 939  DE-------IENETKNKQQL---INSLKEKIMKIGGTKLQLQ--NSKVNSINEQINI-IS 985

Query: 1843 DYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
              ++++    KK E     ++K L+       + +E  N          L+I K  VL  
Sbjct: 986  SKQKKDRTATKKAEN----DLKRLENQCREASNDIESCN----------LEISKISVLNT 1031

Query: 2023 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENN 2202
                 E    +YK  +   LNE+      + E+ + ++ + +   NN ++  S   E NN
Sbjct: 1032 -----ELEAKIYK--LDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINN 1084

Query: 2203 NLKQY--LKNHF---FKNNHQELLNHHIDSTYEDIE-----KKTSEFVENFKNTLNDHLE 2352
             L++   L +H     K N  EL +  I    + ++     K   E  ++F+  + D   
Sbjct: 1085 RLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFE--VQDEEV 1142

Query: 2353 ENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE-NSFDLINKCDSMNNEFYNNM 2511
            + ++  M +  NA      Q  + F+ ++   E +S D+    D   NE  N +
Sbjct: 1143 QREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDI----DEYENETSNGL 1192

>KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {ON}
            Anc_4.364 YJR134C
          Length = 616

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 80/398 (20%), Positives = 162/398 (40%), Gaps = 27/398 (6%)
 Frame = +1

Query: 1456 IMKDILVKNITMELAKIKSDL--LSTKSKEG------IYMSQDHYKNLNSDLESYKNEVQ 1611
            I+K    KN T+++ ++K +L  L+  +KEG      +   ++ +KN+ + LES +  ++
Sbjct: 158  ILKSADKKN-TVKIDQLKKELAALNKINKEGESNFKELTKREEDWKNIETKLESKERTIE 216

Query: 1612 ECKRDIE-XXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKT--ELE 1782
            E    I+                    I+S N  + SL+ ++ QL+ QL     T  + E
Sbjct: 217  ELNATIQALEASSKQEKNDHEEKVKRLIESNNEHIISLESSLEQLRIQLSGSESTADDKE 276

Query: 1783 ISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNI 1962
                N +   L +            +L  +KK    I  ++    T L + L   E+   
Sbjct: 277  GGAINTESYSLLQ-----------EQLTSSKKNWESIEFQLNLKMTNLETSLGEKEKLIT 325

Query: 1963 SQETNIQPNLDIIKNEVLTLMETMQEKAE---LMYKDCVKKI------LNESPKFFNVIV 2115
               T IQ NL +  + ++T +E  +E+++   L +K+   K       LN     +N++ 
Sbjct: 326  GLNTEIQ-NLKVENSRLVTEIEAKKEESKTLRLQFKETSNKTSILEMSLNNLKDDYNLLE 384

Query: 2116 EKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 2295
             K  I +   +   NNI        +E+++  + +K HF   +H++      +S+   IE
Sbjct: 385  SKYMIQKSQLE---NNI--------KEDHSANEIIK-HFENGSHEDWF-LQAESSLLSIE 431

Query: 2296 KKTSEFVENFKNTLNDHLE-------ENKKLIMQNLTNATSAVINQEMDLFEPKRVKWEN 2454
            +K  +  +N     N +L+       +    + Q+  N  S + N    LF       ++
Sbjct: 432  EKPQDERKNTVTDDNSNLQIDINEIPDEAATMTQHAYNDDSFMRNSSASLFRKPSTNIQS 491

Query: 2455 SFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMN 2568
            +    N  DS   +    +   + +++  + +  +  N
Sbjct: 492  N---SNNIDSGTTQIVTRLGAEIRRLEGELKSIQDRYN 526

>TBLA0A05620 Chr1 complement(1394838..1397228) [2391 bp, 796 aa] {ON}
            Anc_1.99 YNL258C
          Length = 796

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 78/363 (21%), Positives = 139/363 (38%), Gaps = 21/363 (5%)
 Frame = +1

Query: 1813 LTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQ-----LSGMEQNNISQETN 1977
            +TE++   LQ   +  +D         S  +  LKT + ++     L+G   N I+ +T 
Sbjct: 210  ITELVSTDLQQIVKDNMDSLFNEYIQFSTLVHVLKTGIMNRNYSIVLTGEASNIINLQTK 269

Query: 1978 IQPNLDIIKNEVLTLMETMQE--KAELMYKDCVKKILNESPKFFNVIVEKID----IIRV 2139
            +     I   + L  +E + E  K  L+ +D +         FFN I++ I     II  
Sbjct: 270  LNSKSSI--QDYLYSLENIIEYLKNTLLERDSITIFNQIGNYFFNEIIKLIKSNTYIILE 327

Query: 2140 D-----FQRFYNNIAENLSDISEENNNLKQYLKNHF--FKNNHQELLNHHIDSTYEDIEK 2298
            D      +   + I   LS +S+ N ++ ++ ++      NN Q   N  +D  +E    
Sbjct: 328  DDGNDILKSQISKICNTLSFLSKRNTSIWKFDEDEITHLLNNRQLQSNLLVDKLFETKIT 387

Query: 2299 KTSEFVENFKNTLNDHLEENKKLIMQN---LTNATSAVINQEMDLFEPKRVKWENSFDLI 2469
               +F  N KN L DH+  +KK    N   L N  + V N E +        W  ++   
Sbjct: 388  TIRDFFNNPKNLLTDHIVPSKKNNNDNSSPLGNGKN-VSNTEAEDETNDEDDWNENW--- 443

Query: 2470 NKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXX 2649
            ++ D   N + + +   L  I N    +  SM    S+        ++            
Sbjct: 444  SEHDDDENAWGDEIDVDLESIANKSIKTKKSMKSIKSIKTSASTNGDDDDWDAWNDEVEI 503

Query: 2650 XXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNI 2829
                  + + +I K    N++ S    I+ I + Y T+   +K      N ++N  I N 
Sbjct: 504  DFDNQSIGQKSINKKIPNNNLNSDELLISGIPNFYKTLILSLK------NEIENAEIPNF 557

Query: 2830 LKE 2838
             +E
Sbjct: 558  SEE 560

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 76/383 (19%), Positives = 163/383 (42%), Gaps = 42/383 (10%)
 Frame = +1

Query: 1567 KNLNSDLESYKNEVQECKRDI---EXXXXXXXXXXXXXXXXXXTIQSQ-NSQMESLKLTI 1734
            + L S+L SY+N+V++   +I   E                  T+Q +    +     T 
Sbjct: 444  EKLGSELSSYENQVKDLNENIHSLEEKDKLNSNKLETITEEYKTLQQKLQDTLSQQSGTT 503

Query: 1735 NQLKAQLDKQHKTELEISGFNNKLQKLT----EIMQLALQDYKRRELDLNKKFETHISKE 1902
            N L  QL++    ++E+    ++L+  +    E +++ L++   ++L+ N K    +  +
Sbjct: 504  NDLNKQLEETRLAKIEVESQLDELKTSSISEKETLEIKLKE-TEQQLENNTKLVDELLAK 562

Query: 1903 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL---METMQEKAELMYKDCVK 2073
              SL+T L  +++ +E     Q T    + +I K +V  L   ++ ++EK E++  D + 
Sbjct: 563  KTSLETELHEKINSIELLK-KQNTESNDDSEINKAQVGQLKIEIQALKEK-EMVLNDSIN 620

Query: 2074 KILNESPKFFNVIVEK---IDIIRV------------------DFQRFYNNIAENLSDIS 2190
            K+ +++ ++     +K   +D  R+                  + +R + NI+   + I 
Sbjct: 621  KLEDKTEEWKMKYQDKCSDLDKNRLEVESLQMKCKNMEEEHLAELERVHANISLLQTLIE 680

Query: 2191 EENNNLKQYLK-NHFFK------NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHL 2349
            E N+N+    K N   K      N  +E +N ++    ++I    +E     +   N   
Sbjct: 681  ENNDNMNTLKKENELLKTGNSKTNRQEETMNENMTKMSDEINSLKTETTTLKEQLANKEQ 740

Query: 2350 EENK--KLIMQNLTNATSAVINQEMDLFEP-KRVKWENSFDLINKCDSMNNEFYNNMATT 2520
            E NK  KL+ ++L    S+   Q++ L +     K++   D +    ++ NE Y      
Sbjct: 741  EINKRLKLLAEDLYVQYSSKHEQKVKLLKKGYDSKYQTKIDQL----TLQNEGY---LQE 793

Query: 2521 LSQIKNTVDTSSNSMNKSISVMK 2589
            + Q+K  +    N   K + +++
Sbjct: 794  VDQLKKQLALERNEKQKVLQLLE 816

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 58/312 (18%), Positives = 125/312 (40%), Gaps = 19/312 (6%)
 Frame = +1

Query: 1735 NQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYK--RRELD-LNKKFETHISKEI 1905
            N  K   ++      +I+  N +L       +  + ++K  + E D L++K+ET I+   
Sbjct: 297  NSFKVISERNKDLIAQINNLNKELNISLSAQEQTIYNFKLLKAEYDGLSEKYETKIN--- 353

Query: 1906 KSLKTTLFSQLSGMEQNNISQET-NIQPNLDIIKNEVLTLME--TMQEKAELMYKDCVKK 2076
                      ++  E  NI  E  N    +D +K ++    +  +M  + + + ++   +
Sbjct: 354  ----------ITAEEMENIQTERENQNRKIDKLKKKISEYKDEISMLNQNQKILQNKYNQ 403

Query: 2077 ILNESPKF---FNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQY------LKNH 2229
              +ES K+      + +K+  +  D Q   NN+ + +SD  +  + L  Y      L  +
Sbjct: 404  TSDESEKWKLSHEEVNDKLQALEKDHQAVLNNLNQLISDKEKLGSELSSYENQVKDLNEN 463

Query: 2230 FFKNNHQELLNHH----IDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATS 2397
                  ++ LN +    I   Y+ +++K  + +     T ND    NK+L     T    
Sbjct: 464  IHSLEEKDKLNSNKLETITEEYKTLQQKLQDTLSQQSGTTND---LNKQL---EETRLAK 517

Query: 2398 AVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSI 2577
              +  ++D  +   +  + + ++  K      E    +   L   K +++T  +    SI
Sbjct: 518  IEVESQLDELKTSSISEKETLEIKLKETEQQLENNTKLVDELLAKKTSLETELHEKINSI 577

Query: 2578 SVMKGQVEESEN 2613
             ++K Q  ES +
Sbjct: 578  ELLKKQNTESND 589

>TPHA0E03680 Chr5 (779557..780873) [1317 bp, 438 aa] {ON} Anc_1.46
            YCL029C
          Length = 438

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 45/199 (22%), Positives = 90/199 (45%), Gaps = 9/199 (4%)
 Frame = +1

Query: 2002 KNEVLT--LMETMQEKAELMYKDCV--KKILNESPKFFNVIVEKIDIIRVDFQRFYNNIA 2169
            + +V+T  L++  ++K E  +   V  KK+L+E       +   IDI   +     N IA
Sbjct: 177  RRDVVTDKLIKEYEQKIEKQFNQLVQYKKLLDEQRVVLEEMKPTIDIYENNLVSSENEIA 236

Query: 2170 ---ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN--T 2334
               E L+   EEN+  K+Y     F+N H++LL   +D  +++I++     + + +N   
Sbjct: 237  SLKEQLNKEREENDKQKKY-----FENEHEQLL-RVVDQLHDEIKENERRVIASKQNMKM 290

Query: 2335 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 2514
             + H +E    +++ L       + +     E  ++KWE   D +   +S  N+ Y  + 
Sbjct: 291  SSGHTDET---VLRELEE-----LREYKQTNETNKLKWEKERDQLKMHNSSLNKEYQELY 342

Query: 2515 TTLSQIKNTVDTSSNSMNK 2571
               S++++    +    NK
Sbjct: 343  KDFSRMESIQRENETLRNK 361

>NDAI0G05870 Chr7 (1456354..1457745) [1392 bp, 463 aa] {ON} Anc_1.334
            YJL049W
          Length = 463

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 60/282 (21%), Positives = 117/282 (41%), Gaps = 7/282 (2%)
 Frame = +1

Query: 1399 LEYASKAKNIKNKPQLGAFIM-----KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 1563
            L Y S+ K+I N  ++   I         ++K+ T+E+ +    +L+ KS  GIY  +  
Sbjct: 200  LFYLSRYKHIINHDEINDIIKIIAPAASHILKSFTIEITENDRQILNVKS--GIYNLERQ 257

Query: 1564 YKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQL 1743
             K L +DLE Y   ++  K + +                    +    Q+   +  +  +
Sbjct: 258  IKKLENDLEVY--SLKTAKENWDAFRKLPIASQREHIKAKKLSERYLDQLLKYRNNLLTI 315

Query: 1744 KAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 1923
            K QLD      +     +N  + L  +        K  EL  N + +T  + EI  L   
Sbjct: 316  KNQLDLSSTNAILFDTLSNSHELLKSMNNYMGSAEKIDELLQNIEEQTEQTDEINKL--- 372

Query: 1924 LFSQLSGMEQNNISQETNIQPNL-DIIKNEVLTLMETM-QEKAELMYKDCVKKILNESPK 2097
                        ++ E  + P L D I+ E+ T+ E + QE+ E   K+ V + + E+ +
Sbjct: 373  ------------LTNEETLTPGLADEIEKELQTMEEQLSQERGEEATKEHVNEEIKENAE 420

Query: 2098 FFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
               ++++K+  +++D +   N + E    + ++  NL+Q  K
Sbjct: 421  -TELLLDKLKDLQIDDK---NQLNEGEEKVHQDERNLEQESK 458

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 79/448 (17%), Positives = 183/448 (40%), Gaps = 30/448 (6%)
 Frame = +1

Query: 1744 KAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 1923
            K   +   + + E S   +KL  L E  +  LQ+   +   L  ++E + S+E KSL   
Sbjct: 693  KISFEAFERLQSECSTLKSKLNVLEETSETQLQELTSKLDSLTNEYEKY-SEENKSLGLK 751

Query: 1924 LFSQLSGMEQ--NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPK 2097
            +   L   ++   +++Q +     L++ + ++LT  +  +   E    + +K  LN+S +
Sbjct: 752  ISDLLESNKKLHKDVNQASQTIEELNVEREKLLTSRDEYKNDTET---NSLK--LNKSME 806

Query: 2098 FFNVIVEKIDIIRVDFQRF---YNNIAENLSDISEENNNLKQYLKNH-----------FF 2235
              +V+ +++  IR + ++     N ++  L  +++EN NLK+  K +             
Sbjct: 807  RISVLEKELKDIRAEKKKAEDGINKMSRELFSLTKENQNLKESQKRNEKERKKEADELSE 866

Query: 2236 KNNHQELLNHHIDSTYEDIE---KKTSEFVENFKN--TLNDHLEENKKLIMQNLTNATSA 2400
            K    E++   +++   + +   K+ +E+   F++  TL   L E  + + +N       
Sbjct: 867  KRRSLEIITKQMEALQSEKQITLKELNEWKSKFQSCETLLPKLTEKLRSLAENFKETEDE 926

Query: 2401 VINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSIS 2580
                   L   K  + +N  +L    + ++NE        L+            +N+++ 
Sbjct: 927  RDKLAKTLESIKLERDKNVAELKEAVEKLSNE-----KAELASDNEKKSLQIKQLNQAVE 981

Query: 2581 VMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDT 2760
             ++ + E   +A S                N  + L+  +E+  T TH      D++ + 
Sbjct: 982  EIERKFEAENHATSQNRTEME---------NNLSKLRTEVESMETRTHELTKKNDELQEE 1032

Query: 2761 IENIM-------KNYGNKENAVK--NEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILS 2913
            I+                E A++     + ++L++  SL + +  +  +   N  +   +
Sbjct: 1033 IKKYQTAQTESTSTLSKIETALQESESKLADVLEQNKSLRQSLESQTKSFGENLEKLSNA 1092

Query: 2914 PKKHAIDDENPSNEITDGEESRKIQKTE 2997
             + HA+D +  ++  T+ +E ++  K E
Sbjct: 1093 EQAHAMDADRINSLQTEIDERKEKYKRE 1120

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 116/623 (18%), Positives = 228/623 (36%), Gaps = 74/623 (11%)
 Frame = +1

Query: 973  ITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLA 1152
            +  +ME +++L++ LK  +    K  D  +            K   ELF ++K N     
Sbjct: 801  LNKSMERISVLEKELKDIRAEKKKAEDGIN------------KMSRELFSLTKEN----- 843

Query: 1153 GSENINRSGALNQ--RAKEAGSINQ---SLLTLGRVINALADKSGHIPFRE--------- 1290
              +N+  S   N+  R KEA  +++   SL  + + + AL  +   I  +E         
Sbjct: 844  --QNLKESQKRNEKERKKEADELSEKRRSLEIITKQMEALQSEK-QITLKELNEWKSKFQ 900

Query: 1291 ------SKLTRLLQDSLGGNTKTA------LIATISPAKVTSEETCSTLEYASKAKNIKN 1434
                   KLT  L+ SL  N K        L  T+   K+  ++  + L+ A +  + + 
Sbjct: 901  SCETLLPKLTEKLR-SLAENFKETEDERDKLAKTLESIKLERDKNVAELKEAVEKLSNEK 959

Query: 1435 KPQLGAFIMKDILVKNITMELAKI--KSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEV 1608
                     K + +K +   + +I  K +  +  + +     +++   L +++ES +   
Sbjct: 960  AELASDNEKKSLQIKQLNQAVEEIERKFEAENHATSQNRTEMENNLSKLRTEVESMETRT 1019

Query: 1609 QECKRDIEXXXXXXXXXXXXXXXXXXTIQS-QNSQMESLKLTINQLKAQLDKQHKTELEI 1785
             E  +  +                  T+   + +  ES     + L+     +   E + 
Sbjct: 1020 HELTKKNDELQEEIKKYQTAQTESTSTLSKIETALQESESKLADVLEQNKSLRQSLESQT 1079

Query: 1786 SGFNNKLQKLTEIMQLALQDYKR-----RELDLNK----KFETHISKEIKSLKTTLFSQL 1938
              F   L+KL+   Q    D  R      E+D  K    +  T + + IK L+  + +  
Sbjct: 1080 KSFGENLEKLSNAEQAHAMDADRINSLQTEIDERKEKYKRESTKLEENIKELQRQITNNT 1139

Query: 1939 SGMEQNNISQETNIQPNLDII-----------------KNEVLTLMETMQEKAELMYKDC 2067
            + +   N + +   Q N  +                  K + L L +T+ E  E   +  
Sbjct: 1140 TTIAGLNKAIDQERQTNARLASELEETRKDKEISNSQAKEDALQLSKTIDELRE--ERKG 1197

Query: 2068 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHF----- 2232
            ++  L E+      +V ++D ++V       NI E L    E  ++    +K  F     
Sbjct: 1198 LEDGLAETKLNNTNLVSELDALKVTVGEKNGNIQE-LEKKKETASSALSKIKADFDETEK 1256

Query: 2233 -FKNNHQELLNHHIDSTYEDIEKKTSEFVENFK----------NTLNDHLEENKKLIMQ- 2376
              K   Q L   H +   +D +K+   F E             NTL + +  ++K I + 
Sbjct: 1257 RLKAQIQSLQTKH-ERKVQDFDKERQLFAEGSDMVTQEYSKKINTLEEQISVSEKQIEEV 1315

Query: 2377 --NLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 2550
               L  +   V N + D    ++       D+  K +S+ +   ++      ++    D 
Sbjct: 1316 KSQLQASEKTVRNLKSDSIASQQTN-----DI--KVESLKSALASSEKQA-KEVTQKYDK 1367

Query: 2551 SSNSMNKSISVMKGQVEESENAV 2619
               S +++ S +KGQ+E    AV
Sbjct: 1368 LKTSSDENASSLKGQIERLTEAV 1390

>Smik_15.457 Chr15 complement(788706..790682) [1977 bp, 658 aa] {ON}
            YOR275C (REAL)
          Length = 658

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 64/286 (22%), Positives = 112/286 (39%), Gaps = 42/286 (14%)
 Frame = +1

Query: 1825 MQLALQDYKRRELDLNKKFETHISKEIK-------------------SLKTTLFSQLSGM 1947
            +Q+ALQ     +L    KF+T I   +K                   S+K  L  + S  
Sbjct: 260  LQMALQFINESKLSSQAKFKTVIESSLKEAQRDNDFIYLQQVPSELPSIKPALMVKPSST 319

Query: 1948 EQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCV-------KKILNESPKFFN 2106
                 S E ++Q   D+I  EV+       E+ +   +  V        K+L ES   F 
Sbjct: 320  STLLPSIENDVQLFKDLIPIEVMEYCTAYNERQDEYVEQRVTNPLISLNKLLKESMTTFE 379

Query: 2107 VIVEKIDIIRVD---FQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDS 2277
            +  E I +   +   +Q   NN+  N  ++  E + ++Q L +  F +N   L +  +  
Sbjct: 380  IPQELITVSEAELSQYQTLLNNLHTNNKNVQTELDKIEQILNDEAFTDNQLRLKHGTLHW 439

Query: 2278 TYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQN---LTNATSAVINQEMDLFEP----- 2433
               +     +++ E   NTL  +L +   +  Q      +    +I  E+ L EP     
Sbjct: 440  VLPESSTINTKYYEKL-NTLKGYLGQGSAIDKQTDNFFQSIDKNLITSEIRLPEPNDPLT 498

Query: 2434 ---KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKN--TVDTSS 2556
               K+V  E + + I K    ++E Y  ++  +S  KN  T+D  S
Sbjct: 499  NKIKKVMQERN-EYIKKTKRKSSE-YRVLSKIISSYKNSGTIDFES 542

>Skud_4.424 Chr4 complement(755616..758534) [2919 bp, 972 aa] {ON}
            YDR166C (REAL)
          Length = 972

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 59/247 (23%), Positives = 105/247 (42%), Gaps = 3/247 (1%)
 Frame = +1

Query: 2095 KFFNVIVEKIDIIRVDFQRFYNNIAENL-SDISEENNNLKQYLKNHFFKNNHQELLNHHI 2271
            K FNV     D+ + D     NN  + L SDI +++ NLKQ + N+F K      + + +
Sbjct: 109  KQFNVKAFLRDMHKQDSFNDLNNSLDKLDSDIQDQSVNLKQLVGNNFTK---YVKIKNKL 165

Query: 2272 DSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE 2451
            D  Y++ ++KT+E ++      N    E+    +  +   T+  +   MD ++ K + ++
Sbjct: 166  DQIYKEFDEKTNEKIQVDSPKENQINVESLNKKVDEVIRTTTFKLKPLMDNYQ-KILNYQ 224

Query: 2452 NSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNK-SISVMKG-QVEESENAVSX 2625
             +   I +      +FY N+   L +  N     +N+ N+  I   KG  +    N  S 
Sbjct: 225  ATKKFIER-----YKFYFNLPKCLKKCLN-----NNNFNEFMIQYSKGLTICRDFNQNSD 274

Query: 2626 XXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV 2805
                           N   I KD I NS+ ++     N+D   +TI ++     N EN +
Sbjct: 275  TSQSLIIKRIWSQVENLLIIYKDLIWNSLMNSD---FNVDQPQETILSLFSKLLNLENFI 331

Query: 2806 KNEMIDN 2826
             N   +N
Sbjct: 332  NNNQNEN 338

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 48/254 (18%), Positives = 100/254 (39%), Gaps = 27/254 (10%)
 Frame = +1

Query: 2137 VDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQ-------ELLNHHIDSTYEDIE 2295
            VD Q+ YN + + L  ++EE  N+ + LK    K+N          L  H +D     + 
Sbjct: 678  VDIQQ-YNTLKKELLAMNEEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMN 736

Query: 2296 KKTSEFVENFKNTLNDH---LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDL 2466
             + S  ++N    + +    LE++ K  M   ++  + +     D+ +  + K     +L
Sbjct: 737  SEPSLMMQNRNGEIENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKEL 796

Query: 2467 INKCDSMN-------------NEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEES 2607
              +   +N             N+ Y  +     QI N +DT + S++ ++  ++ ++EE 
Sbjct: 797  KAEVHELNEQIKDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEE 856

Query: 2608 ENAVSXXXXXXXXXXXXXXXVNKHTILKD----NIENSITSTHSHITNIDDIYDTIENIM 2775
                                +NK     +    +++N +      I+NIDD  + +E  +
Sbjct: 857  ------------------IKINKMLKTSEEELMSVQNDLNVERKRISNIDDELEELERTI 898

Query: 2776 KNYGNKENAVKNEM 2817
            K     +N  + E+
Sbjct: 899  KQKEESKNTYELEL 912

 Score = 42.4 bits (98), Expect = 0.008
 Identities = 65/380 (17%), Positives = 143/380 (37%), Gaps = 31/380 (8%)
 Frame = +1

Query: 1891 ISKEIKSL---KTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYK 2061
            + KE+ ++   K  +  QL  +E  + ++ +N+Q  L + K+ +  L  TM  +  LM +
Sbjct: 686  LKKELLAMNEEKQNIHKQLKILEAKS-NETSNLQKELSLKKHRLDILERTMNSEPSLMMQ 744

Query: 2062 DCVKKILNESPKFFNVIVEK----------IDIIRVDFQRFYNNIAENLSDISEENNNLK 2211
            +   +I NE     +   +K          I+ +R D   F  N    L ++  E + L 
Sbjct: 745  NRNGEIENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELN 804

Query: 2212 QYLKN------------HFFKNNHQELLNH------HIDSTYEDIEKKTSEFVENFKNTL 2337
            + +K+               K   +++ N        +DST +DIEKK  E ++     +
Sbjct: 805  EQIKDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIK-----I 859

Query: 2338 NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 2517
            N  L+ +++ +M          +  ++++   +    ++  + + +      E  N    
Sbjct: 860  NKMLKTSEEELMS---------VQNDLNVERKRISNIDDELEELERTIKQKEESKNTYEL 910

Query: 2518 TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDN 2697
             L Q+ + +    NS +     +    EE E                   VN++    + 
Sbjct: 911  ELKQLHHDLSKYKNSTDGIEKALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRMEQ 970

Query: 2698 IENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLS 2877
            ++ +       +    +I + IE++ K         K E +  +++ I    K++   +S
Sbjct: 971  LQKNFDELRRKVN--PNIMNMIESVEK---------KGEALKTMIRTIEKDKKKIEDTIS 1019

Query: 2878 NTNGNSAQNILSPKKHAIDD 2937
              N    + ++   K    D
Sbjct: 1020 KLNEYKKETLVKTWKKVTKD 1039

>TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1504

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = +1

Query: 1954 NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDII 2133
            NN +  +N   N++   ++ LTL    +E +   Y +  +  ++  PK     V ++   
Sbjct: 348  NNNNSNSNGNSNVNSNSSDPLTLNNLNEEISRQKYLEFAENFISSHPKIAEEYVSRL--- 404

Query: 2134 RVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEF 2313
             ++F     N+ +NL  I+ +N N    L+++  +N + + LN  ID+   + +  TS  
Sbjct: 405  -MEFPEM-RNLTDNL--INHKNRNFLNSLESYLLQNQNFDSLNDSIDTLTSNNDSSTSAL 460

Query: 2314 VENFK----NTLNDHLEENKKLIMQNLTNATSAVINQEMDLFE 2430
               F+    N L + L  N  L  +   N    V  + +D ++
Sbjct: 461  NSTFEADTANKLREILNSNNPLTPEQYANLLRHVAIKVIDSYD 503

 Score = 39.3 bits (90), Expect = 0.069
 Identities = 49/241 (20%), Positives = 100/241 (41%), Gaps = 23/241 (9%)
 Frame = +1

Query: 2158 NNIAENLSDISEENNN-----LKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVEN 2322
            N+I +N  DI  +NN      L+   + H   +  +E+L+       + ++  T++ +  
Sbjct: 223  NSIEDNSRDIKHDNNGDYNGLLRIGNRQHAVDSLRKEILHFKESKQKQVLQNNTNQHING 282

Query: 2323 FKNT-LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLI---NKCDSMN 2490
             ++   N++LE+   +  QN  +  +   N    +  P      ++       N  +S N
Sbjct: 283  NESIHTNNNLEQPNNVSKQNGVSNNNNNNNTATTITTPNATTTASTTTTTTNNNNNNSNN 342

Query: 2491 NEFYNNMATTLSQIKNTVDTSS------NSMNKSISVMKGQVEESENAVSXXXXXXXXXX 2652
            N   NN   + S   + V+++S      N++N+ IS  K  +E +EN +S          
Sbjct: 343  NNNNNNNNNSNSNGNSNVNSNSSDPLTLNNLNEEISRQK-YLEFAENFISSHPKIAEEYV 401

Query: 2653 XXXXXVNKHTILKDNI-----ENSITSTHSHIT---NIDDIYDTIENIMKNYGNKENAVK 2808
                   +   L DN+      N + S  S++    N D + D+I+ +  N  +  +A+ 
Sbjct: 402  SRLMEFPEMRNLTDNLINHKNRNFLNSLESYLLQNQNFDSLNDSIDTLTSNNDSSTSALN 461

Query: 2809 N 2811
            +
Sbjct: 462  S 462

>TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {ON} 
          Length = 623

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 72/365 (19%), Positives = 153/365 (41%), Gaps = 10/365 (2%)
 Frame = +1

Query: 1897 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL-METMQE--KAELMYKDC 2067
            K+I++L+ TL +Q   +  ++  +  +IQ  +   + E+  + +E  +E   ++ + K  
Sbjct: 283  KQIRALRRTLRNQTQKVGNDSSPEIIDIQQKIINCRQELKQIELENKREMKSSKTLQKQI 342

Query: 2068 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNH 2247
            +K++      F  + +EK     V+     NN  +N   ++++  N++   K        
Sbjct: 343  IKELEEHLQLFLKMKIEK----GVEG----NNRQKNNKKVAKQPKNIESSSKK------- 387

Query: 2248 QELLNHHIDSTYEDIEKK--TSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMD 2421
             + L   I  T E +EKK  T+      K+  ++    N+ +   N+ N TS+ +N    
Sbjct: 388  SKKLPTKIPDTSEKLEKKIITNNKKLKPKDRSSNISNNNEPISEDNIKNKTSSNVNYA-- 445

Query: 2422 LFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVE 2601
                      N+++  NKCD++NN    N+ TTLSQ  ++   ++ S + +  V +   E
Sbjct: 446  ---------NNNYN--NKCDNLNNS--ENVRTTLSQSSDSKTKNNKSKSDTRKVQELTEE 492

Query: 2602 ES-----ENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 2766
            ++     +  +S                ++    K N+   +  T  H  + +D  + IE
Sbjct: 493  QALGLNRQEIISIDNENLHITEKKSRTSDRKNNRKKNV---VLQTEDHTNDTND--NAIE 547

Query: 2767 NIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENP 2946
            N   N+ N+ +  K       + ++ SL+ R     +     +  +     K +   +N 
Sbjct: 548  N--TNHKNRRSGKK-------IPDVVSLNNRSSTSTNENIHRNNTDYTKKTKKSNKKKNR 598

Query: 2947 SNEIT 2961
             N++T
Sbjct: 599  DNKVT 603

>KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} similar
            to uniprot|Q07457 Saccharomyces cerevisiae YDL074C BRE1
            E3 ubiquitin ligase for Rad6p required for the
            ubiquitination of histone H2B recruitment of Rad6p to
            promoter chromatin and subsequent methylation of histone
            H3 (on L4 and L79) contains RING finger domain
          Length = 663

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 76/335 (22%), Positives = 137/335 (40%), Gaps = 24/335 (7%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDL 1869
            IQ  N+Q+ESLK T+  L++                 K    TEI +L      R EL  
Sbjct: 236  IQDLNNQIESLKQTLKDLESW----------------KASSETEIAKL------RTELAS 273

Query: 1870 NKKFETHISKEIKSLKTTLFSQLSGMEQNN----------ISQETNIQPNLDIIKNEVLT 2019
            N       S+ I++ + TL  +L  + + N          +S+   +  + +I  N++  
Sbjct: 274  NSSACEQTSRSIQNDRETLLHKLDLVTKENAELAQANDLYLSKFQQMVQDKEIFTNKLSL 333

Query: 2020 LMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR--FYNNIA-------- 2169
              +T Q        D +KK         N ++EK D++R+   R    + IA        
Sbjct: 334  EFQTAQ--------DALKK--------HNAMLEK-DLVRIRATRDELTSRIAILESQKPK 376

Query: 2170 -ENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 2346
             E L+D+ +  +  K+ ++    +N   E  N  +    +D+E+   E  +      +DH
Sbjct: 377  SELLADLQKVLDLQKERIEK--MENKPVETTNDAVMKELQDLERAFKELTQLAHKKYSDH 434

Query: 2347 LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLS 2526
            + + + ++ +     T A    +   F   R K  +S  + NK  S N    N +   L 
Sbjct: 435  ISQ-ESIVSKLTVEKTKA----DQKYFTAMRSK--DSILIENKNLSKNLHKSNELINQLK 487

Query: 2527 QIKNTVDTSSNSMNKSISVMKG---QVEESENAVS 2622
            +I+ T+ +   S+NK I + +    ++ ES  AVS
Sbjct: 488  EIERTLQSKVESLNKQIHLSQSNEKRLMESSKAVS 522

>NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {ON}
            Anc_4.364 YJR134C
          Length = 707

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 74/388 (19%), Positives = 155/388 (39%), Gaps = 26/388 (6%)
 Frame = +1

Query: 1495 LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE-------CKRDIEXXXXXXX 1653
            L K K D+++    EG  +S+  ++  +++L+S KNE  +        K D+E       
Sbjct: 146  LIKEKDDIINQLRTEGENLSKSDFRK-STELKSLKNEYTDLQTQLTAAKNDLEEKDIDLK 204

Query: 1654 XXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQL 1833
                       ++     ++ SL    ++L     + ++ +++I+    KL   T  +  
Sbjct: 205  NIKMANASLEKSLTESTVKISSLLKETDELAHLQSQLNEKDVKINELTEKLTSSTTSLND 264

Query: 1834 ALQDYKRRELDLNKKFETHI---SKEIKSLKTTLFSQLSGMEQNNI--------SQETNI 1980
             + +++     L K    HI      I+ L+  L +    +   NI        +Q+T  
Sbjct: 265  TILNHQSEIDSLKKTNNDHILTLESTIEKLRIELENVNDEITSTNILGNPIRTNTQDTTG 324

Query: 1981 QPN--LDIIKNEVLTLMETMQEKAELMYKDCVKKI---LNESPKFFNVIVEKIDIIRVDF 2145
             P    +I++N+  +  E   E  E      +  +   LN+S K    + + ++ +R + 
Sbjct: 325  HPRDQYEILQNQFKSSKENW-ESIEFSLNSKITNLNSTLNDSKKDIVKLNKDLEQLRTEK 383

Query: 2146 QRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENF 2325
             +    + + L++  E+N  LK+ +KN   K ++     H     Y  ++KK +      
Sbjct: 384  TK----LVKQLNNEREQNEELKEQIKNLNLKIDNLNNALHTRTEDYSLLQKKFNIQKSQL 439

Query: 2326 KNTLNDH---LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNE 2496
            +N +          + LI +N   + S+ I+ +  L    + +W NS          N++
Sbjct: 440  QNNIGTQEVPSNSGELLIPKNKNYSISSKISSD-SLMRNLQEEWLNSDIPFGGNPDNNSD 498

Query: 2497 FYNNMATTLSQIKNTVDTSSNSMNKSIS 2580
              N+    L  I N+V   ++    S+S
Sbjct: 499  LEND---NLDNIDNSVILHTDDKEGSVS 523

>KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {ON}
            weakly similar to uniprot|P39723 Saccharomyces cerevisiae
            YAL047C SPC72 Component of the cytoplasmic Tub4p
            (gamma-tubulin) complex binds spindle pole bodies and
            links them to microtubules has roles in astral
            microtubule formation and stabilization
          Length = 776

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 86/408 (21%), Positives = 165/408 (40%), Gaps = 18/408 (4%)
 Frame = +1

Query: 1213 INQSLLTLGRVINA---LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 1383
            +N S L    V+++   LA ++ H  + +   +  L+     N + AL       K+  E
Sbjct: 364  LNDSRLDNSEVLDSKLELAIETMHEKYHDFLQSIQLKLEKNDNLEKALKDKFQQQKLLLE 423

Query: 1384 ETCSTLEYASKAKNIK----NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM 1551
             + S +E+   ++ I      + Q   F   D L K  ++EL+K                
Sbjct: 424  -SMSNIEHERTSQQIPPLYLQRSQSDLFSSIDDLSKRASIELSK---------------S 467

Query: 1552 SQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLT 1731
             QDH   LNS L++YK E+++ ++ +                   T     ++++   LT
Sbjct: 468  YQDHVDALNSMLQNYKRELEDKEKQL-----GELRSQLRNSYNTNTELDLANKIKEQSLT 522

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS 1911
            + +  A   + H   +E       LQ   + +   L D + +   L  + E  + +  K 
Sbjct: 523  LEENSA---RWHTQRIEYESRIEVLQDEKKDLSQKLIDAQAQMQMLEARTEEDVMELRKK 579

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLD--IIKNEVLTLMETMQEKAELMYKDCVKKILN 2085
            LKT L      M+ N + QE   +   D  I+++E++ L E + + ++           +
Sbjct: 580  LKTALRKSTYYMDDNQLLQEQLEELGNDHHILQDEIIKLREHVNKFSD----------AD 629

Query: 2086 ESPKFFNVIVEK-IDIIRVDFQRFYNNI-AENLSDISEENNNLKQYLKNHFFKNNHQEL- 2256
            +  +   +I  K +D +R  F  F   +  E++     + +NL+Q     FFK    +L 
Sbjct: 630  KGSQQLTIIKSKLLDHLRAIFGSFEKVLQKESIDQAFNKLHNLEQLDSAKFFKKTIAKLD 689

Query: 2257 -LNHHIDSTYEDIEKKTSEFVENFK-----NTLNDHLEENKKLIMQNL 2382
             +   I+S  E I  +  + + N K     ++ ND +E+  KL +  L
Sbjct: 690  SVFFFIESAIESIVTEHVDLLLNEKEEWSGSSQNDEVEKQSKLKIDEL 737

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
            to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
            involved in control of spindle dynamics
          Length = 816

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 72/334 (21%), Positives = 135/334 (40%), Gaps = 22/334 (6%)
 Frame = +1

Query: 1462 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQ--DHYKNLNSDLES------YKNEVQEC 1617
            KD+L      EL K   D +S++      +S   +     NS LE       YK E +E 
Sbjct: 473  KDLLKSEQITELEKKLQDAISSQKNTNTELSLKVEELLKTNSSLEKDAITWKYKLESREI 532

Query: 1618 --KRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL----DKQHKTEL 1779
              K  +E                   I+   S++  +++  + LK       D       
Sbjct: 533  ELKTTLEGKEKELANATSTLSKYESQIRELRSELTDVEMKYSTLKKSFEDVDDDAKIRSA 592

Query: 1780 EISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNN 1959
            E++  N K+  L E ++      + ++  +NK  E   SK+ +  KT L  +   ++ NN
Sbjct: 593  EVTELNYKIDDLREKVENLESSLQEKDDYINKLKEELQSKKDEHSKTLLELESVHLKNNN 652

Query: 1960 ISQETNIQPNLDIIKNEVLTLMETMQEKAELM--YKDCVKKILNESPKFFNVIVEKIDII 2133
            I +E   +  L+ +   +  L E ++ K   +   KD + K+ +E  ++ +  V K +  
Sbjct: 653  IEKEHLAE--LEGLHESLSHLEEELKSKTICVNDMKDEISKLEDEKKEYLS-SVSKQNTT 709

Query: 2134 RVDFQRFYN--NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYED-IEKKT 2304
             ++ +   N  N+   +  + ++ NN +Q       KN   + L+  +   Y    E+K 
Sbjct: 710  SINTEGIMNLQNLQREIDQLRDKLNNSEQE------KNKQLQQLSDDLYVQYSSKHEQKV 763

Query: 2305 SEFVENFKNTLNDHLEENK---KLIMQNLTNATS 2397
                +N++ T   +LEE K   K  +Q +   TS
Sbjct: 764  KMLKKNYEATYKKNLEELKMQNKSYIQEIKQLTS 797

 Score = 37.0 bits (84), Expect = 0.32
 Identities = 84/461 (18%), Positives = 163/461 (35%), Gaps = 43/461 (9%)
 Frame = +1

Query: 1729 TIN-QLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEI 1905
            T+N +    +DK H   LEI   N +L          L D   +  +L+ +F+ H     
Sbjct: 279  TVNSEYNTDIDKAHSVSLEILRRNEELANEVHKTNTDLNDCLMKLENLSYEFQKH----- 333

Query: 1906 KSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILN 2085
                                            K + L   E + EK E +          
Sbjct: 334  --------------------------------KEQSLVDQERLTEKTEELEDS------- 354

Query: 2086 ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNH 2265
                     +EK+ ++R   +    N+A     + E+ + +K         N +Q +L H
Sbjct: 355  ---------LEKLTVLR---EELSTNVANLEKQLHEKQDEIKML-------NQNQSILQH 395

Query: 2266 HIDSTYEDIEKKTSEF----------VENFKN-------------TLNDHLEENK---KL 2367
            + D   ED +K   E+          +E+ +N             TL   + EN+     
Sbjct: 396  NFDKKLEDEQKAREEYIIIQNEKDKAIEDLRNCKGKVEELESEIITLKTQINENEDWNSK 455

Query: 2368 IMQNLTNATSAVIN-QEMDLFEPKRV-KWENSF-DLINKCDSMNNEF----YNNMATTLS 2526
            ++Q  TN  + V N +E DL + +++ + E    D I+   + N E        + T  S
Sbjct: 456  LLQEKTNLEAQVKNIEEKDLLKSEQITELEKKLQDAISSQKNTNTELSLKVEELLKTNSS 515

Query: 2527 QIKNTVDTSSNSMNKSI---SVMKGQVEESENAVSXXXXXXXXXXXXXXXVN----KHTI 2685
              K+ +       ++ I   + ++G+ +E  NA S               +     K++ 
Sbjct: 516  LEKDAITWKYKLESREIELKTTLEGKEKELANATSTLSKYESQIRELRSELTDVEMKYST 575

Query: 2686 LKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV--KNEMIDNILKEIPSLSKR 2859
            LK + E+           + ++   I+++ +   N E+++  K++ I+ + +E+ S    
Sbjct: 576  LKKSFEDVDDDAKIRSAEVTELNYKIDDLREKVENLESSLQEKDDYINKLKEELQSKKDE 635

Query: 2860 VPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRK 2982
                L        +N    K+H  + E     ++  EE  K
Sbjct: 636  HSKTLLELESVHLKNNNIEKEHLAELEGLHESLSHLEEELK 676

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 122/675 (18%), Positives = 254/675 (37%), Gaps = 42/675 (6%)
 Frame = +1

Query: 1036 STKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSI 1215
            +TK+ D + +  +I      K+H  EL  +S+ N   +   ++      L Q+       
Sbjct: 931  TTKLKDIAEKYKSIEQAKASKEH--ELAEVSESNQTKILSLQS--EIVELRQQYDSMKHD 986

Query: 1216 NQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 1395
              ++LT  + +    + +       +   + L+  L  ++K      I     +SEE   
Sbjct: 987  KDNMLTETKKLKKSLEDAERSRSEAAYEIKQLKSELDHSSKE-----IEQLNSSSEEKSK 1041

Query: 1396 TLEYA----SKAKN-IKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 1560
             L  A    +KA+N +++  +  A     +  +  T+E  + K   L   S E I   + 
Sbjct: 1042 NLADAVNTFNKARNELESLNKTLAEANDKLRSRESTIESLEEKLQELKKSSDEKIASLEK 1101

Query: 1561 HYKNLNS------DLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESL 1722
              K+L        DLE  K++ Q+   D++                      +N+  ESL
Sbjct: 1102 SRKDLEKFQQKFRDLELEKSKTQDALTDLQKALQ----------------DEKNNHQESL 1145

Query: 1723 KLTINQLKA-QLDKQHKTEL------EISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 1881
            +L  +++K   L+K++  E       E+S     ++ L +  +L  +DY+++  +L KK 
Sbjct: 1146 QLQKDKIKQLALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKT 1205

Query: 1882 -----ETHIS-KEIKSLKTTLFSQLSGMEQ------------NNISQETNIQPNLDIIKN 2007
                 E+ +  +E+ +L T L    S  E+             NI  E   +   +  K+
Sbjct: 1206 VSLQDESSLRLQEVSALNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSKVKQEKEKD 1265

Query: 2008 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 2187
              + +++   + A+    D V K+     +  N  + K+  I+ +F+       +   D 
Sbjct: 1266 SRILVLDKEMKSAKTDLSDIVHKL-----EASNSEIAKLQEIKAEFESQELEGKKQKEDF 1320

Query: 2188 SEENNNLKQYLKNHFFK-NNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 2364
              E   L+  LK    +    +++LN    +  ++  +K S+  E  ++  + H  ++++
Sbjct: 1321 DAEIKTLRAKLKEKSAEVEKERKMLNEGSSNLEQEYSRKISQLEEELESLESKHSLKHQE 1380

Query: 2365 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 2544
                N     S ++ +     E    +     + + +      E   +      Q+ +  
Sbjct: 1381 --SDNEKRKLSGLLKKS----ESSATEKNRELECVRESMKKLRESLKDKEQQSEQLSSLQ 1434

Query: 2545 DTSSNSMNKSISVMKGQVEES-ENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITST 2721
             T S+ M + + +   ++EE+ E                   V K   LKD   N ++  
Sbjct: 1435 KTQSDKMREELGLANQKLEEAREKGRKHKENLEVALSQKASEVKK---LKDQALNYLSKL 1491

Query: 2722 HSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSK----RVPLRLSNTNG 2889
                  I++    +E   ++     + +K+ M   I K   +LSK    R  LRL     
Sbjct: 1492 DEKEAIINESKVQLETAKRD----SDELKSSMDSKIKKSQETLSKAENERDQLRLELDLS 1547

Query: 2890 NSAQNILSPKKHAID 2934
                 + + + H +D
Sbjct: 1548 KEKLEVNNQRLHELD 1562

 Score = 40.8 bits (94), Expect = 0.024
 Identities = 97/554 (17%), Positives = 215/554 (38%), Gaps = 24/554 (4%)
 Frame = +1

Query: 1297 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 1476
            L +L+Q       + AL+ +   +K   E+   +LE   KA       +  A    ++ +
Sbjct: 702  LEKLIQQKT--QLEEALLKSEESSKGQIEDLNRSLEELQKALKSTEDEKKAA----ELDL 755

Query: 1477 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXX 1656
            +N+      ++ +   TK +  +   +      NSDL +  ++++  K+D+E        
Sbjct: 756  ENVRASFKNLEDNYSGTKEELNLLQKE------NSDLVATNSKIENTKKDLELKFNNNRD 809

Query: 1657 XXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLA 1836
                       +  Q    E     +N+    L ++H  EL+ +   +K  +L +++  +
Sbjct: 810  ALTKLEKELSIVCEQKKAAEDGINKMNRELLVLSREH-NELKNTSTKSK-NELEKVLAAS 867

Query: 1837 LQDYKRRELDLNKKFETHISK------EIKSLKTTLFSQLSGMEQNNISQETNIQPNLDI 1998
             ++ KR + D  ++ ++ I K       +KS    L  +     +N+   ++ +  N ++
Sbjct: 868  NEELKRLQ-DFTREKDSSIEKSRAELERLKSENKALLLEKDNASRNSAELKSRL-ANQEL 925

Query: 1999 IKNEVLTLMETMQEKAELMYKDCVKK--ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAE 2172
            + +++ T ++ + EK + + +    K   L E  +     +  +    V+ ++ Y+++  
Sbjct: 926  LVSKLTTKLKDIAEKYKSIEQAKASKEHELAEVSESNQTKILSLQSEIVELRQQYDSMKH 985

Query: 2173 NLSDISEENNNLKQYLKN---------HFFKNNHQELLN-----HHIDSTYEDIEKKTSE 2310
            +  ++  E   LK+ L++         +  K    EL +       ++S+ E+  K  ++
Sbjct: 986  DKDNMLTETKKLKKSLEDAERSRSEAAYEIKQLKSELDHSSKEIEQLNSSSEEKSKNLAD 1045

Query: 2311 FVENFKNTLNDHLEENKKLIMQN--LTNATSAVINQEMDLFEPKRVKWENSFDLINKCDS 2484
             V  F    N+    NK L   N  L +  S + + E  L E K+   E    L      
Sbjct: 1046 AVNTFNKARNELESLNKTLAEANDKLRSRESTIESLEEKLQELKKSSDEKIASLEKSRKD 1105

Query: 2485 MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXX 2664
            +  E +      L   K+    +   + K++   K   +ES                   
Sbjct: 1106 L--EKFQQKFRDLELEKSKTQDALTDLQKALQDEKNNHQES----------------LQL 1147

Query: 2665 XVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIP 2844
              +K   L    ENS  ST +  + +  +  T+E++ K++       + + +  + K+  
Sbjct: 1148 QKDKIKQLALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKK-VSELKKKTV 1206

Query: 2845 SLSKRVPLRLSNTN 2886
            SL     LRL   +
Sbjct: 1207 SLQDESSLRLQEVS 1220

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 67/316 (21%), Positives = 134/316 (42%), Gaps = 16/316 (5%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKT--ELEISGFNNKLQKLTEIMQLALQDYKRREL 1863
            +++   ++E + L ++   +Q++  HKT  E  +   N   Q   E  + + +     E 
Sbjct: 900  VETLRQELEKVNLQLSDSYSQIE-HHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLEN 958

Query: 1864 DLNKKFETH--ISKEIKSLKTTLFSQLSGM--EQNNISQETNIQPNLDIIKNEVLTLMET 2031
            + N+   T   ++ ++K L   +F Q S    E+N   +E +    L ++K  V      
Sbjct: 959  ERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEIS---KLQMVKESVDRTKAD 1015

Query: 2032 MQEKAELMYKDCVKKI--LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNN 2205
             +EK  ++ KD   +    NES + + + ++K      D  +   ++         +   
Sbjct: 1016 YEEKIAMIQKDLEMQTQYANESQRSYELELQK----HADVSKTITSLRTEAQSYKSDLET 1071

Query: 2206 LKQYLKNHFFKNNHQELLNHHIDSTYED----IEKKTSEFVENFKNTLNDHLEE-NKKLI 2370
            LK   +       + E L +   + YED    +E++  E     K  L D +E  NK   
Sbjct: 1072 LKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNK-LLYDQIELLNKTED 1130

Query: 2371 MQNLTNATSAVIN--QEMDLFEPK-RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNT 2541
              N  +++  +I+  +E D+ E K  V       L  + D   +E   ++ T LSQ+KN+
Sbjct: 1131 RDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEI-EDLNTQLSQVKNS 1189

Query: 2542 VDTSSNSMNKSISVMK 2589
               S++ + +  ++MK
Sbjct: 1190 SSESAHLLEQQENIMK 1205

 Score = 41.6 bits (96), Expect = 0.014
 Identities = 71/417 (17%), Positives = 166/417 (39%), Gaps = 25/417 (5%)
 Frame = +1

Query: 1423 NIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKN 1602
            ++KN+ Q     ++ ++ +    E    K   +  ++++ +  S++  ++L+S++    N
Sbjct: 1304 DVKNELQTTKDTLQSVIAEKDDWES---KFQRIRLQARDRLNASKEKEQSLSSEI----N 1356

Query: 1603 EVQECKRDIEXXXXXXXXXXXXXXXXXXTI--------QSQNSQMESLKLTINQLKAQLD 1758
            ++ E K  +E                   +        Q+ NSQ+  L+  ++ ++ Q++
Sbjct: 1357 QINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQME 1416

Query: 1759 KQHKTELEISGFNNKLQKLTEIMQL---ALQDYKRRELDLNKKFETH----ISKEIKSLK 1917
               KTE   +  + K++ LTE +++    +Q+ +    +  K    H    I+++ KS+ 
Sbjct: 1417 NASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIV 1476

Query: 1918 TTLFSQLSGMEQNNI-SQETNIQPNLDIIKNEVLT-----LMETMQEKAELMYKDCVKKI 2079
              L ++    ++  I  +E  ++   +  K          L +  +E+ + + ++C K  
Sbjct: 1477 DNLKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTT 1536

Query: 2080 LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE----NNNLKQYLKNHFFKNNH 2247
            + +SP    + ++ ID ++ ++++ Y         ++EE       L    K        
Sbjct: 1537 V-QSPSQPTLDID-IDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEAR 1594

Query: 2248 QELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLF 2427
            + +L    +    +  +K +  + N   TL  H  E   L         S     E DL 
Sbjct: 1595 KAVLEESFEEKVNEKAQKLAGEIGNDAITLEKHRAELNAL-------KDSMRKQFEADLA 1647

Query: 2428 EPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQV 2598
            E K+  +E     +    S+  +F  +    L Q K+T+    N  +   +  +  V
Sbjct: 1648 EIKQKSFEEGKQQV----SLKLKFLESKIRNLEQQKSTIKPVENDTSNMSAAFQAPV 1700

 Score = 40.8 bits (94), Expect = 0.024
 Identities = 119/582 (20%), Positives = 215/582 (36%), Gaps = 69/582 (11%)
 Frame = +1

Query: 1459 MKDILVKNI--TME----LAKIKSDLLSTKSKEGIYMSQDHY-----KNLNSDLESYKNE 1605
            ++DIL K    T E    L K KS L S +S+  I  S+  +     K L ++ E +  E
Sbjct: 711  LQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKE 770

Query: 1606 VQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEI 1785
              E K  I                   T+Q +   +  LK T N  K   +K  K E+E+
Sbjct: 771  SVEYKVLIAQLQ---------------TLQREREML--LKETQNSYK---EKLRKLEIEL 810

Query: 1786 SGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTL---FSQLSGMEQN 1956
            SG   +L+++ E     +   K  + +  ++    ++ E    KTTL    +QL  M+  
Sbjct: 811  SGSLERLEEI-EKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQST 869

Query: 1957 NISQETNIQ------------PNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKF 2100
               Q   ++             N+D  +N V TL + + EK  L   D   +I       
Sbjct: 870  INEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQEL-EKVNLQLSDSYSQI-EHHKTL 927

Query: 2101 FNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK--NHFFKNNHQELLNHHID 2274
                V+ ++ +   F+       + +  +  E N L+  +   N   K+ + E+   H  
Sbjct: 928  AEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIF--HQK 985

Query: 2275 STYEDIEKKTSEFV-------ENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 2433
            S Y+     T E +       E+   T  D+ EE   +I ++L   T    N+    +E 
Sbjct: 986  SEYQTERNATMEEISKLQMVKESVDRTKADY-EEKIAMIQKDLEMQTQ-YANESQRSYEL 1043

Query: 2434 KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS----------MNKSISV 2583
            +  K  +    I    +    + +++ T  +Q +  ++   NS              +SV
Sbjct: 1044 ELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSV 1103

Query: 2584 MKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTIL---------KDNIENSITSTHSHIT 2736
            ++ +V+E                      N H            +D +E  +    S  T
Sbjct: 1104 LEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQT 1163

Query: 2737 NIDDIYDTIENIMKNYGNKENAVKN---------EMIDNILKEIPSL----SKRVPLRLS 2877
             +    D  ++ +++   + + VKN         E  +NI+KE+  L       V LR  
Sbjct: 1164 VLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSE 1223

Query: 2878 NTN-GNSAQNILSPKKHAIDDENP-SNEITDGEESRKIQKTE 2997
            N++      N+ S  +   D   P  + I+  +   KI++ E
Sbjct: 1224 NSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQE 1265

>Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR023W
            (MYO1) - Class II Myosin [contig 11] FULL
          Length = 1907

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 91/461 (19%), Positives = 166/461 (36%), Gaps = 24/461 (5%)
 Frame = +1

Query: 1309 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNIT 1488
            LQ  +     T L   +  +    E+T     +A K   ++ K      + +  L +   
Sbjct: 877  LQQEIMQKKDTELKLKLDESNKLREQT-----FAEKEAELQQKFDESEKLRQHFLAEKEA 931

Query: 1489 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXX 1668
            ++    ++   + +++E    SQ  YK L S+ +  KN+V      I+            
Sbjct: 932  LQKEYSEARAKADQNREETEKSQSLYKKLLSENDQLKNQVTNLTTKIDDGERSFRSIESD 991

Query: 1669 XXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDY 1848
                   I+S NS++ S    IN+LK +L +  K ELE                      
Sbjct: 992  KASLHDQIKSLNSEVLSKTTEINELKTKLSESDK-ELE---------------------- 1028

Query: 1849 KRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLME 2028
             R    L KKF T  SK + SL               + +  +++ ++D  K E   L  
Sbjct: 1029 -RSLQGLEKKF-TSASKRLTSL---------------VEENKSLRVSMDRSKREHAELHH 1071

Query: 2029 TMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNL 2208
             +Q       KD   K L +  +    +V  ++  R D       +      + EE  + 
Sbjct: 1072 NLQA------KDKELKRLADRSEQTQSLVASLNKERADLSSEQGRLLNEAKQLREELAS- 1124

Query: 2209 KQYLKNHFFKNNHQEL------LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 2370
                    FK  HQEL      L   +++T +++EK       N +  +       ++L+
Sbjct: 1125 --------FKQKHQELEKNCTDLRTQLETTSKELEKARESSGNNQEGDVKKVQSLEEQLV 1176

Query: 2371 MQ-NLTN-ATSAVINQEMDLFEPKRVKWENSF------DLINKCDSMNNEF--------- 2499
             + +LT      +++Q       +    EN F      D+   CD +  E          
Sbjct: 1177 RERSLTKFLNERLVDQTSSRTPSRPSSGENDFRSMPGEDVFEACDELKLELRETAFRLEK 1236

Query: 2500 -YNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAV 2619
              NN    +S+++ T +T   S +  I  M  Q+++ ++ V
Sbjct: 1237 EINNKKDLISKLRFT-ETRLASASFEIQSMSSQIKKLKSIV 1276

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2.633
            YKL079W
          Length = 572

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 71/341 (20%), Positives = 133/341 (39%), Gaps = 34/341 (9%)
 Frame = +1

Query: 1057 SSRSHTIFTITLY--KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 1230
            +S  HT   I+L     H+D  FR   +  VDL   E++                 Q + 
Sbjct: 191  NSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCAQEDVL----------------QLVC 233

Query: 1231 TLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 1410
            +L  V++   DK   I   +S+  +LL +S+GGN KT  I   S  +   + +  TLE+ 
Sbjct: 234  SLVAVLSNDNDKK--IGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFG 291

Query: 1411 SKAK-------------NIKNKPQLGAFIMKDILVKN--ITMELAKIKSDLLSTKSKEGI 1545
             K               N  NK QL   +M D  +K+   ++++  ++++L   ++    
Sbjct: 292  LKVSQVVNIIQRKDEPLNCDNKLQL---LMDDDSLKDEVYSLQIDVLENELNKLRAIRDN 348

Query: 1546 YMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQS--------- 1698
              +   + N N  +E+ K + +  +  +E                   +Q+         
Sbjct: 349  STTPKAFDNNNESIETVKEQNKTLQTQLENTRQLLNNSTSNKDQYEEIVQTLLDKCELIV 408

Query: 1699 -QNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNK 1875
              NS +E  +     L+  L  +   E  +   N KL +     ++ LQ   +    L K
Sbjct: 409  EANSILEIQENENVLLQELLQNRSLNEQVLEDLNVKLLEYIHSQEIELQQLLKSNTQLKK 468

Query: 1876 KFETHISKE------IKSLKTTLFSQ-LSGMEQNNISQETN 1977
            + E  ++ E      IK L+T++    ++    +++S  TN
Sbjct: 469  QLEIELANEDAQLEKIKDLETSVDKMYIARRSSSSVSSLTN 509

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = +1

Query: 301 QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVL 480
           + L+ D +      +  +G +C+++ YG ++TGKT+ +               GIIP  +
Sbjct: 66  EPLVIDNI-----NELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFI 110

Query: 481 LKLFDTLELQQN-DYVVKCSFIELYNE-ELKDLL 576
            +L+  LE Q +  Y +  S  E  ++ +++DLL
Sbjct: 111 EQLYIYLEAQSDLQYQIGLSVWEADSKGKIRDLL 144

>Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W
            (TID3) - Product of gene unknown [contig 159] FULL
          Length = 676

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 52/243 (21%), Positives = 109/243 (44%), Gaps = 16/243 (6%)
 Frame = +1

Query: 1936 LSGMEQNNISQETNIQPNLDIIKNEVLTL--METMQEKAELMYKDCVKKILNESPKFFNV 2109
            L  ++ + ISQ T    +L +++  + T    E  QEK EL+ +      + +S K F  
Sbjct: 231  LKKVDLSLISQNTQ---DLTVLRQPIGTFDEQEDKQEKYELIVERLFIDYIVQSYKSFLQ 287

Query: 2110 IVEK----IDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDS 2277
            + +     +  + + F++F   I  +++DI  +NN+L    ++   K    ++     ++
Sbjct: 288  LDDDYSQYMKELELGFEKFSQIIRSDIADIGMQNNDLSVKYQDMVEKGQEVKVAKDKFNA 347

Query: 2278 TYEDIEKKTSEFVENFKNTLNDH----------LEENKKLIMQNLTNATSAVINQEMDLF 2427
               D+ K      +N+ N +             +E  K+  ++ L + T   I++  DL 
Sbjct: 348  LNSDLTK-----FQNYVNAMQHKSQEWPRKLAKMEAEKESKLEQLKD-TEREISEIRDLI 401

Query: 2428 EPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEES 2607
            + K +        + + D +N E           +K  +DT+SN+M++++S +K Q  E+
Sbjct: 402  KDKDID-------MAEVDRLNTE--------REGLKKALDTTSNNMDQAVSRLKAQKIET 446

Query: 2608 ENA 2616
            E+A
Sbjct: 447  ESA 449

>ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YLR309C (IMH1)
          Length = 887

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 61/305 (20%), Positives = 124/305 (40%), Gaps = 8/305 (2%)
 Frame = +1

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHI 1893
            E+L     QL  +L+K    E E      K+    E ++  L+D K +  + N++ ET +
Sbjct: 314  ENLVEEHQQLSLELEKSRHWEQECLDSRKKV----ETLETELKDVKPKLKNSNEELET-V 368

Query: 1894 SKEIKSLKTTLFSQLSGMEQNNI---SQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 2064
               +K++   L      ++Q N    ++   ++  L  ++ E  T + T++E+ +L    
Sbjct: 369  RGMLKTVGNELVHARDELKQLNCEGTNEVERLKSELQELRTENSTQIATLKEQLQL---- 424

Query: 2065 CVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNN 2244
                 LN+  K     VE+      D +       EN+S    +NN+L + L+++     
Sbjct: 425  -----LNDQKKALETDVEQHKRKMEDLESELLKSQENVSKFRNQNNDLSEKLRDYIVLKK 479

Query: 2245 HQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLT-----NATSAVIN 2409
             +      +       ++KT E++E      N    E+KK    + T       T+A + 
Sbjct: 480  SEATTRMSLSQ-----KEKTIEYLEEQVRQYNSKEIEDKKAFADSKTELERWQRTAANLE 534

Query: 2410 QEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK 2589
            +++   E  R++ +   D +      N +    +     +  +  +  SNS    +S ++
Sbjct: 535  KQL---ERIRLETKRHDDNLESYIKENGKLSERLEVLQEKYDSLQNLKSNS-GDQVSAIR 590

Query: 2590 GQVEE 2604
             Q EE
Sbjct: 591  KQCEE 595

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 78/401 (19%), Positives = 154/401 (38%), Gaps = 16/401 (3%)
 Frame = +1

Query: 1837 LQDYKRRELD-----LNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDII 2001
            L+   RRELD     +NK F      +I     TL     G   +    E N + NL   
Sbjct: 49   LRKTPRRELDDTINSMNKSFN-----DISQFDETLPFIKDGDNSDGFDDENNPKINLLPS 103

Query: 2002 KNEVLTLM--ETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAEN 2175
             +E +  +  E M+E  E++  +  KK L E  +   VI + +            N  E+
Sbjct: 104  SSETIGAIASEPMRESKEII--ENYKKQLFEKTRQMEVIYQMLR---------ETNPNED 152

Query: 2176 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEE 2355
            L  I E    +  +   +         L+  +DST     KK     E  + +L   L++
Sbjct: 153  LRKIIEYQTEINIWKDKYNVLEVKFTDLSEKLDST-----KKVHSDCEQKRTSLEAQLKQ 207

Query: 2356 NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFD----LINKCDSMNNEFYNNMATTL 2523
            N+      L N +S    +E D  + +  K +   D     I + ++   +   ++  +L
Sbjct: 208  NQVDFEAKLNNVSSQFKGKESDSSDEEISKLQVKIDELQAKIKELETQLLDGNQSLDDSL 267

Query: 2524 SQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIE 2703
            +++K+ VD  +  + +     K ++++    ++                 KH     +++
Sbjct: 268  TKLKDEVDQKTQQLIEQEEKHKDELDQRTKQLTELE-------------KKHVNEISDLQ 314

Query: 2704 NSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSL-----SKRVPL 2868
              +T   + I N+++      +++KN+ N EN   +  + + + +I  L     S    L
Sbjct: 315  AQLTEKLTTINNLEENLKKNNDVIKNF-NTENYKHDNQVKDFISQIEELHDDKKSLTRDL 373

Query: 2869 RLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQK 2991
            ++S    N  +  +  K   +   N      D E+  +I+K
Sbjct: 374  QISKEKFNKYRGEMERKVFELKTSNERTTENDAEQLDQIKK 414

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 94/473 (19%), Positives = 201/473 (42%), Gaps = 45/473 (9%)
 Frame = +1

Query: 1534 KEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQM 1713
            +E +  + D  KN N++   + N+V++    IE                    +S    +
Sbjct: 328  EENLKKNNDVIKNFNTENYKHDNQVKDFISQIEELHDDK--------------KSLTRDL 373

Query: 1714 ESLKLTINQLKAQLDKQHKTELEISG---FNNKLQKLTEIMQLALQDYKRRELDLNKKFE 1884
            +  K   N+ + +++++   EL+ S      N  ++L +I +L    Y+ R   L  K  
Sbjct: 374  QISKEKFNKYRGEMERK-VFELKTSNERTTENDAEQLDQIKKL----YEDRVNKLQSK-N 427

Query: 1885 THISKEIKSLKT---TLFSQLSGMEQNNISQETNIQPNLDIIKN-EVLTLMETMQEKAEL 2052
              + KEI  L+T    + S+LS +E         +  + +  K+ E+L  ME +Q+    
Sbjct: 428  NSLLKEIAQLQTKESNVKSKLSELETKYSKNTKQLTKDRNEAKDRELLAKMEELQKNGAE 487

Query: 2053 MYKDCVKKIL----NESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYL 2220
            + K  V+K L    +E+ K  + + +K   I     +  + ++   S++ EEN +LK  +
Sbjct: 488  LNK--VEKKLQETESENNKLNSELFQKSQEIS-KLSKELDGLSGVNSELLEENKSLKTSV 544

Query: 2221 KNHF-----FKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN----------TLNDHLEE 2355
            ++        K +  E+   H +       KK+ E ++  +N           + D+ ++
Sbjct: 545  RDKIALKKELKKSQSEIKELH-EKIISSASKKSQEILQIIENKDEEIRKLERKIRDYDQK 603

Query: 2356 -NKKLIMQNLTNATSAVINQEMDLFE--PKRV-KWENSFDLINKCDSM---NNEFYNNMA 2514
             +K+  +++L N   A  N+++ L E   K V +W +  D + +  S      E  N+ +
Sbjct: 604  FSKESDIKDLQNKLKATENEKLTLLERHEKEVEEWRHELDKLQEDASQVVKLKEDLNDKS 663

Query: 2515 TTL-----SQIKNTVDTSS--NSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVN 2673
            T +     S IK+  + S   N M K ++   G++ +S N                   +
Sbjct: 664  TKIEELHASLIKHQKENSKIRNDMQK-LTAQYGELRKSMNESQKLIDEYYELKSTRRNED 722

Query: 2674 -----KHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEM 2817
                 K   L+ N  +++ +   ++ ++++    +E ++KN+  K+N ++N +
Sbjct: 723  FKQEEKLNELERNYNSNLQNLKKYVKSLENENTELEQLLKNF--KQNDIRNSI 773

 Score = 41.2 bits (95), Expect = 0.017
 Identities = 66/295 (22%), Positives = 121/295 (41%), Gaps = 15/295 (5%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYK------ 1851
            I++++ ++  L+  I       D++   E +I    NKL K TE  +L L +        
Sbjct: 583  IENKDEEIRKLERKIRDY----DQKFSKESDIKDLQNKL-KATENEKLTLLERHEKEVEE 637

Query: 1852 -RRELDLNKKFETHISKEIKSL--KTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 2022
             R ELD  ++  + + K  + L  K+T   +L      +  + + I+ ++  +  +   L
Sbjct: 638  WRHELDKLQEDASQVVKLKEDLNDKSTKIEELHASLIKHQKENSKIRNDMQKLTAQYGEL 697

Query: 2023 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENN 2202
             ++M E  +L+ +    K    +  F     EK++ +  ++     N+ + +  +  EN 
Sbjct: 698  RKSMNESQKLIDEYYELKSTRRNEDFKQE--EKLNELERNYNSNLQNLKKYVKSLENENT 755

Query: 2203 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVE----NFKNTLNDHLEENKKLI 2370
             L+Q LKN  FK N               IE K SE +E     +K   N  ++ N  L 
Sbjct: 756  ELEQLLKN--FKQN----------DIRNSIETKMSETMEYRSDYYKLKYNREVKRNNDLK 803

Query: 2371 MQNLTNATSAVINQEMDLFEPKRVKWENSFDL--INKCDSMNNEFYNNMATTLSQ 2529
            +Q  T+  + VI   +   +    K+ N      I   DS +  FY +     SQ
Sbjct: 804  IQ--TDYLNRVIKATLATAKADLAKYRNLTRSLGIEYGDSYHTRFYQDTMRPSSQ 856

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519 bp,
            1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 92/410 (22%), Positives = 172/410 (41%), Gaps = 28/410 (6%)
 Frame = +1

Query: 1213 INQSLLTLGRVINALADKSG-HIPFRESKLTRLLQDSLGGNTKTA----LIATISPAKVT 1377
            +   L TL  + +  A ++G HI   E++L RL   S  G TK       +   S  ++ 
Sbjct: 785  LRSELQTLNNITHEKALEAGTHIKELETELWRLKSQSSTGMTKEMDELDSVRLQSKCELL 844

Query: 1378 SEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 1557
              +  S  +  ++ + + N   L    + +IL      +  +IKS  L    KE +   Q
Sbjct: 845  EADNHSLEDKVNELEALINSKFLDMENLNEIL----QFQNERIKSLELEPNHKEKLEELQ 900

Query: 1558 DHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMES----LK 1725
              Y+NL+ + E  KNE ++   DI                     +  +S + S    L 
Sbjct: 901  IEYENLSRENERLKNESKQHNEDIIKQVTTYSSQLALLINHWKENKVSSSFLSSSSSLLS 960

Query: 1726 LTINQLKAQLDKQHKTELEISGFNNK-----LQKLTEIMQLALQDYKRRELDLNKKFETH 1890
            ++ NQ +   +K  K E E  G  N+     + KLT  +   L+  K +EL ++K+    
Sbjct: 961  VSSNQ-EENGEKSIKNEGEPYGDQNRHHRVVINKLTNRLDDLLE--KSQELTVSKE---K 1014

Query: 1891 ISKEIKSLKTTLFSQLSGMEQNNISQETNIQPN-LDIIKNEVLTLMETMQEKAELM---- 2055
            +S E  +LK         ME +++SQ+  ++ N +  I+N+    + ++   ++ +    
Sbjct: 1015 LSSEYHALK---------MEHSSLSQDVLVKENEIKKIQNDYKESISSVNSASKALVVSQ 1065

Query: 2056 -----YKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYL 2220
                 YK   KK+++E     + +  K      + +  + +  E+ +D S  NNN+++  
Sbjct: 1066 RELEKYKSLNKKLIDE----LDELKFKHGHGNQNSENGFESTNESSNDAS-NNNNIRENQ 1120

Query: 2221 KNHFFKNNHQELL--NHHIDSTYEDI--EKKTSEFVENFKNTLNDHLEEN 2358
             N    +   EL   N   DS   ++   KK    +EN  N +N++ + N
Sbjct: 1121 FNIKINDLKAELFITNQERDSLKSEVLELKKRLLNLENSTNDVNENDDSN 1170

>NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {ON}
            Anc_1.110 YNL250W
          Length = 1305

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 67/342 (19%), Positives = 145/342 (42%), Gaps = 31/342 (9%)
 Frame = +1

Query: 1690 IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR--REL 1863
            ++    + +S K+TI QL+ Q+D+      +I     K+ + ++ +  + Q++++   ++
Sbjct: 212  LKVDRDRSKSTKMTIVQLQGQVDEYQGKVTDIEKELKKITEQSDKLFKSNQEFQKVLSKV 271

Query: 1864 DLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL---TLMETM 2034
               K  ETH  +EI +L T++   LS  +Q+     +N   +L   +NEVL     + T+
Sbjct: 272  QNLKLLETHYREEIDNLSTSI-ELLSSSKQSLQELLSNFSTSLQEKENEVLQTENKITTL 330

Query: 2035 QEKAELMYKDCVKKI-----LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEEN 2199
            + KA +   +  K I     L    + +      +  +  +F   Y     N SD    +
Sbjct: 331  KNKANVQQSELTKLIRRQGELQAGKESYEKNTNTLQTMAKEFSSRYK---INFSDTDSMD 387

Query: 2200 NNLKQYLKNHFFKNNHQELLNHHIDST---------------YEDIEKKTSEFVENFKNT 2334
            + +K  L + F  +    LL++  ++T                E I+++  E+       
Sbjct: 388  SFIK--LSSDFVSSLSVSLLSYESEATKAIRKAETRSNEATKSETIQRQRLEYSRKDLEK 445

Query: 2335 LNDHLEENKKLIMQN-LTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 2511
            LN  +E+       N  T     +  ++++ +  K   WE + D+I + +S   +  + M
Sbjct: 446  LNTEIEKLTSEFKNNEYTKEDLEMERKKLEDYHEKVRDWEKT-DVITELNSKLKQKNDQM 504

Query: 2512 ATT---LSQIKNTVDTSSNSMN--KSISVMKGQVEESENAVS 2622
              +   L QI+  +  ++   +    + +MK  + E   A++
Sbjct: 505  IISENELEQIQEKIMKTNQQADLFAKLGIMKKSLYEKTEALN 546

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 61/317 (19%), Positives = 135/317 (42%), Gaps = 15/317 (4%)
 Frame = +1

Query: 1717 SLKLTINQLKAQLDKQHK----TELEISGFNNKLQKLTEIMQLALQDYKRRELDLNK--- 1875
            S++L +  L+   DK  K    T+L I+  NN+   L   +       K  EL LN+   
Sbjct: 615  SMQLKLTTLRQTNDKTIKDIENTQLSINTINNENTNLQTQLVTLENTNKESELKLNELTA 674

Query: 1876 --KFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI---QPNLDIIKNEVLTLMETMQE 2040
                   ++ E+K   TT+ +  + +E N I +  ++   + ++  + ++ L L E   E
Sbjct: 675  QFNESQKLNDELKEKMTTINTTTNDLE-NKIEELKSVYQKEKSMTDVNSKQLELKEINVE 733

Query: 2041 KAELMYKDCVKKI--LNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 2214
                   D  +KI    +  K  +    +++      +  Y  +A   ++++E  N L  
Sbjct: 734  TLNTELSDLQEKIDIYLKKQKELDDYKTQVEQQHAQLESTYQQLATKTNELNERQNELDL 793

Query: 2215 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 2394
              KN   + N  +     +DS +++++K+   F ++       H++  ++  +Q+L+   
Sbjct: 794  QNKNIVEQENVYKQNVERLDSMFDELKKRKESFDQSNAELHQQHIDYAQR--VQDLSEKK 851

Query: 2395 SAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSN-SMNK 2571
              +   E+     K +  +   D+ +   ++ +E  N++    S    T D++ N S+N 
Sbjct: 852  MQLSMGELPP-NAKEIIDQYKPDMTSTTTNLTSEL-NSLDINASPANPTNDSTLNKSLNS 909

Query: 2572 SISVMKGQVEESENAVS 2622
            +I  +  +  E ++  S
Sbjct: 910  NIDNINEKSREIQHPTS 926

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 118/654 (18%), Positives = 245/654 (37%), Gaps = 43/654 (6%)
 Frame = +1

Query: 1159 ENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRE--SKLTRLLQDSLGGN 1332
            E  + +G L ++ K     ++ L+   R+++     S HI  ++  S L   L++  G  
Sbjct: 753  ETESTNGNLTEKLKNLSQEHEELVERYRLLD-----SSHISLKKNFSNLETELKNIKGSL 807

Query: 1333 TKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKS 1512
             +   +  +   K   E   +  EY             G    ++  +K +  EL    S
Sbjct: 808  DEMTQLKNVLETK-DKENLAALQEYK------------GTIHKQEDTIKTLEKELETTFS 854

Query: 1513 DLLSTKSKEGIY-MSQDHY---KNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXX 1680
                 K+++GI  M +D +   + + S  E YKN  +E  +                   
Sbjct: 855  Q--KKKAEDGINKMGKDLFALSREMQSVEEKYKNLQREKDKSDSNYQKEVKLLKEDTVKK 912

Query: 1681 XXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ-------KLTEIMQLAL 1839
               I+  N  +   K   N L  + +   +   E++ + ++ Q       KLT+ ++   
Sbjct: 913  MTEIKILNENLIKTKTEHNNLSKEKENISR---ELTEYRSRFQSHDSLVTKLTDKLKSLA 969

Query: 1840 QDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLT 2019
             DYK  + +     +    +E KS KT   S L     +   Q+ N     + ++  +  
Sbjct: 970  NDYKNMQSENESLIKA--VEETKSEKTMQLSALQDEIDSLSRQKENFLTERESLEQSIKQ 1027

Query: 2020 LMETMQEKAELMYKDCVKKILNESPKFFNVIVE----KIDIIRVDFQRFYNNIAENLSDI 2187
            L ET+           ++K   E+   FN   +    ++ ++R   +   N   E+++ I
Sbjct: 1028 LRETIS---------AIEKAKEEAISRFNSSKDNYESQLGLLREQLENTRNAKDESVNRI 1078

Query: 2188 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE---DIEKKTSEFVENFKNTLNDHLEEN 2358
            SE   N K          + ++ L   I+ T+E   D+ KK+ + ++  K  L   + + 
Sbjct: 1079 SELIQNSKNLEAELETCRHLKDGLEAKIE-TFEKALDVIKKSEQHLKEEKMQLEKEVTDT 1137

Query: 2359 KK---LIMQNLTN-------ATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFY-- 2502
            K+   ++  NL +       + + +   +  + + +    E + +L ++ +S+  E    
Sbjct: 1138 KQQTEILRSNLKSLEKEHEDSIALIEKYKKHIIDKEGEYNERASELNDEINSLQQEKETI 1197

Query: 2503 ----NNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXV 2670
                + +   + ++KNT+   SNS    I  +  Q++E E                    
Sbjct: 1198 RLKSDKLEGDIKEMKNTLGVQSNSKESEIRALNMQIKELE-------------------- 1237

Query: 2671 NKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAV-----KNEMIDNILK 2835
             K    + N+  S+ S  S  T + ++ +  +   K  G  E  +     KN  I  + K
Sbjct: 1238 EKSQKNEANLLQSVKSLESETTKVRELQEECDLKRKKIGELEKKIKASEDKNSQISELQK 1297

Query: 2836 EIPSLSKRVPLRLSNTNGNSAQNI--LSPKKHAIDDENPSNEITDGEESRKIQK 2991
            E     + +  + +    N  + I  L+  K   D E    + T  E+ + +++
Sbjct: 1298 ESEETKRELEAKTAEVK-NQLEKISNLNELKEKSDIEFTRLKKTWSEDKKNMEE 1350

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
            YGL073W
          Length = 613

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 69/349 (19%), Positives = 132/349 (37%), Gaps = 3/349 (0%)
 Frame = +1

Query: 1954 NNISQET--NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKF-FNVIVEKI 2124
            N  S+E   N +P L ++      L  T+         D V K+LNE     +N +    
Sbjct: 258  NTTSKEKIMNTKPILHLMNEPSTGLDNTIDINGGSTTTDHVSKVLNELEAIKYNQLAISK 317

Query: 2125 DIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKT 2304
            D++R++     N +    + ++ E    +Q      F+          + S     +K  
Sbjct: 318  DLLRINKD---NELLWKENMMARERYRSQQQTLEKIFR---------FLASIMP--QKMI 363

Query: 2305 SEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDS 2484
             + V N  +  N  ++ N      N  N  S  +N          +  +N FD +   + 
Sbjct: 364  MDGVMNNSDNTNSSIDLNSLRNKGNSDNNNSESMNTN--------INEKNLFDELVNNEG 415

Query: 2485 MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXX 2664
             NN   NN   TL++  + +      + K+ S  KGQ   +    +              
Sbjct: 416  NNNNSNNNNYDTLNRASSPLRPQPRYLLKNRS-NKGQSMTTTPTSAATSSSPNKILELND 474

Query: 2665 XVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIP 2844
              N H I+++   N   +   + +  DD  + + N+  N   ++N +++ + D I++E  
Sbjct: 475  DDNMHPIVEEYDTNENETNRGNAS--DDSLEFLNNLQSNISEQDNRIQH-LEDIIIQEFS 531

Query: 2845 SLSKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQK 2991
              +  +    SN NGNS     S   +   D  P++ I + +E  K ++
Sbjct: 532  PKNNVMHANASNNNGNSNTADFSLHDYFNSDAIPNSPIGESDEGSKYKR 580

>NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] {ON}
            Anc_2.16 YDL239C
          Length = 626

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 81/389 (20%), Positives = 163/389 (41%), Gaps = 34/389 (8%)
 Frame = +1

Query: 1426 IKNKPQLGAFIMKDILVKNI-TMELAKIKSDLLSTK----SKEGIYMS--QDHYKNLNSD 1584
            I+ + +L  F  K +L +   T +++K+  +L +TK    +KE ++    Q+    L   
Sbjct: 169  IEKEKELNDFKSKFLLCQETYTSQMSKLSEELENTKKVFENKEALFGERIQETVHELECQ 228

Query: 1585 LES-----YKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKA 1749
            L       +KN++ E K  +E                   I+S    ++  +  I  +  
Sbjct: 229  LAKRYETKFKNQIIEYKSKLEEEKKGYVTSCQRAITGYNNIESFVKNLKLFEYDIGPIIV 288

Query: 1750 QLDKQHKTEL--------EISGF-----NNKLQKLTEIMQLALQDYKRRELDLNKKFETH 1890
            +   + +T+L        E+ GF     +++L K  +     + DYK + +DL KK++  
Sbjct: 289  KCFSEKETDLSLRFSQKYEVGGFYTADVDDQLHKFEK----EIDDYKEKIVDLQKKYDQR 344

Query: 1891 I-SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDC 2067
            + S+EIK+      S+L  +E  N   + +I+      +N  L+ ++T   + E      
Sbjct: 345  LNSEEIKN------SELEKLEGLNKKYKDSIEE-----RNGKLSELQTDLSRNE------ 387

Query: 2068 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD--------ISEENNNLKQYLK 2223
             KK+     + FN++ +K  +I  D ++  +  A+ +S+        ++E   N+K    
Sbjct: 388  -KKLEELRAQNFNLLNDKQSLID-DLKKLKDTQADIISNTFLELRKQLNESTENVKTLNG 445

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
             +  K N   + N  +    E  EK       N + +  + LEE   +I+ +L  A +  
Sbjct: 446  KYVDKINELNIANDMLGK--ERKEKMEKIEYSNLQASQIEFLEEKINIIVGDLREALTFN 503

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMN 2490
            I +      P   K   +  +++K D +N
Sbjct: 504  IVRST---RPDVTKELYNLLMVDKIDDLN 529

>Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)
          Length = 692

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 77/389 (19%), Positives = 160/389 (41%), Gaps = 16/389 (4%)
 Frame = +1

Query: 1732 INQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKS 1911
            I+ L+AQ D  ++   E+   + K++   E  +    D  + E  +N   +   S+E  S
Sbjct: 319  ISNLQAQNDTLYEKYQEVMKISQKIKTTREKWKALRSDSNKYENYVNAMKQK--SQEWPS 376

Query: 1912 LKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL--METMQEKAELMYKDCVKKILN 2085
                + S+    ++   + E NI     I++ + ++    E    + E + K+ + KI  
Sbjct: 377  KLEKMKSECDVKKEEINALENNIDELHKILRKKGISTEQFELQNHEREKLTKE-LDKINL 435

Query: 2086 ESPKFFNVIVEKIDIIRVDFQRFYNNIAENLS--DISEEN-----NNLKQYLKNHFFKNN 2244
            +S K  + I  +    +++ +  + ++ + L   DIS +N       L   + + F K +
Sbjct: 436  QSDKLTSSIKSR----KLEAEGIFKSLLDTLRQYDISIQNLVRSRTQLGHKVDDSFLKID 491

Query: 2245 HQE-LLNHHIDS--TYEDIEKKTS---EFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 2406
              E LL+   D    Y  +  K S   EF++++   LND ++E  K I ++       + 
Sbjct: 492  IPENLLDREFDEGIAYHQLFPKGSGINEFIKSYILKLNDDIQERIKTIEKDNITLEKDIK 551

Query: 2407 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 2586
            N + D+ E  +V  +   +L             N    ++Q +  ++     +N S  +M
Sbjct: 552  NLKNDINEKTQVNEKLELELSEANSKFELSKQENERLLVAQ-RIEIEKMEKKINDSNILM 610

Query: 2587 KGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 2766
            K ++ ++E  V+                 K   LK N+       H  + ++ D+    +
Sbjct: 611  KSKISDAEELVTSTEL-------------KLEELKVNLNRKRYKLHQQVIHVIDVTSKFK 657

Query: 2767 -NIMKNYGNKENAVKNEMIDNILKEIPSL 2850
             NI  +  N EN      + N+++E+ +L
Sbjct: 658  INIQSSLENSEN-----NLGNVIEELRNL 681

>TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5.296
            YDR285W
          Length = 950

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 97/583 (16%), Positives = 222/583 (38%), Gaps = 19/583 (3%)
 Frame = +1

Query: 1162 NINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKT 1341
            +++ S   +Q  K   S  +++L++ +  +   + S  I  R++    +L ++     K 
Sbjct: 176  HVDDSKKEDQNLKLKNSFKRNILSIDQFDSHQINDSS-ITLRDTSSNDVLLEAFNDTQK- 233

Query: 1342 ALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLL 1521
             + + +     T E T + LE   K  N +N   +G  + K    K +  EL     D  
Sbjct: 234  -ICSKLKQELHTKEITINKLE--RKISNYEN--DIGKLVQKFNNHKTLLNEL-----DGK 283

Query: 1522 STKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQ 1701
            +   KE   + Q     L  + +++K ++   K +                     I  +
Sbjct: 284  TRIFKEQKNLDQRIIIELKQNNDNFKEKILYYKNEFSKLRISLSECNDWKKEMNNEINKK 343

Query: 1702 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 1881
            N ++  LK  ++    QL ++      +      +++L++     L+ +   ++ L + F
Sbjct: 344  NKEILYLKKELDDFSGQLSEEKIKNSSL------IKELSQNRDETLKTFDENKIYLEESF 397

Query: 1882 ETHISKEIKSLKTTLFSQ-----LSGMEQNNISQETNIQPNLDIIKNEV-LTLMETMQEK 2043
               I +  K+L+  L  +     +    +N+I    N Q N      ++ +     + + 
Sbjct: 398  SGKIIELEKNLEKALVEKFTKPLIDNFNENSIKYNENFQRNFKTYHYKINIPFYFFLTKF 457

Query: 2044 AELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLK 2223
              L YK  +K I   + +F  +I    +I++           E+L  ++E N+ +     
Sbjct: 458  ILLTYK--IKIIYRSNEEFVKII----EIVK----------DEHLKQLNENNDTVISNF- 500

Query: 2224 NHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAV 2403
            N F   N   + N  I ST+++ E+         +N     L E  K++ ++L +     
Sbjct: 501  NVFKVENDVSISN--IFSTFKNFEESLKSKFNEIENNYTSILSEKTKILAEDLNS----- 553

Query: 2404 INQEMDLFEPKRVKWENSFDLINKCDSMNNEF-------YNNMATTLSQIKNTVDTSSNS 2562
            I  + + ++ K  + E   ++I   +   +E          ++ T  ++ +      +  
Sbjct: 554  IANDFNSYKEKMNQKEEYSEIIKNLEKEIHELATQKMNCLTSLGTKEAEFEEITSQLNEL 613

Query: 2563 MNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS----H 2730
             NK  +++  + + +E                    N++  +  N +N I++  S     
Sbjct: 614  KNKETNLLTLEKQLNEQIADLNLNVEQKNFEINKLTNENLSISSNFDNKISAQESIMKAL 673

Query: 2731 ITNIDDIYDTIENIMKNYGNKENAVKN--EMIDNILKEIPSLS 2853
            IT  D +  T   + +    +EN  +N   M+  + ++I  ++
Sbjct: 674  ITENDLLKQTTSKLEEERSKEENEKENTKAMVQKLNEQINKIN 716

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
            YDR356W
          Length = 970

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 78/394 (19%), Positives = 167/394 (42%), Gaps = 26/394 (6%)
 Frame = +1

Query: 1402 EYASKAKNIKNKPQLGAFIMKDILVKN--ITMELAKIKSDLLSTKSKEGIYMSQDHYKNL 1575
            E     +  KN+     + +KD   KN  +T ++ + ++ L++T  +       + ++ L
Sbjct: 420  ELKDSIEECKNQMDNLNYALKDEKKKNKTLTEKITEQQNKLIATDDQ-----LNEKHEAL 474

Query: 1576 NSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQL 1755
             S+ +   +E++  K+ ++                  T+  +  +   LK  IN  K +L
Sbjct: 475  KSEYDIITSELKITKKKLD------------------TVNFELKKELELKKRINNSKQRL 516

Query: 1756 DKQHKT-ELEISGFNNKLQKLTE--IMQLALQDYKRREL---DLNKKFETHISKEIKSLK 1917
            + Q K+  LEIS  ++++  L E  +   +  D  R ++   +L  K       EIK  K
Sbjct: 517  EDQVKSLTLEISDKHSEISDLQEKLLEYTSNSDNSRSKISGMELKIKALQKELVEIKKNK 576

Query: 1918 TTLFSQLSGMEQNNISQETNIQPNLDIIKN--EVLTLMETMQEKAE------LMYKDCVK 2073
              L      ++Q+ +  ++NI  NL+ I N  E ++ ++   +K +      L     ++
Sbjct: 577  DILQESYEELKQSKLELQSNIDRNLEKISNQKEEISRLKIENDKLQQTNFENLNLSTKLQ 636

Query: 2074 KILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN--HFFKNNH 2247
              + +S ++   I E+ + +  D       I +  ++++E    L +  K+  H  ++ +
Sbjct: 637  SEIEQSNEYVQTITEQNNKLTSDITSKIVRIDDLKNELNENKQKLNKLEKDYRHIKRSQN 696

Query: 2248 QEL--LNHHIDSTYEDIEKKTSEFVENFKN---TLND-HLEENKKLIMQNLTNATSAVIN 2409
              L  L   ++S   +++   ++F EN KN    LND  ++   K +  N   A    + 
Sbjct: 697  DRLPKLLSELNSKNNELQYIENKFKENEKNLEKQLNDSRIKLEIKEVQNNELLAKIEELT 756

Query: 2410 QEMDLFEPKRVKWENSFD--LINKCDSMNNEFYN 2505
            Q+ D F       +  ++  L +K D +    Y+
Sbjct: 757  QQCDNFRNLNYDLQEKYNDLLRDKTDVLPEHIYH 790

>TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] {ON}
            Anc_1.162 YKL179C
          Length = 627

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 91/421 (21%), Positives = 163/421 (38%), Gaps = 40/421 (9%)
 Frame = +1

Query: 1816 TEIMQLALQDYKRREL-DLNKKFETHI----SKEIKSLKTTLFSQLSGMEQNNISQETNI 1980
            T I   A+  + + +L DL K  + +I    SKE +S+ +              S+E  +
Sbjct: 3    TSIYSHAIDLWSKADLPDLQKNLDENIISIKSKETESIDSRKLLAKETKSFKKKSEEEKL 62

Query: 1981 QPNLDIIK---NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 2151
                 IIK   NE+ +L +  +    +++ D   K+ +E P    ++   I+ ++VD   
Sbjct: 63   TSINKIIKQYQNEIDSLTKRSKFSESILF-DIYSKV-SEVPDPLPLLKNSINSLKVD--- 117

Query: 2152 FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 2331
                   N  D  E  N +   LK+       +E LN+ ++    +I++K +E     KN
Sbjct: 118  -------NSKD-QELQNEINVLLKD-------KESLNNQLN----EIKEKQNEESTKLKN 158

Query: 2332 TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEF---- 2499
             +      NKKL + N   +  A  NQ+         +  NS   I+  ++ NN      
Sbjct: 159  EIETL---NKKLEILNKLQSDKAKDNQDSPQISLLTEELNNSISKISDLENKNNLLTKDL 215

Query: 2500 --------YNNMAT---------TLSQIKNTVDTSSNSMNKSI--SVMKGQVEESENAVS 2622
                    +NN+           T   IK T D +SN +  +      K +++E +   +
Sbjct: 216  TKLKEDLEHNNIINANEKTIKNLTNENIKLTKDLNSNQLQLTSLKDSSKREIDELKLNST 275

Query: 2623 XXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENA 2802
                              +  +KD +    +     + N DD  DT E    N  NK ++
Sbjct: 276  TYKSELDSIRRKLNQFQDYNKIKDELSALKSIEFGTVENDDDDDDTNEG--TNSANKNSS 333

Query: 2803 VKNEMIDNIL--------KEIPSL-SKRVPLRLSNTNGNSAQNILSPKKHAIDDENPSNE 2955
             K+  +D+ L        K++  L    V L   N N N+  N+L+ K  +++  N   E
Sbjct: 334  SKDSKVDSTLLATNKQLQKKLAELRGSTVDLEEKNKNLNNQVNVLNEKISSLEKLNQKLE 393