Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.66.16ON99999952660.0
YEL061C (CIN8)6.16ON1000100044250.0
Smik_5.266.16ON1002100243990.0
Skud_5.286.16ON998100143850.0
TDEL0G045306.16ON95893925280.0
ZYRO0C07898g6.16ON97494024790.0
NCAS0H008806.16ON100491024040.0
NDAI0D008706.16ON106991823970.0
CAGL0B03641g6.16ON98891123260.0
SAKL0E01078g6.16ON94896322960.0
KAFR0L003706.16ON96391622800.0
Kpol_1032.66.16ON100493022540.0
Kwal_56.224036.16ON94395021680.0
Ecym_30206.16ON94488321220.0
KLTH0C11330g6.16ON94195420860.0
ACR010C6.16ON94587920710.0
KNAG0M011306.16ON95089219610.0
KLLA0D01045g6.16ON96568015260.0
Kpol_1045.736.16ON96299814700.0
TPHA0M002406.16ON93961713831e-175
TBLA0A072306.16ON109764213791e-173
TPHA0J003006.16ON98291711661e-143
TPHA0E008907.387ON12325608781e-100
ACR228C7.387ON11295166534e-70
Smik_2.537.387ON11132206507e-70
YBL063W (KIP1)7.387ON11112216509e-70
Suva_2.547.387ON11102206491e-69
Skud_2.417.387ON11102206481e-69
SAKL0F12298g7.387ON11122166428e-69
Ecym_46887.387ON11343146358e-68
TDEL0C016007.387ON11052146233e-66
ZYRO0B03234g7.387ON11382136144e-65
NDAI0E043007.387ON11862186129e-65
NCAS0E026407.387ON11022166073e-64
KAFR0L017107.387ON11512406073e-64
TBLA0D006407.387ON11421984686e-47
KLTH0G03850g5.531ON4731733602e-35
Kwal_47.186085.531ON4791753513e-34
SAKL0G18920g2.633ON6491863548e-34
KLLA0B00759g5.531ON4561743432e-33
SAKL0G05016g5.531ON5041733453e-33
ADR145C2.633ON6353483291e-30
Ecym_34152.633ON6623183192e-29
Ecym_40665.531ON4781723042e-28
KAFR0F042103.528ON6721783076e-28
CAGL0I07029g3.528ON7051803051e-27
SAKL0F01760g3.528ON8091783061e-27
Suva_7.443.528ON8051783032e-27
Skud_7.533.528ON8051783024e-27
TDEL0D059603.528ON7331813004e-27
TBLA0C039403.479ON7391943005e-27
KLLA0A01606g3.528ON7692032997e-27
Kwal_47.190933.528ON8191792998e-27
ZYRO0D12650g5.531ON4781862928e-27
NCAS0E005503.528ON7841802989e-27
TPHA0D034803.528ON8471932981e-26
Smik_7.483.528ON8051782971e-26
YGL216W (KIP3)3.528ON8051782971e-26
KNAG0B005203.528ON7231832962e-26
ZYRO0E08668g3.528ON7781812952e-26
TBLA0C049603.528ON8011882943e-26
KLTH0G01606g3.528ON8191792926e-26
CAGL0D04994g3.479ON6921482906e-26
NDAI0I029603.528ON8681852926e-26
Kpol_1050.1033.479ON6971522899e-26
Kpol_423.83.528ON8062022901e-25
KAFR0B065903.479ON7061832881e-25
Kpol_1004.255.531ON5061872803e-25
TPHA0D032003.479ON7241512835e-25
KNAG0A078803.479ON7641432836e-25
NCAS0F034703.479ON6981972827e-25
AER441C3.528ON8181682828e-25
AGR253W3.479ON7091832819e-25
NCAS0C013508.678ON6551832782e-24
Ecym_12003.528ON8331802773e-24
NDAI0B057703.479ON7631562756e-24
TDEL0A062408.678ON6373852729e-24
KLLA0D05951g8.678ON6683062702e-23
Kpol_505.393.479ON6921502702e-23
SAKL0F03168g3.479ON7061452702e-23
TDEL0F036403.479ON7041852692e-23
ZYRO0F07414g8.678ON6541942683e-23
Kpol_1013.78.678ON6201912674e-23
Ecym_44073.479ON7111822665e-23
YPR141C (KAR3)3.479ON7291442666e-23
Suva_16.4693.479ON7311442667e-23
ZYRO0B04290g3.479ON7311482658e-23
TBLA0C053103.479ON6761872658e-23
Skud_16.4353.479ON7291842659e-23
KAFR0H024108.678ON6583042631e-22
Smik_16.3883.479ON7291442622e-22
NDAI0E02090singletonON6851962622e-22
KLTH0F14498g3.479ON7021862585e-22
KLLA0B10956g3.479ON6902452577e-22
SAKL0H06490g8.678ON6572672541e-21
Kwal_26.88068.678ON7153122496e-21
CAGL0M02189g8.678ON6722202488e-21
Skud_16.1278.678ON7062282488e-21
TPHA0D012708.678ON6962002471e-20
KLTH0D11286g8.678ON6782232442e-20
YPL155C (KIP2)8.678ON7062002417e-20
ACR145W8.678ON6852112408e-20
Smik_6.3528.678ON7152062362e-19
Ecym_23958.678ON6871892335e-19
TDEL0B072702.633ON6441992292e-18
KNAG0J017208.678ON6251842221e-17
TBLA0C018808.678ON4681512182e-17
TPHA0D041903.479ON6721442103e-16
Suva_16.1558.678ON7042282077e-16
Kpol_1019.112.633ON6472071979e-15
Kwal_55.21164singletonOFF5881721862e-13
Kwal_YGOB_55.211643.479ON6571721862e-13
Suva_11.1452.633ON6571241853e-13
TPHA0N016502.633ON6822151745e-12
Smik_11.1602.633ON6561281674e-11
Skud_11.1482.633ON6561081622e-10
YKL079W (SMY1)2.633ON6561081603e-10
TBLA0A008202.633ON8031761542e-09
NCAS0H031802.633ON6602501522e-09
ZYRO0E01078g2.633ON6681091471e-08
KNAG0M025402.633ON5221111381e-07
NDAI0C004802.633ON5981901334e-07
TBLA0C008002.633ON6931331291e-06
KAFR0C040202.633ON667941183e-05
CAGL0L05104g2.633ON6752031112e-04
KNAG0H003602.633ON6811251059e-04
NCAS0C052002.633ON572154830.31
NCAS0I023003.124ON3025101830.49
ZYRO0F06424g8.636ON45291810.58
KNAG0M024702.649ON60677810.67
Kwal_55.197335.696ON676266800.81
NCAS0A142107.364ON600215800.92
TPHA0H016805.414ON989175791.2
NCAS0B039808.235ON1184173781.5
KNAG0G004801.483ON49863771.7
YDR460W (TFB3)5.580ON321219762.0
KLLA0D19580g2.16ON754157772.1
TBLA0B035208.727ON815222772.2
KNAG0E029302.16ON587194752.8
ZYRO0A02244g2.301ON336106743.2
YNL225C (CNM67)2.16ON581283753.5
TPHA0E013805.307ON1219226753.7
NDAI0B055405.416ON58590743.8
Skud_12.5094.300ON418188744.1
Kpol_1065.363.330ON1219254735.7
NCAS0D019505.170ON93936727.6
Kpol_1063.77.204ON592166727.9
KNAG0A022808.484ON860245728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.6
         (999 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  2033   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1709   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1699   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1693   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   978   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   959   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   930   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   927   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   900   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   889   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   882   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   872   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   839   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   822   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   808   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   802   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   759   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   592   0.0  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   570   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   537   e-175
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   535   e-173
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   453   e-143
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   342   e-100
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   256   4e-70
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   254   7e-70
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   254   9e-70
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   254   1e-69
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   254   1e-69
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   251   8e-69
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   249   8e-68
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   244   3e-66
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   241   4e-65
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   240   9e-65
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   238   3e-64
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   238   3e-64
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   184   6e-47
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   143   2e-35
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   139   3e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   140   8e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   136   2e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   137   3e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   131   1e-30
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   127   2e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   121   2e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   122   6e-28
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   122   1e-27
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   1e-27
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   2e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   4e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   120   4e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   5e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   119   7e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   119   8e-27
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   117   8e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   119   9e-27
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   119   1e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   1e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   119   1e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   118   2e-26
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   118   2e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   117   3e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   117   6e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   116   6e-26
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   117   6e-26
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   115   9e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   116   1e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   115   1e-25
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   112   3e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   113   5e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   113   6e-25
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   113   7e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   113   8e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   112   9e-25
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   111   2e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   111   3e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   110   6e-24
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   109   9e-24
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   108   2e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   108   2e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   2e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   108   2e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   107   3e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   4e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   107   5e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   107   6e-23
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   107   7e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   106   8e-23
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   106   8e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   106   9e-23
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   105   1e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   105   2e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   105   2e-22
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   103   5e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   103   7e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   102   1e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   100   6e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   100   8e-21
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   100   8e-21
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   100   1e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    99   2e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    97   7e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    97   8e-20
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   2e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    94   5e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    93   2e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    90   1e-17
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    89   2e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    86   3e-16
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    84   7e-16
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    80   9e-15
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    76   2e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    76   2e-13
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    76   3e-13
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   5e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    69   4e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    67   2e-10
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    66   3e-10
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    64   2e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     63   2e-09
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    61   1e-08
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    58   1e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   4e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   1e-06
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    50   3e-05
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    47   2e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    45   9e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.31 
NCAS0I02300 Chr9 complement(426211..435288) [9078 bp, 3025 aa] {...    37   0.49 
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    36   0.58 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    36   0.67 
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    35   0.81 
NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON}             35   0.92 
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    35   1.2  
NCAS0B03980 Chr2 (712826..716380) [3555 bp, 1184 aa] {ON} Anc_8....    35   1.5  
KNAG0G00480 Chr7 (82725..84221) [1497 bp, 498 aa] {ON} Anc_1.483...    34   1.7  
YDR460W Chr4 (1383811..1384776) [966 bp, 321 aa] {ON}  TFB3Subun...    34   2.0  
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    34   2.1  
TBLA0B03520 Chr2 (819266..821713) [2448 bp, 815 aa] {ON} Anc_8.7...    34   2.2  
KNAG0E02930 Chr5 (588769..590532) [1764 bp, 587 aa] {ON} Anc_2.1...    33   2.8  
ZYRO0A02244g Chr1 complement(179204..180214) [1011 bp, 336 aa] {...    33   3.2  
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    33   3.5  
TPHA0E01380 Chr5 (278339..281998) [3660 bp, 1219 aa] {ON} Anc_5....    33   3.7  
NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON} Anc_5...    33   3.8  
Skud_12.509 Chr12 complement(906950..908206) [1257 bp, 418 aa] {...    33   4.1  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    33   5.7  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   7.6  
Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON} (19685.....    32   7.9  
KNAG0A02280 Chr1 complement(208088..210670) [2583 bp, 860 aa] {O...    32   8.3  

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score = 2033 bits (5266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 999/999 (100%), Positives = 999/999 (100%)

Query: 1   MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
           MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN
Sbjct: 1   MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60

Query: 61  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
           VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121 NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
           NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121 NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181 IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240
           IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP
Sbjct: 181 IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240

Query: 241 RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300
           RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN
Sbjct: 241 RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300

Query: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF
Sbjct: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360

Query: 361 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA
Sbjct: 361 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP
Sbjct: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540
           QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK
Sbjct: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540

Query: 541 RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600
           RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN
Sbjct: 541 RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600

Query: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660
           KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI
Sbjct: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660

Query: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720
           QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN
Sbjct: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720

Query: 721 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 780
           NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN
Sbjct: 721 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 780

Query: 781 DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 840
           DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT
Sbjct: 781 DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 840

Query: 841 LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNI 900
           LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNI
Sbjct: 841 LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNI 900

Query: 901 ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 960
           ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN
Sbjct: 901 ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 960

Query: 961 TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
           TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE
Sbjct: 961 TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1709 bits (4425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 886/1000 (88%), Positives = 949/1000 (94%), Gaps = 1/1000 (0%)

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
            MPAENQNT Q+RSSN+IS N N+Q+GCH VPNEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240
            IELYNEELKDLLD+NSN SSN GF+G FMKKLRIFDS+TANNTTSNSASSSRSNSRNSSP
Sbjct: 181  IELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSP 240

Query: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQ-TTNSRNNSSSNPGSTNNNIPGNINTN 299
            RSLNDLTPKAALLRKRLRTKSLPNTIKQQ+QQQ   NSRNNSSSN GST NN   N NTN
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTN 300

Query: 300  NSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 359
            N QRSSMAPNDQ+NGIYIQNLQEFHITNAMEGLNLLQ+GLKHRQVASTKMNDFSSRSHTI
Sbjct: 301  NGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360

Query: 360  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419
            FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL
Sbjct: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420

Query: 420  ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
             DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK
Sbjct: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480

Query: 480  PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 539
            PQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC
Sbjct: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540

Query: 540  KRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFN 599
            KR+IESL+SKN+LL+KDKLKSK+TIQSQN Q+ESLK TI+ L+AQLDKQHKTE+EIS FN
Sbjct: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600

Query: 600  NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETN 659
            NKLQKLTE+MQ+AL DYK+RELDLN+KFE HI+KEIK LK+TLF QL+ M+Q +I QETN
Sbjct: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660

Query: 660  IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFY 719
            IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIRVDFQ+FY
Sbjct: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720

Query: 720  NNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL 779
             NIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYE+IEK+T+EFVENFK  L
Sbjct: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780

Query: 780  NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 839
            NDHL+ENKKLIMQNLT ATSAVI+QEMDLFEPKRVKWENSFDLIN CDSMNNEFYN+MA 
Sbjct: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840

Query: 840  TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDN 899
            TLSQIK+TVDTSSNSMN+SISVMKGQVEESENA+SLLKNN KFNDQF+QL+NKH +LKDN
Sbjct: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900

Query: 900  IENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLS 959
            I+NSITSTHSHITN+DDIY+TIENIMKNYGNKENA K+EMI+NILKEIP+LSK++PLRLS
Sbjct: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLS 960

Query: 960  NTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
            N N NS Q+++SPKKHAI+DEN S+E  D E SRK+ K E
Sbjct: 961  NINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1699 bits (4399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 887/1002 (88%), Positives = 945/1002 (94%), Gaps = 3/1002 (0%)

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
            MP ENQN+ QER+SNNIS N N+QIGCH V NEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240
            IELYNEELKDLLDNNSN+SSNNGF+G FMKKLRIFDS+TANNTTSNSASSSRS+SRNSSP
Sbjct: 181  IELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNSSP 240

Query: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQ---TTNSRNNSSSNPGSTNNNIPGNIN 297
            RSLNDLTPKAALLR+RLRTKSLPNTIKQQ Q Q   T NSRNNSSSN GS  NNI  + N
Sbjct: 241  RSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTN 300

Query: 298  TNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 357
             NN QR+S+APNDQSNGIYIQNLQEFHITNAMEGL LLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 301  NNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360

Query: 358  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 417
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420

Query: 418  ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
            AL DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480

Query: 478  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 537
            NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540

Query: 538  ECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 597
            ECKR+IESL+SKNSLL+K+KLKSK+TIQSQNSQ+ESLK TI+ L+ QLDKQHKTELEISG
Sbjct: 541  ECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600

Query: 598  FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 657
            FN+KLQKLTE+MQ+ALQDYKRRELDLNKKFETHI+ EIK++KTTLFSQLS ++Q NI QE
Sbjct: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660

Query: 658  TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 717
            T+IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII VDF+R
Sbjct: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720

Query: 718  FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 777
            FY NIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKT++FVENFK 
Sbjct: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780

Query: 778  TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 837
             LNDHLEENKKLIM+NLT  TSAVI+QEM LFEPKRVKWE+SFDLIN+CDSMNNEFYN+M
Sbjct: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840

Query: 838  ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILK 897
            ATTLSQIK+TVDTSSNSMNKSISVMKGQVEESENA+SLLKNN KFNDQFKQL+NKHTILK
Sbjct: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900

Query: 898  DNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLR 957
            DNIE+SITST+SHITNIDDIY+TIE IM NYGNKENA K+EMI+N+L EIP+LSKR+PLR
Sbjct: 901  DNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960

Query: 958  LSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
            +SNTN NS QNI+SPKKHAI+DEN SN   D E SRKI KTE
Sbjct: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score = 1693 bits (4385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 895/1001 (89%), Positives = 949/1001 (94%), Gaps = 5/1001 (0%)

Query: 1   MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVV 58
           MPAE+QNTIQERSSN+IS+N N   Q+GCH VPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1   MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 59  VNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118
           VNVPDITGS+EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 61  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178
           GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 121 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 179 SFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNS 238
           SFIELYNEELKDLLDNNSN SSNNGF+G FMKKLRIFDS+TANNTTSNSASSSRSNSRNS
Sbjct: 181 SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 239 SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINT 298
           SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQ QQQ  NSRNNSSSN GS  NN   + + 
Sbjct: 241 SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANN---SSSN 297

Query: 299 NNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 358
            N QRS M  NDQSNGIYIQNLQEFHITNA+EGLNLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 298 TNGQRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHT 357

Query: 359 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418
           IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA
Sbjct: 358 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 417

Query: 419 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
           L D+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN
Sbjct: 418 LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477

Query: 479 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 538
           KPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQE
Sbjct: 478 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 537

Query: 539 CKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598
           CKR+IESL+SKNSLL+KDKLKS++TIQSQNSQMESLK TIN LKAQLDKQHK ELEISGF
Sbjct: 538 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 597

Query: 599 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 658
           NNKLQK+TE+MQ+ALQDYK+RELDLNKKFETHISKEIKSLKT LF QL  M+Q NI QET
Sbjct: 598 NNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQET 657

Query: 659 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 718
           +IQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR++FQ F
Sbjct: 658 DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 717

Query: 719 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778
           Y NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE+IEKKT++FVENFK T
Sbjct: 718 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMT 777

Query: 779 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838
           LNDHLEENKKLIMQN+TNATSAVI+QEMDLFEP+R KWENSFDLINKCDSMNNEFYNNMA
Sbjct: 778 LNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 837

Query: 839 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKD 898
            TLSQIK TVDTSSNSMN+SISVMKGQVEESENA+SLLKNN KFNDQFKQL++KH ILKD
Sbjct: 838 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKD 897

Query: 899 NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRL 958
           NIE+SITSTHSHITN+DDIY+TIE+IM N+GNKENA K+EMIDNILKEIP+LSKR+PLR+
Sbjct: 898 NIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 957

Query: 959 SNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
           SN NG S Q+I+SPKKH I+DENPS+E  D E SRKI KTE
Sbjct: 958 SNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/939 (53%), Positives = 674/939 (71%), Gaps = 50/939 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL ++   +S+        +KL
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184

Query: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQ 272
           RIFDSNT +  T++ ++ + + +  ++    +   P A  LRKR +T     ++ Q HQ 
Sbjct: 185 RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP---SVTQSHQ- 240

Query: 273 QTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 332
                                      NSQ       DQ+ GIYIQNLQ+FHITNA EG+
Sbjct: 241 ---------------------------NSQ-------DQNAGIYIQNLQDFHITNAKEGI 266

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 392
            LLQ+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RS
Sbjct: 267 KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRS 326

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 452
           GA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 327 GAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIAT 386

Query: 453 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 512
           ISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILVKNIT ELAKIK+DLLSTKSK
Sbjct: 387 ISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSK 446

Query: 513 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQME 572
           EGIYMSQD+YK L +DLESYK EV+ECKR IE+L+S+N+LLLKDK  S +    Q  +++
Sbjct: 447 EGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQ 506

Query: 573 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 632
           +++  ++ L ++ +KQ+K E  +    + L+     MQ  +++++RRE D+  K     +
Sbjct: 507 NMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFN 566

Query: 633 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK 692
            E   +K T+ S +  +EQ    +   +Q N+D I+ E+  L+E  Q++ + MYKDCV+K
Sbjct: 567 NEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEK 626

Query: 693 ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 752
           IL+E+P  F +  EK+  +       + ++ ENLSD+SEE NNL+QYL +HFFKNNH+E+
Sbjct: 627 ILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEI 686

Query: 753 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 812
           L  HID TY  I+    +  + FK  +++HLE+NK L++++L  AT  VI +EM LFEP+
Sbjct: 687 LVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQ 746

Query: 813 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 872
           + KWE+SF  INKCDS+N  F N + + L  IK+T+ +S  ++NK+I+ +K Q++E E+ 
Sbjct: 747 KKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESP 806

Query: 873 VSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE 932
            S+L N++ F++QF  ++NK ++L ++++ S+  T  H   +D + + I++++   G+  
Sbjct: 807 ASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSM 866

Query: 933 NAVKNEMIDNILKEIPS----LSKRVPLRLSNTNGNSAQ 967
              + E +D IL+ +         R PLR +N   N ++
Sbjct: 867 EGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSE 905

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/940 (54%), Positives = 673/940 (71%), Gaps = 37/940 (3%)

Query: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           G   EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K 
Sbjct: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y VDKVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208
           LSD+AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD++  NSS        
Sbjct: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS-------- 180

Query: 209 MKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTI-K 267
           M+KLRI+DS +     SNS S SR NSRN+SP+ + D      + R+R+RT  L +++ K
Sbjct: 181 MRKLRIYDSGSG----SNSNSGSRKNSRNNSPKLVTD----PMINRRRMRTVPLSSSLAK 232

Query: 268 QQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITN 327
           QQHQ Q    R                       Q+      D  +G+YIQNLQ+FHIT+
Sbjct: 233 QQHQWQ---QRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITS 289

Query: 328 AMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSE 387
           A +GL LLQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSE
Sbjct: 290 ARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSE 349

Query: 388 NINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKT 447
           NI+RSGA +QRAKEAGSINQSLLTLGRVIN+LADKS H+PFRESKLTRLLQDSLGGNTKT
Sbjct: 350 NISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKT 409

Query: 448 ALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLL 507
           ALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKDILVKNIT ELAK+KSDLL
Sbjct: 410 ALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLL 469

Query: 508 STKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQ 567
           STK +EG+YMSQD+YK + +DLESYK E+QE KR IE LSS+NSLLLKDK  S +  + Q
Sbjct: 470 STKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQ 529

Query: 568 NSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKF 627
             +++++K  ++ L  +L+ QHK E E+      L+    + Q  +++Y +RE  ++++ 
Sbjct: 530 RIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERM 589

Query: 628 ETHISKEIKSLKTTLFSQLSGMEQNNI-------SQETNIQPNLDIIKNEVLTLMETMQE 680
           +  + +E    +  L + +  +  N+         ++  IQ NL++++ EV+ L+   Q+
Sbjct: 590 QMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQK 649

Query: 681 KAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYL 740
           +AE MYKD ++KIL E+P  F  I  K+D + V    ++  + ENLSDISE  NNLKQY 
Sbjct: 650 RAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYF 709

Query: 741 KNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 800
            +HFFKNNH+E+LN HID TY+ ++      ++ FK  ++DHL++NK L+M++L +AT+ 
Sbjct: 710 NDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTE 769

Query: 801 VINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSIS 860
            I++EM LFEP+R KWE SFDLIN CDS++N F  +M + LS IK+T  +S++ +++S+S
Sbjct: 770 AIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVS 829

Query: 861 VMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDT 920
            +K +V+  E+A ++L  N+    Q   ++NK + L++ +  SI S+  HI+  D++ + 
Sbjct: 830 KVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKER 889

Query: 921 IENIMKNYGNKENAVKNEMIDNILKEIPSL---SKRVPLR 957
           I N + +    EN+  ++   N +   P L   S+R PL+
Sbjct: 890 IRNTIAS----ENSTLHQ---NKIATTPPLGQNSERSPLK 922

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/910 (56%), Positives = 668/910 (73%), Gaps = 37/910 (4%)

Query: 34  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDK 93
           ELNITVAVRCRGRNEREI  KS VVV VPDITG++E+SINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LSD 151
           VFGP A QDLIF EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 152 AAGIIPRVLLKLFDTLELQQN--------DYVVKCSFIELYNEELKDLLDNNSNNSSNNG 203
           AAGIIPR+L KLFDTL+  ++        D+VVKCSF+ELYNE+LKDLL+ +SN+     
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 204 FE-GPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSL 262
            + G   +KLRIFDS   NN  SNS +SSR++SRN+SPR+ + + P A      +R KS 
Sbjct: 208 QQLGS--RKLRIFDSTNNNNNNSNSNASSRASSRNNSPRT-SSILPNANATNLAMRKKS- 263

Query: 263 PNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQE 322
              I+  +         NS++   S+NN  P   NTN+   S   P++ +NGIYIQNLQE
Sbjct: 264 ---IRYNY---------NSNNKAKSSNNTRP---NTNDEPSSIAGPDENTNGIYIQNLQE 308

Query: 323 FHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVD 382
           FHITNA EGL+LLQ+GLKHRQVASTKMNDFSSRSHTIFTITLYK+H+D LFR+SKMNLVD
Sbjct: 309 FHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVD 368

Query: 383 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLG 442
           LAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LADKS H+PFRESKLTRLLQDSLG
Sbjct: 369 LAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLG 428

Query: 443 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKI 502
           GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I+KDIL+KNIT ELAK+
Sbjct: 429 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKV 488

Query: 503 KSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKD 562
           KSDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR IE LSS+NS+LLKDK  + +
Sbjct: 489 KSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANE 548

Query: 563 TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELD 622
             + Q  ++ +LK +++ L  +L+ Q+  E ++     +L+K  E +   +++Y+ ++  
Sbjct: 549 VNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQ 608

Query: 623 LNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKA 682
           L  +    +++ +  LK  L S    + Q+      +++ NL +IK+E+ +++E  Q K 
Sbjct: 609 LKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEMNLKVIKDEITSMLEKTQHKT 666

Query: 683 ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN 742
           E+MYK+ +++ L ++P     I E +  +      +YN I ENLSDISEE NNLKQYL N
Sbjct: 667 EMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDN 726

Query: 743 HFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 802
            FF+NNH++LLN HI++T + + + ++E    FK  ++ HL ENKKL++ N   AT+ VI
Sbjct: 727 DFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVI 786

Query: 803 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 862
            +EM+LF+PKR KWE S +LIN+CDS+NN F++NM   +S+IK  + +SS+S++ +I+ +
Sbjct: 787 TKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASI 846

Query: 863 KGQVEE-----SENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDI 917
           K QV E       +  + L+N+  FN  F +++ K+ IL+ N +N+I  T   + NID++
Sbjct: 847 KSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDEL 906

Query: 918 YDTIENIMKN 927
            +T++  + N
Sbjct: 907 SETVKIALNN 916

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/918 (55%), Positives = 658/918 (71%), Gaps = 39/918 (4%)

Query: 35  LNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           LNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           FGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 155 IIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRI 214
           IIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+LKDLL++N+N+ +N+      + KLRI
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSN---INKLRI 228

Query: 215 FDSNTANNT-TSNSASSSRSNSRNSSPRSLNDLTPKAA-----LLRKRLRTKSLPNTIKQ 268
           FDS+TA+N     S +SSR+NSRN+SPR LN  T          LR++L++    N    
Sbjct: 229 FDSSTASNVNVPGSNASSRANSRNNSPR-LNPSTSNVGTTNNNYLRRKLKSSRYSNP--- 284

Query: 269 QHQQQTTNSRNNSSSNPGSTNN-------NIPGNINTNNSQRS-----------SMAPND 310
             +     + N SSS    T N       N   N+NTN++ R+           +   +D
Sbjct: 285 --ENSNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDD 342

Query: 311 QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD 370
            +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+HQ 
Sbjct: 343 NNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQG 402

Query: 371 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRE 430
            LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LAD++ HIPFRE
Sbjct: 403 TLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRE 462

Query: 431 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDI 490
           SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I KDI
Sbjct: 463 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDI 522

Query: 491 LVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKN 550
           L+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE LSS+N
Sbjct: 523 LLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQN 582

Query: 551 SLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQ 610
           +LLLKDK  S +  + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   +  +
Sbjct: 583 ALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFK 642

Query: 611 LALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNE 670
             +++Y+ +++D+  K E  +  ++ SL+  L    + ++  N   + +I  NLD+I+NE
Sbjct: 643 KMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQNE 702

Query: 671 VLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS 730
           V+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  Q  +  +A+NLSDIS
Sbjct: 703 VIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDIS 762

Query: 731 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 790
           EE NNLKQYL  + F+NNH++L+N HI+ST + +          FK+ +N HLE N+ L+
Sbjct: 763 EEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLM 822

Query: 791 MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 850
           + +   AT  VIN+EM+LF P++ KWE S DLIN+CDS+NN F   +   LS  ++ +  
Sbjct: 823 LNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKITA 882

Query: 851 SSNSMNKSISVMKGQVEE------SENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSI 904
           S N M  + + +K ++        S N  +++++N+    QF +L  K++I +DN+ENS+
Sbjct: 883 SINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVENSL 942

Query: 905 TSTHSHITNIDDIYDTIE 922
               + + N++ + D+I+
Sbjct: 943 KCAVASVNNLNHLEDSIK 960

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/911 (54%), Positives = 655/911 (71%), Gaps = 33/911 (3%)

Query: 30  VPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRY 89
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K Y
Sbjct: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86

Query: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149
           TVDKVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146

Query: 150 SDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD--NNSNNSSNNGFEGP 207
            DAAGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD  N + NS N      
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200

Query: 208 FMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRL-RTKSLPNT- 265
             KKLRIFDSN   N TS S SSSRS+SRN+SPRS  D   +A +LR++L R  +  N+ 
Sbjct: 201 --KKLRIFDSNV--NGTSASGSSSRSSSRNNSPRSAPD-NSRAQMLRRKLGRHNTTGNSK 255

Query: 266 -----------IKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNG 314
                       KQ  Q+ T   R ++S+N    N +IP N   +N+     +P DQS  
Sbjct: 256 ISNNNHNKFSRFKQTSQEST---RAHASNN--HQNVHIPNN--NSNNTNQQQSPIDQSAS 308

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR 374
           IYIQNL+EFHIT+AMEGL LLQ+GLK RQVASTKMNDFSSRSH+IFTITLYK+   ELFR
Sbjct: 309 IYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFR 368

Query: 375 ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLT 434
           +SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKLT
Sbjct: 369 VSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLT 428

Query: 435 RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKN 494
           RLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV++
Sbjct: 429 RLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRS 488

Query: 495 ITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLL 554
           IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IESL+++N++L 
Sbjct: 489 ITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQ 548

Query: 555 KDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQ 614
           +++L  KD      + + SLK  +  L++ L +Q   E  I      +Q   E M+  + 
Sbjct: 549 QERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIH 608

Query: 615 DYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTL 674
            ++ ++ +L +   T IS EI +++ TL   +  ++ N   ++T I  NL  ++ EV+ +
Sbjct: 609 LFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKV 668

Query: 675 METMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENN 734
           ++  +E+A   Y +CVK +L E+P+ F  +  ++D I    +  ++ IAE LSD+SEE N
Sbjct: 669 IKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLSDVSEEYN 728

Query: 735 NLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNL 794
           NLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ +++ ++NF   L+ H++ENK+ +++N+
Sbjct: 729 NLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENI 788

Query: 795 TNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS 854
              T  VIN E+ +F  +R KWE S  LIN+CDS+N+ F+  + + L +I++ V +S ++
Sbjct: 789 LGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDN 848

Query: 855 MNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNI 914
           +  +IS ++ +    ++   +++ N     Q  ++  K+  L    E+S  +  + I ++
Sbjct: 849 IGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETATTSIGSV 908

Query: 915 DDIYDTIENIM 925
           + +   ++ IM
Sbjct: 909 NKVEGNLKVIM 919

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/963 (51%), Positives = 644/963 (66%), Gaps = 57/963 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL        N   E   +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLL--------NEPQESGVIKKL 186

Query: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQ 272
           RIFDSNT ++ + N++ ++  N           L   +   ++  +T   P   KQQ Q 
Sbjct: 187 RIFDSNTTSSNSRNNSRNNSPN-----------LVGTSGTFKRIFKT---PVPYKQQQQH 232

Query: 273 QTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 332
           Q    +              P  IN  N Q+S    ++QS+ IYIQNLQEFHITNA +G+
Sbjct: 233 QQHLQQQQQQQ---------PRLIN--NKQQS---LSEQSSAIYIQNLQEFHITNAKDGI 278

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 392
           NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H  E+FR+SKMNLVDLAGSENI+RS
Sbjct: 279 NLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFRVSKMNLVDLAGSENISRS 338

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 452
           GA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 339 GAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIAT 398

Query: 453 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 512
           ISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MKDILVKNIT ELAKIKSD LSTKSK
Sbjct: 399 ISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKNITRELAKIKSDFLSTKSK 458

Query: 513 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQME 572
           +GIYM+QDHYK L SDLE+YK EVQECKR+IE ++S+N LLLKDK  S +  + Q  +++
Sbjct: 459 DGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLLKDKRASHEVSELQRIKIK 518

Query: 573 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 632
            L   I  L  ++DKQHK E ++    + L+     +Q +L++ +  +L    + E  + 
Sbjct: 519 HLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLY 578

Query: 633 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK 692
             + S K ++  QL+ M+ ++ S+   I  N+DII+ E+  ++E++   +  + + CV+K
Sbjct: 579 DHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQVLESICSTSVDVCRSCVEK 638

Query: 693 ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 752
           IL  +PK F  I   +  I      + N + +NL DISEE NN ++YL  H FKNNH+E 
Sbjct: 639 ILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGDISEEYNNFREYLNEHLFKNNHEET 698

Query: 753 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 812
           L+ H+D TY  ++K   E    FK  ++ HLEENK L++++L  A+  V+ +E+ LF P 
Sbjct: 699 LSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPV 758

Query: 813 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 872
           + KWE+S + INKCDS+NN F + +   L +++  ++ S      +   +K  +++ +  
Sbjct: 759 KQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGI 818

Query: 873 VSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKN----- 927
             +LKNN K  +   ++  KHT L+D +E     T S+I   ++ ++ I+  ++      
Sbjct: 819 SEVLKNNTKVVNNINEVKEKHTFLRDQVER----TSSYIEAANEKFEGIDQFIRQIIDKK 874

Query: 928 -----YGNKE--NAVKNEMIDNILKEIPSLSKRVPLRLS----NTNGNSAQNILSPKKHA 976
                 GN E  N +  ++    LK I S S R P   S     T  N+  N +SP K  
Sbjct: 875 LPTHLVGNGELVNVMLEQLGKTHLKPIGSAS-RTPSSRSVSPMKTLDNNIFNGISPSKRK 933

Query: 977 IDD 979
           +D+
Sbjct: 934 VDE 936

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/916 (52%), Positives = 644/916 (70%), Gaps = 43/916 (4%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GS+EV+INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL  + NN + N       KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 188

Query: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNT--IKQQH 270
           RIFDS             SRSNSRN+SP+  N+ T     L+K+LR ++L  +  I    
Sbjct: 189 RIFDS---------LGRDSRSNSRNNSPKMSNNNT---TFLKKKLRNEALLRSRNIASSK 236

Query: 271 QQQTTNSRNNSSSNPG---------STNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQ 321
           +      RN +++            S+ NN   N  +      S   +DQ+ GIYIQNLQ
Sbjct: 237 RSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQ 296

Query: 322 EFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLV 381
           EFHIT A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+SKMNLV
Sbjct: 297 EFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLV 356

Query: 382 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSL 441
           DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+LADK+ H+PFRESKLTRLLQDSL
Sbjct: 357 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSL 416

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAK 501
           GGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKDIL+KNIT EL K
Sbjct: 417 GGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTK 476

Query: 502 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSK 561
           IKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IESL+S+N+LLLKDK    
Sbjct: 477 IKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTIN 536

Query: 562 DTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG----FNNKLQKLTEIMQLALQDYK 617
           +  + Q  +++++  ++ +L A++++Q   E E+ G    F     KLT+I    + + K
Sbjct: 537 ENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKI----IDEMK 592

Query: 618 RRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMET 677
            RE  +N KF+T +   +  +   L  Q+   +   I+Q   +  NL +IK+E+  L+ T
Sbjct: 593 NREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLST 652

Query: 678 MQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLK 737
            ++  E  Y++C+ K L+++P  F+ I + +  ++     +Y+ IAENLSD+SEE NN K
Sbjct: 653 ARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFK 712

Query: 738 QYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNL 794
           Q++ + F+   K +  ELLN +I++T   IE  +++ +   +N LN+HL  NK+LI+ +L
Sbjct: 713 QFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSL 772

Query: 795 TNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNS 854
           +N T+ +++ E+D  +PK  KWE S +LIN+ D++NNEF +N+ ++++ + + +  +++S
Sbjct: 773 SNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDS 832

Query: 855 MNKSISVMKGQVEESENAVS---LLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHI 911
           +N +I  +    + ++ A S   ++ +N    + FK +  K++ L + ++     T+  +
Sbjct: 833 INNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESM 892

Query: 912 TNIDDIYDTIENIMKN 927
             ++++  +I  ++K+
Sbjct: 893 KKLNELDTSIRTVLKD 908

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/930 (50%), Positives = 652/930 (70%), Gaps = 58/930 (6%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD     +S         KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINST-------AKKL 183

Query: 213 RIFDSNTAN---------------------NTTSNSASSSRSNSRNSSPRSLNDLTPKAA 251
           RIFDSN +                      N  +N+ +++ +N R++SP + +   P+  
Sbjct: 184 RIFDSNASQIRKVSEYNKTNTSTNTGTNNNNNNNNNNNNNNTNGRSTSPSNSSKSRPQPI 243

Query: 252 LLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNI-----------NTNN 300
           L   R+R++               +S NN+   P S+N N   +             ++ 
Sbjct: 244 LGNNRIRSR--------------LSSSNNAFLKPSSSNLNTSNDTIASSSSSSSSSTSSA 289

Query: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
              S+++P+ Q+ GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIF
Sbjct: 290 YTSSTVSPDKQT-GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIF 348

Query: 361 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           TI LYK+H  ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LA
Sbjct: 349 TINLYKEHDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 408

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           DK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKP
Sbjct: 409 DKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKP 468

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540
           QLG+ I KDILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECK
Sbjct: 469 QLGSIITKDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECK 528

Query: 541 RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600
           R I+ L+++N LLLKDK  S +    Q  +++S+K +I+ L   ++KQH+ E  +     
Sbjct: 529 RVIDGLTTQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLIL 588

Query: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660
           KL+  +  MQ  ++ +  RE     K +   ++E+  LK+ L   L  + +  +   T++
Sbjct: 589 KLKSKSIEMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDL 648

Query: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD-FQRFY 719
             N++ IK+EV ++++T Q +A  +YKDC+++++ ESP     + +  DII++      Y
Sbjct: 649 GMNIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLY 706

Query: 720 N-NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778
           N  ++ ++S+++ E+N+LKQYL   FFK++H+E+LN HI+ TY++I + ++  VE  K  
Sbjct: 707 NEQLSISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTG 766

Query: 779 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838
           L  +LEE++ +I+ +L N TS ++  EM+LF PK+ KWE+SF++INKCDS+NN+++ +++
Sbjct: 767 LELYLEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDIS 826

Query: 839 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKD 898
             LS +K +V ++S+ ++  +S M+   + +  +  L +N+K+   QF +++ K++ L+ 
Sbjct: 827 ALLSNMKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLES 886

Query: 899 NIENSITSTHSHITNIDDIYDTIENIMKNY 928
           ++  SIT   S I   D + ++I +  + Y
Sbjct: 887 HLNESITMNESSINAFDKLSESIHSAFEKY 916

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/950 (48%), Positives = 623/950 (65%), Gaps = 57/950 (6%)

Query: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKK 211
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD   ++S          KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSS--------MPKK 175

Query: 212 LRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQ 271
           LRIFDS +  ++ S ++S + S   N            +   R++ R  S+    K    
Sbjct: 176 LRIFDSVSNVSSNSRASSRNNSPKPNEG---------SSFGTRRKTRAPSIHRPTK---- 222

Query: 272 QQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEG 331
                   +  S P                    ++P + S+ I+IQNLQEFHI +A EG
Sbjct: 223 --------SPVSKP--------------------VSPCEPSSAIHIQNLQEFHIMDAKEG 254

Query: 332 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 391
           + LLQRGL+HRQVASTKMND SSRSHTIFTI LYKK   E FR+SKMNLVDLAGSENI+R
Sbjct: 255 IRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSKMNLVDLAGSENISR 314

Query: 392 SGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIA 451
           SGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 315 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLLQDSLGGNTKTALIA 374

Query: 452 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKS 511
           TISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+L+K++T EL KIKSDLLSTKS
Sbjct: 375 TISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTAELVKIKSDLLSTKS 434

Query: 512 KEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQM 571
           K+GIYMSQ++YK L ++LE+YK EV+ECKR +E +S++NSLL+K+K  S +  +SQ  ++
Sbjct: 435 KDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEKRVSNEVNESQKVKL 494

Query: 572 ESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHI 631
             L   I  L  ++D+QHK E E+S    +L +    MQ +L+ Y+ +    + + E  +
Sbjct: 495 RKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYEDQGQRFHTEMERVL 554

Query: 632 SKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVK 691
              I S K +L  ++  ++ N      +++ N+D +  E+  + + M      ++++ +K
Sbjct: 555 YDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIK 614

Query: 692 KILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQE 751
           K+ +++P +F  I  +++ I      + +N+  +LS ISEE NNLK YL  HFFKNN QE
Sbjct: 615 KVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQE 674

Query: 752 LLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEP 811
            L+ H+D TY  ++   +      +  LN+ L+ NK+ +MQ+L +A S V+ +EM L +P
Sbjct: 675 ALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDP 734

Query: 812 KRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESEN 871
            +  WENS + IN+CD +NN F N +  T+++I  T+D    +   +    K ++     
Sbjct: 735 VKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAKSELTRVRA 794

Query: 872 AVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNK 931
           A S L+NN         +  KH +LK  +++S     +      +I ++I++++      
Sbjct: 795 AFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIP 854

Query: 932 ENAVKNEMIDNILKEI--PSL-----SKRVPLRLSNTNGNSAQNILSPKK 974
           +   +N  ID +L+++   SL     S + P+R    +  +   +L P+K
Sbjct: 855 QPQSENP-IDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLPPQK 903

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/883 (49%), Positives = 599/883 (67%), Gaps = 74/883 (8%)

Query: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKK 211
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD+  +          + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPD----------YSKR 187

Query: 212 LRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQ 271
           LRIFDSNT  N        SR+ S+N+SP+                             +
Sbjct: 188 LRIFDSNTITN--------SRAGSQNNSPK-----------------------------E 210

Query: 272 QQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPN---DQSNGIYIQNLQEFHITNA 328
           Q  T     SSS       +IP        +R S+      +QS+ IYIQNLQEFHITNA
Sbjct: 211 QDGT-----SSSMAKRRYTHIP-----TKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNA 260

Query: 329 MEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSEN 388
            EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++ ELFRISKMNLVDLAGSEN
Sbjct: 261 REGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSEN 320

Query: 389 INRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTA 448
           I+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKLTRLLQDSLGGNTKTA
Sbjct: 321 ISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTA 380

Query: 449 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLS 508
           LIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKDILVK+I+ EL+K+KSD LS
Sbjct: 381 LIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLS 440

Query: 509 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQN 568
           TK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR +ES SS+NSLLLKDK  S+   + Q+
Sbjct: 441 TKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQD 500

Query: 569 SQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFE 628
            ++  L+ TI  L  ++++QH+ E+++    +KL++    M+ +LQ+Y+  EL L    +
Sbjct: 501 MKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIK 560

Query: 629 THISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKD 688
             + + I S + ++   L  ++   + +  +I  N+D I+      +++++     M  +
Sbjct: 561 EVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTN 620

Query: 689 CVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNN 748
            VK + ++    +    E +  +    Q +   +   L++++EENNN+K+YL  HF KNN
Sbjct: 621 IVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNN 680

Query: 749 HQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDL 808
           +QE+L+  ++  Y   +  +   + +  + +  H+EE++ L++ ++ +A S +I++E+++
Sbjct: 681 NQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEM 740

Query: 809 FEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTS-------SNSMNKSISV 861
           F+P + +W  SF+ IN+CD+ + +F N     L+ +K   D S       +  + ++++ 
Sbjct: 741 FQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVVAADDVAKQVQENVTN 800

Query: 862 MKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSI 904
            +G V ++    S++K     ND       KH +L+D+ EN+I
Sbjct: 801 FEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFENNI 836

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/954 (46%), Positives = 618/954 (64%), Gaps = 65/954 (6%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD   ++S          +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSS--------MPRKL 176

Query: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQ 272
           RIFDS T  N++ +S+ +S       S           +  ++R+R    PNT+ +  + 
Sbjct: 177 RIFDSVTNPNSSRSSSRNSSPKPPEGS----------TSGTKRRIR----PNTMYKPSRS 222

Query: 273 QTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 332
            T     +S  N                            + I+IQNLQEFHI +A EG+
Sbjct: 223 PTVKPTLSSELN----------------------------SAIHIQNLQEFHIMDAKEGI 254

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 392
            LLQRGL+HRQVASTKMND SSRSHTIFTI LY+K   E FR+SKMNLVDLAGSENI+RS
Sbjct: 255 RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRS 314

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 452
           GA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 315 GAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIAT 374

Query: 453 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 512
           ISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LVKN+T EL KI+SDLL+TKSK
Sbjct: 375 ISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSK 434

Query: 513 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQME 572
           +GIYMSQ++YK L ++LE+YK EVQECKR IE LS++N LL K+K  + +  +SQ  +++
Sbjct: 435 DGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIK 494

Query: 573 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 632
            L   I+ L  ++D+QHK E E+S    +L +    MQ +L+ Y+ +      + E  + 
Sbjct: 495 KLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLY 554

Query: 633 KEIKSLKTTLFSQ---LSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDC 689
           + I S K +L ++   L G E++      ++  N+D +  E+  + + +      + +  
Sbjct: 555 ENIGSFKHSLLNEIEKLKGTEEDGF----DVDANIDTLTKELNRIYDFINTSTIEICRKF 610

Query: 690 VKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNH 749
           + KI  ++P +   I  +++ I      + +++  +LS ISEE N+LK YL  HFFKNN 
Sbjct: 611 MNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNF 670

Query: 750 QELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLF 809
           Q+ L+ H+D TY  ++   +      +  +N+ LE NK+++MQ+L NA S V+ +EM L 
Sbjct: 671 QDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLL 730

Query: 810 EPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEES 869
           +P +  WE+S + IN+CD +N+ F  ++ + +  +   ++        ++      +   
Sbjct: 731 DPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRF 790

Query: 870 ENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYG 929
           ++A   L+ +       +++  KH +LK  +++S +   +      +I D+I+ ++ +  
Sbjct: 791 QDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQA 850

Query: 930 NKENAVKNEMIDNILKEI---P----SLSKRVPLRLSNTNGNSAQNILSPKKHA 976
             +   +N  I+ +L+++   P      S + P+R++     S+  +  P+K +
Sbjct: 851 VSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRS 903

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/879 (49%), Positives = 594/879 (67%), Gaps = 67/879 (7%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD + ++S          K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188

Query: 213 RIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAA---LLRKRLRTKSLPNTIKQQ 269
           RIFDS++ N+++  S+ S       +SPR      P+ A     R+R R           
Sbjct: 189 RIFDSSSMNHSSRASSQS-------NSPRE-----PEVAHNGFSRRRQR----------- 225

Query: 270 HQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAM 329
                                  P  +  N    +    ++  +GIY+QN+QEFHI NA 
Sbjct: 226 -----------------------PPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAR 262

Query: 330 EGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENI 389
           EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK    ELFR+SKMNLVDLAGSENI
Sbjct: 263 EGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENI 322

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTAL 449
           +RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFRESKLTRLLQDSLGGNTKTAL
Sbjct: 323 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTAL 382

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLST 509
           IATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MKDILVKNI+ ELAKIKSD LST
Sbjct: 383 IATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLST 442

Query: 510 KSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNS 569
           KSK+GIYMS +HY+ + +DLE+ + E+QE KR IESL+S+N+LLLKDK  S++  + QNS
Sbjct: 443 KSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNS 502

Query: 570 QMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFET 629
           +++ L+ TI  L  ++++QH  E E++   +KL++    MQ +L+ Y+  EL L    + 
Sbjct: 503 KIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKE 562

Query: 630 HISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDC 689
            + + I S + ++   L  ++ + + +  +I+ N++ I       +++++     M  D 
Sbjct: 563 VLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMC-DT 621

Query: 690 VKKILNESP----KFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFF 745
           + K++ E+P    K FN   E +  ++ +   + N +   L++ISEENN+L++YL  H F
Sbjct: 622 LVKLIKETPSMYLKEFN---ETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLF 678

Query: 746 KNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQE 805
           KN+ QE+L+  ++S Y+ ++  + + +    + +  H+EE++ L++ ++ +  + +I+ E
Sbjct: 679 KNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNE 738

Query: 806 MDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQ 865
             LF+P R +W  S D IN+CD+ +  F     + L ++K   D S  S   +++  K +
Sbjct: 739 RSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHR 798

Query: 866 VEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSI 904
            +   + V  L  ++    Q   + +KH +L+D+ ++++
Sbjct: 799 TDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNV 837

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/892 (46%), Positives = 602/892 (67%), Gaps = 60/892 (6%)

Query: 14  SNNISNNLNAQIG-CHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSI 72
           +  + N+   +IG    +  +++NITVAVRCRGRN+REI  KS +VV VPD+T + EVSI
Sbjct: 3   TTGLGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSI 62

Query: 73  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           NT+G +GI AQ+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTST
Sbjct: 63  NTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTST 122

Query: 133 GKTYTMTGDEKL-YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDL 191
           GKTYTMTGD ++   G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DL
Sbjct: 123 GKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDL 179

Query: 192 L----DNNSNNSSNNGFEGPFM---KKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLN 244
           L    D+ SN + N+  +   +   KKLRIFDSN               NSR++SP    
Sbjct: 180 LSEGQDDFSNGTENSSKQPESLNASKKLRIFDSN---------------NSRSNSP---- 220

Query: 245 DLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRS 304
                            + NT    H+ ++   +    SN   + +++  ++N N   ++
Sbjct: 221 -----------------VTNTNNPTHKARSDYLKKKLKSNRKKSLDDM--SLNANAGGKT 261

Query: 305 SMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
            + P     GIYIQNL++FHI+ A EGL LLQRGL+ RQVA+TK+ND SSRSHTIFTITL
Sbjct: 262 HVPPT--QTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITL 319

Query: 365 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 424
           YKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+LADKS 
Sbjct: 320 YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379

Query: 425 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 484
           HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+
Sbjct: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439

Query: 485 FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIE 544
           FI+KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K E+ E KR  +
Sbjct: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499

Query: 545 SLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQK 604
           SL  +N LL K+K    +   S  S++++L+   +QLK+  +K  +T  + +  + ++  
Sbjct: 500 SLVQENELLGKEKKSGAERADSLKSELDNLR---SQLKSVTNKLAQTNTQNTKLSEQVTD 556

Query: 605 LTEI---MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQ 661
           +  I   ++  ++ Y+++      KF+  +  E+ +L   + SQ   ++  N S    I 
Sbjct: 557 MNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIH 615

Query: 662 PNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNN 721
            ++D I+ EV+ L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  
Sbjct: 616 THIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTE 675

Query: 722 IAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLND 781
           +A N SD+SEE N  KQYL   FF+NNH E++  H D    +++K + + +++ +N++ +
Sbjct: 676 MARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQN 735

Query: 782 HLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTL 841
           +L  N +++  ++ +    VIN+EMDLF PK+ KWE S DLIN+ DS++N+F NNM  ++
Sbjct: 736 YLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSV 795

Query: 842 SQIKNTVDTSSNSMNKSISVMKGQVEESE-NAVSLLKNNKKFNDQFKQLVNK 892
             I + +  S+ SM++SIS +K  + E++ N+   + +N+   + FK +  K
Sbjct: 796 DDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEK 847

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/680 (47%), Positives = 456/680 (67%), Gaps = 14/680 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSS 548
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R+IE LSS
Sbjct: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 549 KNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608
           +N LL KDK  S+DTI+SQ  Q+ +L+ +++ L  ++D +HK E+E++    KL+     
Sbjct: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668
           MQ AL+ ++  E  L    +  +   I   +  + ++L  ++Q  + Q   I  +++ +K
Sbjct: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728
           + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +        + + E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788
           I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +    N ++DH+E+N+ 
Sbjct: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848
           L+M  L  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K+ +
Sbjct: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 849 DTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTH 908
           +++    +     +K  +   ++   +       N     + NKH++L+D +E +++  H
Sbjct: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862

Query: 909 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSK-------RVPLRL--- 958
           +       I  +++ IM N+   E   +  + D+++K I S S        + PLR    
Sbjct: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKTET-LADDLIKHIDSSSVAPVASSGKTPLRPLLK 920

Query: 959 SNTNGNSAQNILSPKK--HA 976
           S T   S    +SP K  HA
Sbjct: 921 SETKQRSLSKSVSPAKSSHA 940

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/998 (35%), Positives = 588/998 (58%), Gaps = 69/998 (6%)

Query: 29  GVPNE-ELNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSEEVSINTTG-DTGITAQM 84
           GV ++ E NI V  R +G+  NE+   ++  +++  P +       I   G D  +    
Sbjct: 6   GVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV---- 54

Query: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-K 143
             + + +D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  
Sbjct: 55  -KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113

Query: 144 LYNGELSD-AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNN 202
           L + E S  + G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL +      +N
Sbjct: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQ-----HN 168

Query: 203 GFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSL 262
                 +KKLRI DS + N    N A+S+  N+R++SP + +   P  A++RK++  +SL
Sbjct: 169 SLLSASIKKLRIVDSGSPN--VKNGANSN-CNTRDNSPLTSSKSIP-TAIIRKKMGRQSL 224

Query: 263 PNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQE 322
              +KQ +    + SR+NS  N  S   +I         Q  + AP       YIQNL+E
Sbjct: 225 -TALKQANT--LSISRSNSF-NEYSPQRHI---------QEKTGAP-------YIQNLEE 264

Query: 323 FHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVD 382
           FHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ + E+FR+SK N VD
Sbjct: 265 FHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVD 324

Query: 383 LAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLG 442
           LAG+E+ ++    NQR K+   INQ +  L +++N+L +K   IPF++SKLT L++D+L 
Sbjct: 325 LAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLE 384

Query: 443 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKI 502
           GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+ L+K+I+ ELAK+
Sbjct: 385 GNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKV 444

Query: 503 KSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKD 562
           KSDLLSTKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+ L+ +++ L KDK   ++
Sbjct: 445 KSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEE 504

Query: 563 TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELD 622
             + Q  +++S++ +++ +   ++KQ + E ++    +KL++    M + +  Y  RE  
Sbjct: 505 VNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESS 564

Query: 623 LNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKA 682
           +  + +T  ++E+  LK+ L   L   E+N +     I+ NL+    E+  +++  + + 
Sbjct: 565 VQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEI 624

Query: 683 ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKN 742
           + ++ DC+KK+  ESPK F+  ++ +  +       YNN+AE LSD+SEE NNLKQY+  
Sbjct: 625 DSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINE 684

Query: 743 HFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVI 802
            FFKNNH+ELL  +++ TY  ++K + +F+  F + L  +LE NK +++QN+ +ATS VI
Sbjct: 685 KFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVI 744

Query: 803 NQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVM 862
             EM+ F P++ KWE S +LI K    +NEF       + ++++T+  +S S+  ++S M
Sbjct: 745 ENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEM 804

Query: 863 KGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIE 922
           K ++ E + A ++++NN+   ++F  ++ K+ ILKD +  ++TST   I   D + D+I 
Sbjct: 805 KSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIR 864

Query: 923 NIMKNYGNKE----NAVKNEMIDNILKE--IPSLSKR-VPLRLSNTNGNSAQNILS---- 971
           N+ KN  +       ++  E+ D + ++   P++  R  P+R S +   ++  I S    
Sbjct: 865 NVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVSPSRTSPQIQSLMNS 924

Query: 972 -----------PKKHAIDDENPSNEITDGEESRKIQKT 998
                        KH++D  +  ++I +G   +++ + 
Sbjct: 925 DLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVHRA 962

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  537 bits (1383), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 284/617 (46%), Positives = 424/617 (68%), Gaps = 2/617 (0%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 433
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ADK+ HIPFRESKL
Sbjct: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356

Query: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 493
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416

Query: 494 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLL 553
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++SL  +N+LL
Sbjct: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476

Query: 554 LKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTE-LEISGFNNKLQKLTEIMQLA 612
           LKDK  S +  + Q   +  +  T++ ++  L+ QHK E + +    +  +K  + M+  
Sbjct: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535

Query: 613 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVL 672
           +++Y  +E  +    ++  + E+  LK  L   L+G+ + N+  +TN++ N+ +IK++V+
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVI 595

Query: 673 TLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEE 732
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655

Query: 733 NNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQ 792
            + L +Y  N FFK+NH  ++N H+++T   IEK  S+  + F+  +    E+N+KLI++
Sbjct: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715

Query: 793 NLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSS 852
           NL   +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + +S 
Sbjct: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775

Query: 853 NSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHIT 912
             + K ++ +K  V+   +   LL  ++   D + Q+++K   L D+++ S+ ST + + 
Sbjct: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835

Query: 913 NIDDIYDTIENIMKNYG 929
             D+I  +I+    NY 
Sbjct: 836 VFDEICKSIQFAFANYS 852

 Score =  281 bits (720), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 158/186 (84%), Gaps = 11/186 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGD--TGITAQMNAKRYT 90
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMK 210
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL  +SNN+         +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLI-DSNNTK--------LK 183

Query: 211 KLRIFD 216
           KLRIFD
Sbjct: 184 KLRIFD 189

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  535 bits (1379), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 310/642 (48%), Positives = 425/642 (66%), Gaps = 22/642 (3%)

Query: 304 SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 363
           S  AP D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 324 SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382

Query: 364 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
           LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+LADKS
Sbjct: 383 LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 543
           +FIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 503 SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562

Query: 544 ESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 603
           E L S+N  LLKDK  S +  + Q  Q+E     I +L   LD+ +K E  +     +L+
Sbjct: 563 ERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLK 622

Query: 604 KLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS-------- 655
            +   MQ  +++Y+ R+L++ +  +  +  E K LK  L   LS +  N I         
Sbjct: 623 NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIIS 682

Query: 656 --------QETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 707
                     +N Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 683 NNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740

Query: 708 IDIIRVDFQR--FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 765
           I+I  +DFQ    +N I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE
Sbjct: 741 IEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIE 800

Query: 766 KKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK 825
             ++  + N    +N+    N KL  + L N  + ++ +E +  +P + KW  S ++IN 
Sbjct: 801 SFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINS 860

Query: 826 CDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK-GQVEESENAVSLLKNNKKFND 884
            D +NN F+N+M   + QI N +  S N +N SI+ +K  ++ E+E    +L +N ++ +
Sbjct: 861 TDKINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVN 920

Query: 885 QFKQLVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMK 926
              +L  K+   ++ ++    S+ + I  +D     IE+ +K
Sbjct: 921 NINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESGLK 962

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  453 bits (1166), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 322/917 (35%), Positives = 524/917 (57%), Gaps = 65/917 (7%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNV---PDITGSEEVSIN-TTGDTGITAQMNAKRYTV 91
           NITVAVRCR   + E    S  ++++    D T +E + ++ +TG   I        YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI--------YTL 60

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNG 147
           D V+G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFE-- 205
           E S+  G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL +  NN++ N     
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 206 -GPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPN 264
            G   KKLRI DS  A+N    SA SS S++R++SP + +   P  A++RKR+  +SLP 
Sbjct: 180 TGSTGKKLRIVDS--ASNGL-RSAGSSNSSTRDNSPLTNSKKIP-TAMMRKRMGKRSLP- 234

Query: 265 TIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFH 324
                         NNS SN  + NN +  +   + S  S  + +++ N IYIQNLQE  
Sbjct: 235 -------------PNNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEIT 281

Query: 325 ITNAMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMN 379
           IT   EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++
Sbjct: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341

Query: 380 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQD 439
            V+ AGSE  + + + N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ+
Sbjct: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395

Query: 440 SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMEL 499
           +  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L+K ++ EL
Sbjct: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455

Query: 500 AKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKL 558
            K KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I  L+ K + +  +K 
Sbjct: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515

Query: 559 KSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR 618
             ++  + Q  ++++L+ TI+ L   L+KQ K E E+     KL  +   MQ +++ Y  
Sbjct: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSD 575

Query: 619 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 678
           +E+ L  K +    KE+  LK +L S  + ++        N+  N+D IK E+L +    
Sbjct: 576 KEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQS 635

Query: 679 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 738
           Q K + +  +   ++L+ SPK+F  +   +  +    +  +N  +E LSDISEE NNL  
Sbjct: 636 QSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNN 695

Query: 739 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 798
           Y+ ++F K++H+EL++ +I+ TY +++  + EF ENFK  L+ ++E+N K + +++T+ T
Sbjct: 696 YINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLT 755

Query: 799 SAVINQEMDLFEPKRVKW--------ENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 850
           S ++  E+  F P++ KW        EN  + I K  + N+E    +A  LS+  +T + 
Sbjct: 756 SEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEI---LAKLLSESTSTSEL 812

Query: 851 SSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSH 910
             N+M    S +K  VE  E    +  +N     +F +++NK+  LKD I ++  S+ + 
Sbjct: 813 FINNM----SSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENS 868

Query: 911 ITNIDDIYDTIENIMKN 927
           I + D++ + ++N+ KN
Sbjct: 869 IDSFDNLKEAMQNVFKN 885

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  342 bits (878), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 222/560 (39%), Positives = 297/560 (53%), Gaps = 133/560 (23%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEV----------SINTTGDTGITAQM- 84
           NI V VRCR R +REI  KSSVV++     G++ +          + N  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 85  ----------------NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 128
                           N + YT DKVFG  + Q+ +F+ VA     + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 129 MTSTGKTYTMTGD----------EKLYNGELSDAAGIIPRVLLKLFDTLE---------- 168
            T TGKTYTM+GD          +K+  GE    AGIIPRVL+ LF  L           
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKELSKNDTITNTKV 227

Query: 169 -------------------LQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFM 209
                              L+  +Y VK SF+ELYNE+L DLL N   ++ N+       
Sbjct: 228 NNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNS------- 280

Query: 210 KKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQ 269
                 +    N T+ NS   S +N  N     +ND        + +++  +L       
Sbjct: 281 ------NDKLINQTSGNSTPYSITNGLN-----VND--------KFKIKNNNL------- 314

Query: 270 HQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAM 329
           H     N R  S+ N  ++N N                     + I ++ ++E +I +A 
Sbjct: 315 HDFDGKNVRIMSNQNKSASNCN--------------------GSSITVKGMEEIYIKSAH 354

Query: 330 EGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT--------LYKKHQDELFRISKMNLV 381
           EGL LL  G   R+VASTK+ND SSRSHTIFTI         +  KH     +  K+NLV
Sbjct: 355 EGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPVTGKH---FVKTGKLNLV 411

Query: 382 DLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSL 441
           DLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D+S HIP+RESKLTRLLQDSL
Sbjct: 412 DLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIPYRESKLTRLLQDSL 471

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAK 501
           GG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   + KD  +     E+ +
Sbjct: 472 GGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLSKDTFIHEYINEIDR 531

Query: 502 IKSDLLSTKSKEGIYMSQDH 521
           ++++L   ++KEGIY++QD 
Sbjct: 532 LRNELKLARTKEGIYITQDQ 551

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  256 bits (653), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 184/516 (35%), Positives = 293/516 (56%), Gaps = 56/516 (10%)

Query: 307 APNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT--L 364
           +PN  S  I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT  +
Sbjct: 245 SPNGYS--IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNV 302

Query: 365 YKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
            K H    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D
Sbjct: 303 TKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 362

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 481
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 363 HSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQ 422

Query: 482 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 541
           +   + K+  +     E+ +++ +L ++ SKEGIY++Q+ ++      ES    V+E + 
Sbjct: 423 VNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQQA 478

Query: 542 DIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNK 601
            I++L  +   L +  L+    I+ ++ Q++ L +     +  L++     + I+G ++K
Sbjct: 479 KIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVAN---RKYLEQSKDLTIYINGIHSK 535

Query: 602 LQKLTEIMQLALQDYKRRELDL---NKKFETHISKEIKSLKTTLFSQLSGMEQNN--ISQ 656
                      L+DY+   + +   N K    I+    ++   L +++  +E  N  IS+
Sbjct: 536 -----------LEDYEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISR 584

Query: 657 ETN--------IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKI 708
           E          +Q   D  K  +  + E +QEK   + +   +  L+    F +   E++
Sbjct: 585 EITSLISIRNVLQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFEEV 644

Query: 709 -DIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKK 767
            DII+   +     + E++S++  E  +L          ++   LL     + +  ++K 
Sbjct: 645 TDIIKATCENLVRTMDEHVSNMKLETTDL---------TSSCASLLEKECQALHGKLQK- 694

Query: 768 TSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVIN 803
              +VE+ K  LN  L+E    ++++L    S+++N
Sbjct: 695 ---YVESMKQELNSTLQE----MVRDLDMKASSMLN 723

 Score =  156 bits (394), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 121/208 (58%), Gaps = 21/208 (10%)

Query: 34  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDK 93
           E NI V VRCR RNEREI  KSSVV++     G E   I T   TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGRE--VILTNPGTG-----SNKTYTFDR 104

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 148
           VFG  + Q+ +F++VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 149 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSN---- 201
              LS+ AGIIPRVL++LF  L     DY VK SF+ELYNE+L+DLL ++ + S      
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLEDHNF 224

Query: 202 NGFEGPFMKKLRIFDSNTANNTTSNSAS 229
           NG   P  + +RI+DS   + T+ N  S
Sbjct: 225 NGMAPP--ESIRIYDSLKTDRTSPNGYS 250

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  254 bits (650), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
           Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 130/239 (54%), Gaps = 30/239 (12%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E +  N +  +  +++   K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFE 205
            GE    AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK       +  S++  +
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK-------DLLSDSDDD 218

Query: 206 GPFM----KKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTK 260
            P +    +++RIFD+N  NN +S      +    NS+   LN L  + +L RK   TK
Sbjct: 219 DPVVNDTKRQIRIFDNN--NNNSSIMVKGMQEIFINSAHEGLN-LLMQGSLKRKVAATK 274

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  254 bits (650), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 8/221 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD 
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 455

 Score =  137 bits (345), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 101/268 (37%), Positives = 145/268 (54%), Gaps = 19/268 (7%)

Query: 3   AENQNTIQERSSNNISNNLNAQIG--CH-GVPNEELNITVAVRCRGRNEREIGMKSSVVV 59
           A  + TI    S ++SN ++      C+ G    + NI V VRCR RN+REI  KSSVV+
Sbjct: 16  ANKRRTIAHAPSPSLSNGMHTLTPPTCNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVI 75

Query: 60  NVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKG 119
           +     G E +  N +  +  +++   K Y  D+VFG  + Q+ +F+  A    ++ + G
Sbjct: 76  STLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVFGAESDQETVFNATAKNYIKEMLHG 132

Query: 120 YNCTVLVYGMTSTGKTYTMTGDEKLY-------NGELSDAAGIIPRVLLKLFDTLELQQN 172
           YNCT+  YG T TGKTYTM+GD  +        N  L + AGIIPRVL+ LF  L     
Sbjct: 133 YNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNK 192

Query: 173 DYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSR 232
           +Y VK SF+ELYNE LKDLL ++ ++        P  +++RIFD+N  NN +S      +
Sbjct: 193 EYSVKISFLELYNENLKDLLSDSEDDDP--AVNDP-KRQIRIFDNN--NNNSSIMVKGMQ 247

Query: 233 SNSRNSSPRSLNDLTPKAALLRKRLRTK 260
               NS+   LN L  + +L RK   TK
Sbjct: 248 EIFINSAHEGLN-LLMQGSLKRKVAATK 274

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  254 bits (649), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 134/251 (53%), Gaps = 25/251 (9%)

Query: 26  GCHGVP---------NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTG 76
           G H VP           E NI V VRCR RN REI  KSSVV++     G E +  N + 
Sbjct: 33  GKHPVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSH 92

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
            +  +++   K Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTY
Sbjct: 93  QSYSSSK---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTY 149

Query: 137 TMTGDEKLY-------NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 189
           TM+GD  +        N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 150 TMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLK 209

Query: 190 DLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPK 249
           DLL   S+N  ++       K++RIFD+N  NN +S      +    NS+   LN L  +
Sbjct: 210 DLL---SDNEDDDPTANDSKKQIRIFDNN--NNNSSIMVKGMQEIFINSAHEGLN-LLMQ 263

Query: 250 AALLRKRLRTK 260
            +L RK   TK
Sbjct: 264 GSLKRKVAATK 274

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  254 bits (648), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  144 bits (364), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 130/232 (56%), Gaps = 16/232 (6%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E +  N +  +  +++   K Y  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 107

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208
           L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE LKDLL   S+N  ++      
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLL---SDNEDDDPAVNDS 224

Query: 209 MKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPKAALLRKRLRTK 260
            +++RIFD+N  NN +S      +    NS+   LN L  + +L RK   TK
Sbjct: 225 KRQIRIFDNN--NNNSSIMVKGMQEIFINSAHEGLN-LLMQGSLKRKVAATK 273

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  251 bits (642), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 162/216 (75%), Gaps = 5/216 (2%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD- 370
           S+ I ++ ++E +I +A EGL LL  G   RQVASTK ND SSRSHT+FTIT      D 
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 371 ----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 426
               E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 427 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 487 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
            KD  +     E+ +++ +L +T++K+GIY++Q+ Y
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  155 bits (391), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 117/204 (57%), Gaps = 16/204 (7%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REIG KSSVV++     G + +  N +  +  +     K YT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+++F+ VA     + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 149 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFE 205
              LS+ AGIIPRVL+ LF  L+ +  DY VK SF+ELYNE LKDLL +++    NN   
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNA-- 231

Query: 206 GPFMKKLRIFDSNTANNTTSNSAS 229
               + +RIFD+      T  S S
Sbjct: 232 ----ESIRIFDNIKPEKNTQGSHS 251

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  249 bits (635), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 206/314 (65%), Gaps = 23/314 (7%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT--LYK 366
           N   + I ++ ++E +I +A EGL LL  G   R+VA+T+ ND SSRSHTIFTIT  + K
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 367 KHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
            H    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 543
             + K+  +     E+ K++ +L +  +KEGIY++++ Y+   S+       V+E +  I
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNCIL----VEEQQAKI 484

Query: 544 ESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 603
           ++L  +     +  L+    ++ +++Q++ +K +IN+              I+ +N KL 
Sbjct: 485 DNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIK-SINE-------------RITMYNKKLT 530

Query: 604 KLTEIMQLALQDYK 617
              + ++  ++DY+
Sbjct: 531 DYLDKLRFRVEDYE 544

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 115/200 (57%), Gaps = 19/200 (9%)

Query: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           G   +  NI V VRCR RN REI  KSSVVV+     G E +  N +  TG     N K 
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKT 101

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D+VFG  + Q+ +FD+VA     + ++GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 102 YTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGAS 161

Query: 149 LSDA--------AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSS 200
           L D         AGIIPRVL++LF  L+ +  DY VK SF+ELYNE+L+DLL  +     
Sbjct: 162 LEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLI 221

Query: 201 NNGFEGPFM----KKLRIFD 216
           + G  G  +    + +RI+D
Sbjct: 222 DEGGIGGGVANSPETIRIYD 241

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  244 bits (623), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/214 (56%), Positives = 162/214 (75%), Gaps = 5/214 (2%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 370
           I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT      D    
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 371 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 523
             +     E+ +++ +L +++ KEG+Y+++D ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  156 bits (395), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/202 (44%), Positives = 116/202 (57%), Gaps = 29/202 (14%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR-YTVDKV 94
           N+ V VRCR RNE+EI  KSSVV++     G E +  N  G        ++KR YT D+V
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS-----HSKRTYTFDQV 95

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKL 144
           FG  + Q+ +FDEVA     + ++GYNCTV  YG T TGKTYTM+GD          +K+
Sbjct: 96  FGAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKI 155

Query: 145 YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGF 204
             GE S   GIIPRVL+ LF  L  + N+Y VK SF+ELYNE+LKDLL  +     N   
Sbjct: 156 LLGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEEN--- 209

Query: 205 EGPFMKKLRIFDSNTANNTTSN 226
                  +RIFD+N+  N   N
Sbjct: 210 -------IRIFDNNSGFNCNKN 224

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  241 bits (614), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 159/213 (74%), Gaps = 5/213 (2%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 370
           I ++ ++E +I +A EGL LL +G   R+VA+TK ND SSRSHTIFTI  +    D    
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 371 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINAL + S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
             +     E+ +++ +L +++ +EG+Y++Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 118/208 (56%), Gaps = 24/208 (11%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVVV+     G   +  N +           K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 149 -LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGP 207
            L + AGIIPRVL+ LF  L  +  ++ VK SF+ELYNE LKDLL +N ++  N      
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDN------ 212

Query: 208 FMKKLRIFDSNTAN-NTTSNSASSSRSN 234
               +RIFD+N +N +  SN  S  + N
Sbjct: 213 ----IRIFDNNNSNAHGASNGMSQVKMN 236

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  240 bits (612), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 159/218 (72%), Gaps = 5/218 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ S+ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 369 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
            D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
             + KD  +     E+ +++ +L +++ K+GI ++QD 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  146 bits (369), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 115/203 (56%), Gaps = 29/203 (14%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR R+EREI  KSSVV++     G++ +  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGE------ 148
           G  + Q+ +F++ A     + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208
           L + AGIIPRVL+ LF  L L +NDY VK SF+ELYNE LKDL   N +           
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNERLKDLFAQNESEE--------- 273

Query: 209 MKKLRIFDSNTANNTTSNSASSS 231
            + +RIFD+N       N+ASSS
Sbjct: 274 -ETIRIFDNN-------NNASSS 288

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  238 bits (607), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 161/216 (74%), Gaps = 5/216 (2%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 366
           S+ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 367 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 426
              ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D + HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 427 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 487 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
            KD  +     E+ +++ +L +++ K+GI ++QD +
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQF 454

 Score =  142 bits (359), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 113/195 (57%), Gaps = 22/195 (11%)

Query: 37  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFG 96
           I V VRCR RNEREI  KSSVV++     G+ + +     +  +      + YT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 97  PGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE-------- 148
             + Q+ +F++ A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPF 208
           L + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE LKDLL +  +   N       
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLLASEQSEEEN------- 229

Query: 209 MKKLRIFDSNTANNT 223
              +RIFD+ +A+++
Sbjct: 230 ---IRIFDNVSASSS 241

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  238 bits (607), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 172/240 (71%), Gaps = 11/240 (4%)

Query: 289 NNNIP-GNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVAST 347
           +N+IP GN     S R     N+  + I ++ ++E +I +A EGL LL  G   R+VAST
Sbjct: 232 DNHIPSGNSKIQKSSR-----NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVAST 286

Query: 348 KMNDFSSRSHTIFTITLYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEA 402
           K ND SSRSHTIFTIT      D     +  +I K+NLVDLAGSENI+RSGA N RA+EA
Sbjct: 287 KCNDLSSRSHTIFTITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEA 346

Query: 403 GSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
           G IN+SLLTLGRVINAL D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EE
Sbjct: 347 GLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEE 406

Query: 463 TCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
           T STLEYA++AK+IKN PQ+   + KD+ +     E+ +++ +L +++ K+G+Y++Q+ +
Sbjct: 407 TISTLEYATRAKSIKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  144 bits (362), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 115/213 (53%), Gaps = 28/213 (13%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E V      D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVV----LSDPSSVLSHTKKTYIFDQVF 114

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+++F+  A     + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFE 205
            GE    AGIIPRVL+ LF  L  +  +Y VK SF+ELYNE LKDLL  +     +    
Sbjct: 175 LGE---HAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETEES---- 227

Query: 206 GPFMKKLRIFDSNTANNTTSNSASSSRSNSRNS 238
                 +RIFD++  +   S    SSR+N+ +S
Sbjct: 228 ------IRIFDNHIPSG-NSKIQKSSRNNTYSS 253

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  184 bits (468), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 133/198 (67%), Gaps = 31/198 (15%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 370
            I ++ +QE  I NAMEGLNLL +G   R+V STK+ND SSRSHTIFTIT      D   
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 371 --ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--- 425
             E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL+DK+ +   
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 426 ---------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 464
                                IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 465 STLEYASKAKNIKNKPQL 482
           STLEYA++A +IKN P++
Sbjct: 385 STLEYATRAMSIKNNPKI 402

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-- 373
           +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L   
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 374 --RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 69/128 (53%), Gaps = 15/128 (11%)

Query: 101 QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVL 160
           Q  +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 161 LKLFDTLELQQN-------DYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLR 213
            +LF+  E+ ++        + ++CS++E+YNE ++DLL  N         +  F++ L+
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLGANKCRIRERADKTTFVEGLQ 174

Query: 214 IFDSNTAN 221
            F+ N+ +
Sbjct: 175 EFEVNSVD 182

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  139 bits (351), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 116/175 (66%), Gaps = 8/175 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 375
           +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 376 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 484
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 93/198 (46%), Gaps = 29/198 (14%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREV--DESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 96  GPG----ASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
                  A Q  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 152 AAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLLDNNSNNSSNNGF 204
           + GI+ R+  +LF+  E+ ++        + ++CS++E+YNE ++DLL            
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 205 EGPFMKKLRIFDSNTANN 222
           +  F++ LR FD ++  +
Sbjct: 166 KTTFVEGLREFDVSSVED 183

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  140 bits (354), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 119/186 (63%), Gaps = 9/186 (4%)

Query: 302 QRSSMAPND-QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           +R S++ +D + +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I 
Sbjct: 183 KRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIV 242

Query: 361 TITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419
            I L K++  +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL
Sbjct: 243 RINLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINAL 302

Query: 420 AD-------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472
                     S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+
Sbjct: 303 TQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSR 362

Query: 473 AKNIKN 478
           AK IKN
Sbjct: 363 AKKIKN 368

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 69/115 (60%), Gaps = 11/115 (9%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           + Q N + +T D+VF  G++Q+ +++ VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
            +        +  G+IPR+   +F  +E    +   + V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 375
           ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT+++ ++  D   R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 376 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALADKSGH-IPFRESK 432
           S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ LA  S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 433 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 17/178 (9%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDY-VVKCSFIELYNEELKDLLDNNSNNS 199
                    +   GIIP +   LFD LEL +     V  ++ E+YNE+L DLL + S   
Sbjct: 89  T--------NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDTSPRV 140

Query: 200 SNNGFEGPFMKKLRIFDSNTANNT--------TSNSASSSRSNSRNSSPRSLNDLTPK 249
                +  F++ +  F  N             +  S +S+R N  +S   ++  L+ K
Sbjct: 141 RETNDKKTFVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIK 198

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 371
           +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
             R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ LA K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARV 368

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 84/183 (45%), Gaps = 22/183 (12%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R    RE G      V  P     ++  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 96  ----GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 148
                    Q++I+D +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 149 LS-------DAAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLLDN 194
            +        A GIIPRV   LFD   +  ++       + + CS++E+YNE+++DLL  
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 195 NSN 197
           + +
Sbjct: 183 DGS 185

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 187/348 (53%), Gaps = 37/348 (10%)

Query: 299 NNSQRSSMAPNDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 357
           N+ +R+S+  ++ +  G+Y++      +++  E LN +  G   R   ST MN  SSRSH
Sbjct: 172 NSDKRASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSH 231

Query: 358 TIFTITLYKKHQDEL-FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 416
            I  I L K+   E   + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VI
Sbjct: 232 AIVKINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVI 291

Query: 417 NALA--DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
           NAL   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK
Sbjct: 292 NALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAK 351

Query: 475 NIKNKPQLGAFIMK-DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK 533
           +IKNK    A + K D+ +K       K++  +   + KE  Y ++         +E  +
Sbjct: 352 HIKNK----AIVNKSDLFLKK------KLERKIAQLEKKEQDYKTR---------IELLE 392

Query: 534 NEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTEL 593
           +EV+E    +++ +S   L  +  L +++T     +Q++SLK+ +N     LD    TE 
Sbjct: 393 HEVKE----LQATASHRPLPEEVDLLAENT--KLRAQVDSLKVLLNPRTDSLD----TEQ 442

Query: 594 EISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 641
            IS  ++ L KL E  +L ++   R  LD     E  + K +  LK T
Sbjct: 443 HIS-VDDLLTKLMEKCELVVELQSR--LDDQADKEKALKKLMTDLKHT 487

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 17/160 (10%)

Query: 64  ITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 123
           +  ++E ++   G     A   A+ +  D VFG  A Q+ +FD VA  +   F  GYN T
Sbjct: 40  VVAADEGTVEFAG-----AADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNST 94

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +L YG T +GK+YTM G             G+IPR+  ++F+ + L +N    +YVV  S
Sbjct: 95  ILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVS 146

Query: 180 FIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNT 219
           F+E+Y E++ DLL  + N +S+          L + +SNT
Sbjct: 147 FLEIYLEKVYDLLGESINKASSPKKNSDKRASLTVHESNT 186

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 172/318 (54%), Gaps = 19/318 (5%)

Query: 302 QRSSMAPNDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           +R+S+  ++ S  G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I 
Sbjct: 202 KRTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIV 261

Query: 361 TITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419
            I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL
Sbjct: 262 KINLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINAL 321

Query: 420 ADKS---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
             K     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I
Sbjct: 322 TQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQI 381

Query: 477 KNKPQL--GAFIMKDILVKNITMELAKIKSDL---LSTKSKEGIYMSQDHYKNLNSDLES 531
           +NK  +      +K  L + I + L K + +    ++    E + +  ++ +  + D E 
Sbjct: 382 ENKAIVNRSDLFLKKKLERQIAL-LEKREQEYQNRITLLEHEVLALRANNIRAPSPDTED 440

Query: 532 YKNEVQECKRDIES----LSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDK 587
            + E  + K  ++S    LSS  SL  +  + + D +   +  ME  +L ++ L+A+LD 
Sbjct: 441 IETENTKLKAQMDSLKSILSSGGSLEGEQHISTDDLL---SKLMEKCELVVD-LQARLDD 496

Query: 588 QHKTELEISGFNNKLQKL 605
           Q   E  +    + L+ L
Sbjct: 497 QLDKETALKRMMDDLRLL 514

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 12/127 (9%)

Query: 79  GITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 138
           G+  +  ++ +  D VFG  ++QD ++D VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 139 TGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLLDN 194
            G          D  G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E++ DLL  
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGE 188

Query: 195 NSNNSSN 201
           + N S++
Sbjct: 189 SINKSAS 195

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  121 bits (304), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 7/172 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK----KHQDE 371
           YI+ L +  + +  E L  ++ G   R VA T +N+ SSRSH I TI + +       D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA-DKSGHIPFRE 430
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 431 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 80/171 (46%), Gaps = 23/171 (13%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VA+R R +  RE    S     V     S E+++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGI 155
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 156 IPRVLLKLFDTLELQQND---------YVVKCSFIELYNEELKDLLDNNSN 197
           IP V  +LF  +++ Q++         + V  S+ ++YNE++ D+L    N
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGGCN 160

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 111/178 (62%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK--K 367
           DQ++ I + NL      N  + ++L+ RG  +R  + T+ N+ SSRSH++  I + +  K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 368 HQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--D 421
           + D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 13/110 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ++Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND-----YVVKCSFIELYNEELKDLL 192
             S+  GII R + +LF  +E+   D       +  S++E+YNE ++DLL
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  122 bits (305), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 104/180 (57%), Gaps = 10/180 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL +   T   E ++L+ RG  +R  + T+ N+ SSRSH +  I + +K++
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 420
                E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 421 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 207

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  GI+ + + +LF  +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 208 -TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D   GI + NL         + ++L+ RG  +R  + T  N+ SSRSH +  I + +K++
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT----- 188

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
               +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 189 ---PEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 71  SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 126
           SIN+ G     +Q        ++  DK+F   +SQ  ++ E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 127 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIEL 183
           YG T  GKTYT++G             G+I   + +LF   D L+ ++N + +  S++E+
Sbjct: 191 YGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKN-FEISLSYLEI 241

Query: 184 YNEELKDLL 192
           YNE ++DLL
Sbjct: 242 YNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + ++ +  S++E+YNE + DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 105/181 (58%), Gaps = 13/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + +  +
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 370 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                 D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL    
Sbjct: 300 TAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 424 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
           G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 479 K 479
           K
Sbjct: 418 K 418

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------ 181

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 182 --PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 107/194 (55%), Gaps = 15/194 (7%)

Query: 298 TNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 357
           T +S    +  +DQS   Y+ N++ F I N  + + L+ +    R  +ST +N  SSRSH
Sbjct: 545 TKDSISHEIRHDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSH 604

Query: 358 TIFTITL--YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
            IF I L  Y    +E   ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG V
Sbjct: 605 GIFIIYLEGYNHKTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDV 663

Query: 416 INAL------------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 463
           I+AL              K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET
Sbjct: 664 IHALNRGNKNHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNET 723

Query: 464 CSTLEYASKAKNIK 477
            ++L +A+K  N K
Sbjct: 724 INSLRFATKVNNTK 737

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (53%), Gaps = 14/110 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF        +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIEQ-LIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLLDNN 195
           L+   G+IP  +  +F++++ L++N  +Y V C FIELYNE + DL  +N
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDN 542

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 115/203 (56%), Gaps = 14/203 (6%)

Query: 289 NNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTK 348
           N  I   ++ N S +  +   D  N  ++ NL +    N  E ++L+ +G  +R  + T 
Sbjct: 214 NEQIHDLLDPNISSKKLVIREDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTD 273

Query: 349 MNDFSSRSHTIFTITLYKKH------QDELFRISKMNLVDLAGSENINRSGALNQRAKEA 402
            N+ SSRSH +  I + + +      QD+ F  + ++++DLAGSE    +    +R  E 
Sbjct: 274 ANETSSRSHAVLQIHVAQMNRTADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEG 331

Query: 403 GSINQSLLTLGRVINALADKS------GHIPFRESKLTRLLQDSLGGNTKTALIATISPA 456
            +IN+SLL LG  INAL   S       H+P+R+SKLTRLL+ SLGGN KT +I  +SP+
Sbjct: 332 ANINRSLLALGNCINALCVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPS 391

Query: 457 KVTSEETCSTLEYASKAKNIKNK 479
               +ET +TL+YA++AK IK K
Sbjct: 392 SGHYDETLNTLKYANRAKEIKTK 414

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 12/116 (10%)

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           +   +++  D++F    +Q  +++    PL    + G+N TV  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 143 KLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLLDNN 195
                  S+  GII   + +LF  +E Q  D   + ++ SF+E+YNE++ DLLD N
Sbjct: 177 -------SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQIHDLLDPN 224

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 109/179 (60%), Gaps = 9/179 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D    I + NL    ++   + ++L+ +G  +R  ++T  N+ SSRSH +  + + ++++
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 370 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---ADK 422
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL     K
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 423 SG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D+VF   +SQ  +++    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT----- 177

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 193
               +  GII   + +LF  +E  Q+   + +  S++E+YNE ++DLL+
Sbjct: 178 ---PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  117 bits (292), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 108/186 (58%), Gaps = 11/186 (5%)

Query: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           SQR         +  +++ L+E  + N  E ++ + +G ++R V ST MN  SSRSH IF
Sbjct: 164 SQRKCKIRERHDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIF 223

Query: 361 TITL-----YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
            I++     +KK    +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRV
Sbjct: 224 HISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRV 283

Query: 416 INALAD----KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
           I+ LA+    +S  IP+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS
Sbjct: 284 ISLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYAS 341

Query: 472 KAKNIK 477
             K +K
Sbjct: 342 LTKKVK 347

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 21/120 (17%)

Query: 86  AKRYTVDKVFGPGAS----QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           AK +  D  FG   S    Q +I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQ---------NDYVVKCSFIELYNEELKDLL 192
           +           GI+PR   +LF+   +            D+ VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 107/180 (59%), Gaps = 10/180 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +N I + NL   +     E ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 370 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 420
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 421 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            ++S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ASQ+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------ 203

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
              +  GII RV+ +LF+ +E  ++   + +  S++E+YNE ++DLL
Sbjct: 204 --PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 105/193 (54%), Gaps = 9/193 (4%)

Query: 296 INTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSR 355
           +N N S +  +   D    I + NL         E ++ + RG  +R  + T  N+ SSR
Sbjct: 225 LNPNVSSKKLVIREDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSR 284

Query: 356 SHTIFTITLYKKHQDELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLT 411
           SH +  I + +  +          + ++++DLAGSE    +    +R  E  +IN+SLL 
Sbjct: 285 SHAVLQIHIAQTDRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLA 344

Query: 412 LGRVINALADKSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 466
           LG  INAL    G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +T
Sbjct: 345 LGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNT 404

Query: 467 LEYASKAKNIKNK 479
           L YA++AK+IK K
Sbjct: 405 LTYANRAKDIKTK 417

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 59/110 (53%), Gaps = 10/110 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGT------ 180

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLDNN 195
              +  GII   + +LF  +E  ++  +  +  S++E+YNE ++DLL+ N
Sbjct: 181 --PEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNPN 228

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ +     + ++ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + D+ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 103/183 (56%), Gaps = 17/183 (9%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL----- 364
           D +  I + NL      +  + L+L+ RG  +R  + T+ N  SSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 365 ---YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
               K+HQ        ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 422 KSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
             G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 477 KNK 479
           K K
Sbjct: 430 KTK 432

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLDNNS 196
                     +  GII R + +LF  ++      D+ +  SF+E+YNE + DLL  ++
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLLSPDT 244

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 107/181 (59%), Gaps = 13/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +  I + NL  ++     + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 370 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--- 420
                 D  F  + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 299 TADLKSDHTF--ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 421 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
              +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 479 K 479
           K
Sbjct: 417 K 417

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  D++F   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------ 180

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  GII + + +LF+ +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 181 --PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 112/188 (59%), Gaps = 23/188 (12%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 370 --------DELFRISKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTLGRVINA 418
                   ++LF  S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  INA
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 419 LADKSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
           L   +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 472 KAKNIKNK 479
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  DK+    ++Q  +F     PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------ 162

Query: 148 ELSDAAGIIPRVLLKLFDTLE-LQQNDYV-VKCSFIELYNEELKDLLD 193
              +  GII   L  LF+ +E L+    + +  S++E+YNE +KDLLD
Sbjct: 163 --PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D    I + NL    +    + ++L+ +G  +R  ++T  N+ SSRSH +  + + +K++
Sbjct: 236 DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 370 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--ADKS 423
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    K 
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 424 G---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           G   H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK K
Sbjct: 356 GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 17/131 (12%)

Query: 71  SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVL 125
           SI T   +     MN++R     +  D+VF   ASQ+ +++    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 126 VYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIE 182
            YG T  GKTYT++G         ++  GII   + +LF  +E Q  D   + +  S++E
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLE 212

Query: 183 LYNEELKDLLD 193
           +YNE ++DLL+
Sbjct: 213 IYNESIRDLLE 223

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 4/148 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N S
Sbjct: 540 VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT +
Sbjct: 600 MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIK 477
              ISPA +   ET ++L +ASK  N K
Sbjct: 660 FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (49%), Gaps = 17/133 (12%)

Query: 76  GDTGITAQMNAKR---YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           GD G+T      +   +  DK+F    + D IF EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELK 189
           GKTYTM          L+   GI+P  +  +F   D L  +   Y V C FIE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 190 DLLDNNSNNSSNN 202
           DLL + + +  NN
Sbjct: 490 DLLRSGAPSQENN 502

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 108/185 (58%), Gaps = 17/185 (9%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 368
           D+ + I + NL   +  +  + ++L+ RG  +R  +ST+ N+ SSRSH +  I + + + 
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 369 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                 +  F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 424 G---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
                     HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 475 NIKNK 479
            IK K
Sbjct: 480 EIKTK 484

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 10/113 (8%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
           +        +  GII RV+ +LF+ +E  +++  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  115 bits (289), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 101/152 (66%), Gaps = 4/152 (2%)

Query: 326 TNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 384
           +N  E   L+QR  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 385 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSL 441
           GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKA 473
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 14/109 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 149 LSDAAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNEELKDLLDN 194
           L++  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLL++
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLND 505

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 114/202 (56%), Gaps = 13/202 (6%)

Query: 289 NNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTK 348
           N +I   +N +   +  +   D  + I + NL         + ++L+ +G  +R  ++T 
Sbjct: 236 NESIRDLLNPDTPSKKLVIREDNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATD 295

Query: 349 MNDFSSRSHTIFTITLYKKHQ------DELFRISKMNLVDLAGSENINRSGALNQRAKEA 402
            N+ SSRSH +  I + + ++        +F  + ++++DLAGSE    +    +R  E 
Sbjct: 296 ANETSSRSHAVLQIHISQTNRTVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEG 353

Query: 403 GSINQSLLTLGRVINALA-----DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 457
            +IN+SLL LG  INAL       +S H+P+R+SKLTRLL+ SLGGN KT +I  +SP+ 
Sbjct: 354 ANINKSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSS 413

Query: 458 VTSEETCSTLEYASKAKNIKNK 479
              +ET +TL+YA++AK IK K
Sbjct: 414 THYDETLNTLKYANRAKEIKTK 435

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 10/111 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------ 198

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLDNNS 196
              +  GII   + +LF  +E      ++ +  S++E+YNE ++DLL+ ++
Sbjct: 199 --PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPDT 247

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (56%), Gaps = 8/183 (4%)

Query: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           SQ+  +  +D+S    I N+    +        +L R  K R  ASTK N+ SSRSH+IF
Sbjct: 522 SQKHDIRHDDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIF 581

Query: 361 TITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 417
            I L+ K+    ++ + I  +NLVDLAGSE IN S    +R +E   IN+SL  LG VI+
Sbjct: 582 IIHLHGKNSKTNEDSYGI--LNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIH 639

Query: 418 AL---ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
           AL     K  HIPFR SKLT LL+ SL GN+KT +   IS +     ET ++L +ASK  
Sbjct: 640 ALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVN 699

Query: 475 NIK 477
           + K
Sbjct: 700 STK 702

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 61/116 (52%), Gaps = 14/116 (12%)

Query: 80  ITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMT 139
           IT   N  +Y  DK+F    S   IF EV G L Q  + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 140 GDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
                    L+ + GIIP  +  +F   D L+ +  +Y + C F+E+YNE + DLL
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 104/187 (55%), Gaps = 28/187 (14%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 370
            +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ +   D   
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 371 --ELFRISKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGRVINALADK-- 422
              +   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ +L  +  
Sbjct: 248 NSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREE 304

Query: 423 ---------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 470
                    S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL YA
Sbjct: 305 LKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRYA 362

Query: 471 SKAKNIK 477
             A+ IK
Sbjct: 363 DIAQTIK 369

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 77/173 (44%), Gaps = 20/173 (11%)

Query: 37  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFG 96
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 97  PGA----SQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
            G     SQ   +        +D + GYNC +L YG T +GKTYTM G+ K      +D 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 153 AGIIPRVLLKLFDTLE----------LQQNDYVVKCSFIELYNEELKDLLDNN 195
            G+IPR    LF  +E           Q+++Y V CS  E+YNE++ DLL+ N
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMN 171

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (62%), Gaps = 8/151 (5%)

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK---MNLVDLAGSENI 389
           N+L++  K R  A+T  N+ SSRSH++F I  Y K ++E+   S    +NLVDLAGSE +
Sbjct: 570 NVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERL 627

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALA---DKSGHIPFRESKLTRLLQDSLGGNTK 446
           N S A+  R +E  +IN+SL  LG VI+AL    +   HIPFR SKLT LLQ SL G++K
Sbjct: 628 NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSK 687

Query: 447 TALIATISPAKVTSEETCSTLEYASKAKNIK 477
           T +   ISP K    ET ++L +ASK  + K
Sbjct: 688 TLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 64/118 (54%), Gaps = 14/118 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D++F    S   +F E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQNDYV--VKCSFIELYNEELKDLLDNNSNNSSNNG 203
           L+D  G+IP  +  +FD  E +++  ++  + C FIE+YNE + DLL +NS + +  G
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGNEAG 536

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSLGGNTKTALI 450
               +R +E  +IN+SL  LG VI AL DK+   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 451 ATISPAKVTSEETCSTLEYASKA 473
             ISP+     ET ++L +ASK 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 63/114 (55%), Gaps = 14/114 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F  G S D +F EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLLDNNSNNS 199
           L    G+IP  +  +FD +E L++   +Y + C F+E+YNE + DLL +N N +
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLLRSNENGT 574

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 112/197 (56%), Gaps = 8/197 (4%)

Query: 287 STNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVAS 346
           S++N+   NI++N   +  +  + ++    I N+   ++ +     N+L+R  K R  AS
Sbjct: 501 SSSNDDTRNIDSNIPTKHEIRHDQENRNTTITNIVTRNLDSEETADNILKRANKLRSTAS 560

Query: 347 TKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAG 403
           T  N+ SSRSH+IF I L   +    +E + I  +NLVDLAGSE IN S     R +E  
Sbjct: 561 TGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQ 618

Query: 404 SINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
           +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT +   ISP+    
Sbjct: 619 NINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHI 678

Query: 461 EETCSTLEYASKAKNIK 477
            ET ++L +ASK  + K
Sbjct: 679 NETINSLRFASKVNSTK 695

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 14/120 (11%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
            +R+  DK+F    +   +F EV G L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 401 PQRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM------- 452

Query: 146 NGELSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNN 202
              L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL ++SN+ + N
Sbjct: 453 ---LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSNDDTRN 509

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 323 FHITNAMEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK------HQDELFRI 375
           +H    +E  ++L+ RG  +R  + T  N+ SSRSH +  + + +        +D+++  
Sbjct: 251 YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMY-- 308

Query: 376 SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----DKSGHIPFRES 431
           + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL         H+P+R+S
Sbjct: 309 ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDS 368

Query: 432 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           KLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 369 KLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 10/112 (8%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   ASQ  +F     PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGT----- 180

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLDNNS 196
               D+ GII   + +LF  +   ++   + +  S++E+YNE ++DLL+ ++
Sbjct: 181 ---PDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLEPDT 229

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 105/183 (57%), Gaps = 6/183 (3%)

Query: 300 NSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 359
           +SQ+  +  + +  G YI N+    +T+  +   +L++  K R  A+T+ N+ SSRSH++
Sbjct: 524 DSQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSV 583

Query: 360 FTITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 417
           F + +  +  H  E  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI 
Sbjct: 584 FMVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIY 642

Query: 418 ALADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
           AL        +IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  
Sbjct: 643 ALNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVN 702

Query: 475 NIK 477
           + K
Sbjct: 703 STK 705

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 81/167 (48%), Gaps = 24/167 (14%)

Query: 33  EELNITVAVRCRGR----NEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN   + G     N   
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINR--NEGRILSYN--- 414

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D +F P  +   IF+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
           L+   G+IP  L  +F     L+ +  +Y ++C +IE+YNE + DLL
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 103/183 (56%), Gaps = 18/183 (9%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L+E    ++ E +  ++RG  HR+ A T  N  SSRSH I  I L   +
Sbjct: 273 DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTN 332

Query: 369 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 333 VIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 424 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 473
                     GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+A
Sbjct: 390 HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 474 KNI 476
           KN+
Sbjct: 450 KNV 452

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 55/108 (50%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D V+ P  S   I++ +  P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNS 196
                  +  +  K+ +   + +  + V  S++E+YNE + DLLD+ S
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDSES 242

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 105/180 (58%), Gaps = 12/180 (6%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK-- 367
           D  N   + NL      +  + ++L+ +G  +R  + T  N+ SSRSH +  I + +   
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 368 ----HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                +D+ +  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 301 SVDLKEDKTY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 358

Query: 424 ----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
                H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 359 RRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 80/162 (49%), Gaps = 29/162 (17%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG------ 181

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLDNNSNNSSNNGF 204
               +  GII   + +LF  +E  ++   + +  S++E+YNE ++DLL+ ++ +      
Sbjct: 182 --TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLEPDTPS------ 233

Query: 205 EGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDL 246
                +KL I   +T N TT        +N    +PRS+ D+
Sbjct: 234 -----QKL-IIREDTDNTTTV-------ANLSYHTPRSVQDV 262

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 13/156 (8%)

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 389
           N+L+R  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602 NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALAD--------KSGHIPFRESKLTRLLQDSL 441
           N S    +R +E  +IN+SL  LG VI+AL          K  HIPFR SKLT LLQ SL
Sbjct: 660 NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
            GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720 IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 60/114 (52%), Gaps = 14/114 (12%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F    + D +F EV G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 452 KFKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 501

Query: 148 ELSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLLDNNSNN 198
            L    GIIP  +  +F+    L+ +   Y ++C F+E+YNE + DLL N  +N
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDN 554

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 185/385 (48%), Gaps = 56/385 (14%)

Query: 290 NNIPGNINTNNSQRSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQ 343
           N+ P  +  + + RSS  P      +D   G+ I  L E    ++ E    +Q G K+R+
Sbjct: 220 NSTPSRMFLSGTPRSSGGPVELRIRDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRK 279

Query: 344 VASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEA 402
            + T  N  SSRSH I  + L          +S  ++L DLAGSE   ++ +  +R KE 
Sbjct: 280 TSETIYNTRSSRSHAIVLVRLNNTDLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEG 336

Query: 403 GSINQSLLTLGRVINAL------------------ADKSGHIPFRESKLTRLLQDSLGGN 444
             IN+SLL LG VI+ L                   + + HIP+R+SKLTR+LQ +L GN
Sbjct: 337 AFINKSLLALGTVISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGN 396

Query: 445 TKTALIATISPAKVTSEETCSTLEYASKAKN----IKNKPQL--GAFIMKDILVKNITME 498
           +    I TI      + ET +T+ +AS+AKN    +  +P +  G++  KD  ++N+T +
Sbjct: 397 SIITTICTIDTRNEAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQ 456

Query: 499 LAKIKSDLLSTKSKEGIYMSQ---DHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLK 555
           L K    ++  K +  +  S    D   + NS L   +N V +CK           L   
Sbjct: 457 LEKQHQLVMRLKQRTSMTSSSHNDDSTVDPNSTLLKAENRVLKCK-----------LSNC 505

Query: 556 DKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI---MQLA 612
           +KL  KDTI+ ++S+M ++   I+ L   +D     E +  G  ++L++  E    ++  
Sbjct: 506 EKLLDKDTIELEDSEMVAI---IDMLP--IDVGSVLETKFQGLESQLRQYKEYTKQLEFK 560

Query: 613 LQDYKRRELDLNKKFETHISKEIKS 637
           L ++ RRE    + F  H++  I+S
Sbjct: 561 LMNFDRRENVSAEPFTAHVNSVIQS 585

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 68/122 (55%), Gaps = 14/122 (11%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A  +T D+VF    +   I++  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQ-----NDYVVKCSFIELYNEELKDLLDNNSNNSS 200
                D AG+IP  +  LF  + L+      + Y V  S++E+YNE++ DLLD  S N  
Sbjct: 166 -----DEAGLIPLSVTYLFSKI-LEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKF 219

Query: 201 NN 202
           N+
Sbjct: 220 NS 221

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 155/306 (50%), Gaps = 43/306 (14%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++   
Sbjct: 230 DDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--C 287

Query: 369 QDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-- 423
            DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S  
Sbjct: 288 TDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSG 344

Query: 424 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 477
                GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI  
Sbjct: 345 LSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISL 404

Query: 478 -----------NKPQLGAFIMKDILVKNITME---------LAKIKSDLLSTKSKEGIYM 517
                      +K QL   + K +  + IT++          + I SD    +  E + M
Sbjct: 405 AVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKM 464

Query: 518 SQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLT 577
             +HY+ L + LE    +  E    I+ L     ++L+ KL + D      SQ++  K  
Sbjct: 465 KVEHYERLET-LEPSILKDTELVEIIDMLPQDIGVMLETKLVNMD------SQLQESKRY 517

Query: 578 INQLKA 583
           I+QL++
Sbjct: 518 ISQLES 523

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 10/106 (9%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF P  + D +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 149 LSDAAGIIPRVLLKLFDTL--ELQQNDYVVKCSFIELYNEELKDLL 192
                GIIP  +  +FD +   L +  + V+ S++E+YNE + DLL
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLL 203

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 390
           L+++  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 391 RSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKT 447
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597 SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 448 ALIATISPAKVTSEETCSTLEYASKAKNIK 477
            +   ISP +   +ET ++L +ASK    K
Sbjct: 657 LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 14/109 (12%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F        +FDE+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
             L+   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE + DLL
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 6/145 (4%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELFRISKMNLVDLAGSENINR 391
           LL+R  K R  A+T  N+ SSRSH++F I L  Y  +  E  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 392 SGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTA 448
           S     R +E  +IN+SL  LG VI+ALA       HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 449 LIATISPAKVTSEETCSTLEYASKA 473
           +   ISP      ET ++L +ASK 
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKV 697

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 71/147 (48%), Gaps = 22/147 (14%)

Query: 66  GSE--EVSINTTGDTGITAQMNAKR------YTVDKVFGPGASQDLIFDEVAGPLFQDFI 117
           GSE   V IN   D   T  MN  R      +  DK+F P  S D IF+E+   L Q  +
Sbjct: 382 GSESCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSL 440

Query: 118 KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DY 174
            GYN  +  YG T +GKTYTM          L    G+IP  L  +F  + L +    +Y
Sbjct: 441 DGYNVCIFAYGQTGSGKTYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEY 490

Query: 175 VVKCSFIELYNEELKDLLDNNSNNSSN 201
            +   FIE+YNE + DLL   +N++ +
Sbjct: 491 EISSQFIEIYNETIIDLLRGLNNDTED 517

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/185 (42%), Positives = 108/185 (58%), Gaps = 4/185 (2%)

Query: 297 NTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           +TN++ +  +  N ++    I N+    +T+      LL+R  K R  AST  N+ SSRS
Sbjct: 512 DTNSNTKLEIRHNQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRS 571

Query: 357 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
           H+IF + L  ++     R    +NLVDLAGSE IN S  + +R +E  SIN+SL  LG V
Sbjct: 572 HSIFIVHLSGENVLTGERSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDV 631

Query: 416 INAL--ADKSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472
           I+AL  AD S  HIPFR SKLT LLQ SL GN+KT +   IS     + ET ++L +ASK
Sbjct: 632 IHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASK 691

Query: 473 AKNIK 477
             + K
Sbjct: 692 VNSTK 696

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (46%), Gaps = 20/161 (12%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R    RE    + + V    D  G++ + +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    +   +F E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 155 IIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
           IIP  +  +F+    L+ +   Y V C F+E+YNE + DLL
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 101/194 (52%), Gaps = 23/194 (11%)

Query: 303 RSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           RSS  P       D   G+ I  L E    ++ E L  ++ G K R+   T  N  SSRS
Sbjct: 244 RSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRS 303

Query: 357 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
           H I  I L K    E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG V
Sbjct: 304 HAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTV 360

Query: 416 INALADKS-------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
           I+ L+ +S             GHIP+R+SKLTR+LQ +L GN     I TI      S E
Sbjct: 361 ISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSE 420

Query: 463 TCSTLEYASKAKNI 476
           T +TL +AS+AKN+
Sbjct: 421 TLNTLRFASRAKNV 434

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++ + + P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 149 LSDAAGIIPRVLLKLFDTL--ELQQND--YVVKCSFIELYNEELKDLLD 193
             +  G+IP  +  L+  +  E  Q D  + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD 222

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 107/191 (56%), Gaps = 21/191 (10%)

Query: 303 RSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           RSS+A       +D + G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRS
Sbjct: 213 RSSIAVPELKIRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRS 272

Query: 357 HTIFTITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 414
           H I  I L        E+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG 
Sbjct: 273 HAIILIRLISSDLSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGT 328

Query: 415 VINALADK---------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 465
           VI+ L+ +         + HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +
Sbjct: 329 VISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVN 388

Query: 466 TLEYASKAKNI 476
           TL +AS+AKN+
Sbjct: 389 TLRFASRAKNV 399

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 59/111 (53%), Gaps = 12/111 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 149 LSDAAGIIP----RVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNN 195
           +   AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+ +
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETD 206

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 105/182 (57%), Gaps = 6/182 (3%)

Query: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
           SQ+  +  +  ++   I N+ +  +T+  +  ++L+R  + R  A T+ N+ SSRSH++F
Sbjct: 527 SQKHEIRHDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVF 586

Query: 361 TITLYKKHQDELFRIS--KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418
            + +   H D+   +S  K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI A
Sbjct: 587 MVHI-NGHNDQTGEVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYA 645

Query: 419 LADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 475
           L        HIPFR SKLT LLQ SL G++KT +   I   +  + ET ++L +ASK  +
Sbjct: 646 LNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNS 705

Query: 476 IK 477
            K
Sbjct: 706 TK 707

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 15/122 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F P  +   +F E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 417 FHFDKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM---------- 465

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQND--YVVKCSFIELYNEELKDLL-DNNSNNSSNNGF 204
           L+   G+IP  L  +F   E L ++   Y + C +IE+YNE + DLL + NSN++ ++  
Sbjct: 466 LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSNDNIDDIL 525

Query: 205 EG 206
           E 
Sbjct: 526 ES 527

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 392
           +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 84/170 (49%), Gaps = 17/170 (10%)

Query: 33  EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   + +    + ++NV +   +  V          TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVH--EFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLLDNNSNN 198
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL +++NN
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNN 537

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 17/174 (9%)

Query: 33  EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E +    + ++NV +   +    + +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNR--GVQSMEVTKIQNTPQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNN 202
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL N +N    N
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLLRNENNKDDTN 541

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (58%), Gaps = 4/148 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINRS 392
           LL++  + R  AST  N+ SSRSH++F I L    H         +NLVDLAGSE IN S
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSS 625

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             L +R +E  +IN+SL  LG V++AL        HIPFR SKLT LLQ SL GN+KT +
Sbjct: 626 QVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLM 685

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIK 477
              IS  +    ET ++L +ASK  + K
Sbjct: 686 FVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 81/161 (50%), Gaps = 18/161 (11%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    + + +F+E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 155 IIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           IIP  +  +F  +E L++   +Y + C FIE+YNE + DLL
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 85/196 (43%), Gaps = 20/196 (10%)

Query: 741 KNHFFKNNHQELLNHHIDSTYEDIEKKTSEF--------------VENFKNTLNDHLEEN 786
           KN F +  HQ  L         DI K  +E+               EN +N+L D +EE 
Sbjct: 162 KNGFLEQGHQLHLQQLRAKNDADINKMENEYRVQLERLKFAKVKKFENERNSLLDKVEEV 221

Query: 787 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCD-SMNNEFYNNMATTLSQIK 845
           +  I+ N TN  + +   E + +  K   W   +    K +  MN  F N++     QIK
Sbjct: 222 RNNIITNETNLQNMLRECETNHYRAKE-NWLQDYQKNWKENVQMNENFSNDVTVLGQQIK 280

Query: 846 NTVDTSSNSMNKSISVMKGQVEESENAVSLLKNN----KKFNDQFKQLVNKHTILKDNIE 901
             ++   N   + ++ ++G+++  +N++   +++    K+  D+ K    +    +  + 
Sbjct: 281 TVLEPQCNEKMQEVAALRGKLQNLQNSLKQRQDDTQSMKRQIDEIKGKTVQTKRKRQELH 340

Query: 902 NSITSTHSHITNIDDI 917
           + I +T S +  ID+I
Sbjct: 341 DYIHNTKSELQQIDEI 356

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 107/187 (57%), Gaps = 8/187 (4%)

Query: 297 NTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           N++N  R  +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRS
Sbjct: 486 NSSNGPRHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRS 545

Query: 357 HTIFTITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 413
           H+IF I ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG
Sbjct: 546 HSIFIIKIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLG 603

Query: 414 RVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 470
            V+N+L        HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A
Sbjct: 604 NVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFA 663

Query: 471 SKAKNIK 477
            K  + K
Sbjct: 664 KKVNSTK 670

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 68/128 (53%), Gaps = 20/128 (15%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           +Y+ DKVF    +   IF EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL--DNNSNNSSNN 202
            L+   GIIP     +FD ++    +   Y V C F+E+YN+E+ DLL  D+N +NSSN 
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNSSN- 489

Query: 203 GFEGPFMK 210
              GP  K
Sbjct: 490 ---GPRHK 494

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/184 (38%), Positives = 101/184 (54%), Gaps = 4/184 (2%)

Query: 294 GNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFS 353
           G  +TN + +  +  + ++    I N+    + +      +L++  K R  AST  N+ S
Sbjct: 537 GKDDTNTNSKHEIRHDQETKTTMITNVTSCQLESEERVDMILKKANKLRSTASTASNEHS 596

Query: 354 SRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           SRSH+IF I L   +     +    +NLVDLAGSE IN S  +  R +E  +IN+SL  L
Sbjct: 597 SRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCL 656

Query: 413 GRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 469
           G VI+AL        HIPFR SKLT LLQ SL G++KT +   ISP+     ET ++L +
Sbjct: 657 GDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRF 716

Query: 470 ASKA 473
           ASK 
Sbjct: 717 ASKV 720

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 85/173 (49%), Gaps = 27/173 (15%)

Query: 33  EELNITVAVRCRGRNEREI--GMKSSVV-VN-VPDITGSEEVSINTTGDTGITAQMNAKR 88
           +EL   + V CR R   E    + +S++ VN   D  G + + +     T I +      
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEV-----TKIQSTTQVHE 435

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 146
           +  DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLLDNNS 196
                  GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL N+S
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDS 535

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 142/304 (46%), Gaps = 56/304 (18%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   +
Sbjct: 261 DDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHN 320

Query: 369 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 321 VIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 424 --------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 463
                                HIP+R+SKLTRLLQ +L GN+    I TI P   T  ET
Sbjct: 378 KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 464 CSTLEYASKAKNI-------KNKPQLG-AFIMKDILVKNITMELAKIKSDLLSTKSKEGI 515
            +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K  +   K K   
Sbjct: 438 INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLKS-- 495

Query: 516 YMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLK-----DKLKSKDTIQSQNSQ 570
             S D     + D             +I  L ++NS+L K     + + +KD I+ Q+SQ
Sbjct: 496 --SHDTSNKFSLD-----------NPNISLLQTENSILKKKLENYENIMNKDMIELQDSQ 542

Query: 571 MESL 574
           M  +
Sbjct: 543 MSEI 546

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 63/120 (52%), Gaps = 9/120 (7%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   N   Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLDNNSNN 198
           D +       +  GI+P  +  LF+ +   +ND  Y V  S++E+YNE++ DLLD++  N
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 392
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 76/164 (46%), Gaps = 17/164 (10%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSV-VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E    S   ++NV +    +   I +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTAQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 100/196 (51%), Gaps = 31/196 (15%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ E +N + +G K R+ A T  N  SSRSH I  I L    
Sbjct: 275 DDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD 334

Query: 369 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 335 MKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 424 -----------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
                                  GHIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392 SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 461 EETCSTLEYASKAKNI 476
            ET +TL +AS+AKNI
Sbjct: 452 AETLNTLRFASRAKNI 467

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 9/120 (7%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF    S   I+  +  P+     +G+N T+  YGMT +GKTY
Sbjct: 125 DEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTY 184

Query: 137 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLL 192
           TM G       E     G+IP  +  LF  +  +  D    + +  S++E+YNE++ DLL
Sbjct: 185 TMMG-----CPEREQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLL 239

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 106/186 (56%), Gaps = 6/186 (3%)

Query: 297 NTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           +T  S +  +  +++S   +I N+    +T+      +L+R LK R  A+T  N  SSRS
Sbjct: 513 DTGESLKFEIRHDNESRTTHITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRS 572

Query: 357 HTIFTITL--YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 414
           H++F I L  Y     E      +NLVDLAGSE I+      +R +E  +IN+SL  LG 
Sbjct: 573 HSVFIIKLDGYNTISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGD 631

Query: 415 VINAL--ADKSG-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
           VI+AL  AD S  HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+
Sbjct: 632 VIHALGSADASKRHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAA 691

Query: 472 KAKNIK 477
           K  + K
Sbjct: 692 KVNSTK 697

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 84/176 (47%), Gaps = 23/176 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   E    SS  + +   +       + TG   IT + ++K  ++T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHKFT 410

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 151 DAAGIIPRVLLKLFDTLE-LQQNDYV--VKCSFIELYNEELKDLLDNNSNNSSNNG 203
              GIIP  L  +F  +E L++  +V  +   F+E+YNE +KDL   N  +  + G
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDADVDDTG 515

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 124/245 (50%), Gaps = 26/245 (10%)

Query: 240 PRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTN 299
           P +L+ +     LL++R    S      + + +Q  +   + +  PG T   I  +    
Sbjct: 461 PMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLLRSLNPEPGPTKYEIRHD---G 517

Query: 300 NSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 359
           +SQR+S           I N+    +        +L+   K + +A+T  N+ SSRSH++
Sbjct: 518 DSQRTS-----------ITNVTSIKLETRARVNTVLRTANKTKSIAATNSNERSSRSHSV 566

Query: 360 FTITLYK------KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 413
           FTI ++       +  D +     +NLVDLAGSE I+ S     R +E  +IN+SL  LG
Sbjct: 567 FTIRIHGTNSITGEASDGV-----LNLVDLAGSERIDTSNVTGDRLRETQNINKSLSCLG 621

Query: 414 RVINALADKS-GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472
            VI AL  K   HIPFR SKLT LLQ SL G++KT +   +SP+    +ET ++L +ASK
Sbjct: 622 DVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPSSNHVKETLNSLRFASK 681

Query: 473 AKNIK 477
             + K
Sbjct: 682 VNSTK 686

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 78/161 (48%), Gaps = 23/161 (14%)

Query: 36  NITVAVRCRGRNEREIGMKSSV-VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   E E+   S + V N  +  GS+ + I+              R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNS--------RFLFDKV 409

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F   AS   +F+EV G L Q  + GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 155 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
           +IP  L  +FD   L +    DY  +  FIE+YNE++ DLL
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 135/267 (50%), Gaps = 25/267 (9%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL-YKK 367
           +D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L    
Sbjct: 267 DDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTD 326

Query: 368 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 424
            +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 327 LKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNM 383

Query: 425 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 477
                 HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI  
Sbjct: 384 GVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISL 443

Query: 478 --NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK-----NLNSDLE 530
              + ++     KD +++N+  +L +    +   KS  G   + D        +L S+ +
Sbjct: 444 VVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENK 503

Query: 531 SYKNEVQECKRDIESLSSKNSLLLKDK 557
             K  ++ C    E L  K+S++L+D+
Sbjct: 504 VLKLRLEHC----EKLLDKDSMILQDQ 526

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           ++ D VF P      +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
            S+  G+IP  +  +F  +    L    + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 149/312 (47%), Gaps = 50/312 (16%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L    
Sbjct: 272 DDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT- 330

Query: 369 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS- 423
             +L       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  S 
Sbjct: 331 --DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSM 385

Query: 424 --------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 475
                    HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN
Sbjct: 386 HTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKN 445

Query: 476 I-----KNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKS-KEGIYMSQDHYKNLNSDL 529
           +     +N+ +L     KD L+ N+  +L + +  +   K  +E    + D Y  L  + 
Sbjct: 446 VSMTVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKES 502

Query: 530 ESYKNEVQECKR----------------DIESLSSKNSLLLKDKLKSKDTIQSQNSQMES 573
           ++ K ++Q C+R                 +E L      LL+ K      IQ   SQ+ S
Sbjct: 503 DALKRKLQLCERLLDKDEAAVQDDQLVEIVEMLPPAVGALLESK------IQGLQSQLRS 556

Query: 574 LKLTINQLKAQL 585
            +   +QL+ QL
Sbjct: 557 HRDYSSQLERQL 568

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF P ++   ++ ++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 137 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE++ DLL+
Sbjct: 187 TMSGT--------PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 111/220 (50%), Gaps = 32/220 (14%)

Query: 286 GSTNNNIPGNINTNNSQRSS---MAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHR 342
           GS   N P  + T+    SS      +D   G+ +  L +     + E L+ + +G K+R
Sbjct: 237 GSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNR 296

Query: 343 QVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKE 401
           + + T+ N  SSRSH I  I L  K  +     I  ++L DLAGSE   R    N+R KE
Sbjct: 297 KTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDLAGSE---RGVGQNERRKE 353

Query: 402 AGSINQSLLTLGRVIN--------------------ALADKSG-----HIPFRESKLTRL 436
              IN+SLL LG VI+                    +LA  +G     HIP+R+SKLTRL
Sbjct: 354 GAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRL 413

Query: 437 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
           LQ +L G++    + TI  A  +S ET +TL +AS++KN+
Sbjct: 414 LQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNV 453

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 72/143 (50%), Gaps = 23/143 (16%)

Query: 64  ITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 123
           I G + +S N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L  + N       V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 180 FIELYNEELKDLLDNNSNNSSNN 202
           ++E+YNE++ DLLD  S ++  N
Sbjct: 220 YLEIYNEKINDLLDVASGSNVQN 242

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 107/228 (46%), Gaps = 35/228 (15%)

Query: 281 SSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLK 340
           S S PG+ + +  G  N+N         +D   G+ +  L E    +  E L  +  G K
Sbjct: 269 SGSRPGTPSRSYMGKSNSNAMGVELKIRDDSKYGVKVIGLTERRCESTEELLRWIGIGDK 328

Query: 341 HRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRA 399
            R++  T  N  SSRSH I  I L      +   R S ++L DLAGSE   R+    +R 
Sbjct: 329 SRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERR 385

Query: 400 KEAGSINQSLLTLGRVINAL-ADK------------------------------SGHIPF 428
           KE   IN+SLL LG VI+ L ADK                              S HIP+
Sbjct: 386 KEGSFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPY 445

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
           R+SKLTRLLQ +L G++    I T+      + ET +TL +AS+AKN+
Sbjct: 446 RDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++    P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLDNN 195
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL++ 
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESG 265

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 106/200 (53%), Gaps = 23/200 (11%)

Query: 297 NTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           N+ NS +     +D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRS
Sbjct: 231 NSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRS 290

Query: 357 HTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
           H+I  + L     +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG V
Sbjct: 291 HSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTV 347

Query: 416 INALADKS-------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPA 456
           I  L+ +S                    HIP+R+SKLTR+LQ +L GN+    I T+   
Sbjct: 348 IAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIR 407

Query: 457 KVTSEETCSTLEYASKAKNI 476
              S ET +TL +AS+AKN+
Sbjct: 408 SDASSETLNTLRFASRAKNV 427

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 64/118 (54%), Gaps = 12/118 (10%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   + +D++F    S   I+ E+  PL      GYN T+  YGMT +GKT+TM+G 
Sbjct: 102 AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGT 161

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLE----LQQNDYVVKCSFIELYNEELKDLLDNN 195
           +        +  G+IP  +  LF+T+     L +  Y +  S++E+YNE+L DLLD N
Sbjct: 162 Q--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLDTN 211

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 112/223 (50%), Gaps = 41/223 (18%)

Query: 281 SSSNPGST-----NNNIPGNINTNNSQRSSMAP--NDQSNGIYIQNLQEFHITNAMEGLN 333
           S+ +PG T     + N+PG          +  P  +D  +G+ +  L E  + ++ + L 
Sbjct: 242 SAKSPGGTYGSFQSKNVPGA--------GAELPVRDDARHGVRVVGLTEQQVHSSEDVLR 293

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR----ISKMNLVDLAGSENI 389
            ++ G  +R+   T  N  SSRSH I TI   K    EL       S ++L DLAGSE  
Sbjct: 294 KIELGNSNRRTGETDYNTRSSRSHAIVTI---KVTCTELLSGTDTTSTLSLCDLAGSE-- 348

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALADKSG----------------HIPFRESKL 433
            R+   ++R KE   IN+SLL LG VI+ L+  SG                H+P+R+SKL
Sbjct: 349 -RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKL 407

Query: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
           TR+LQ +L G++    I TI        ET +T+ +AS+AKN+
Sbjct: 408 TRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKNV 450

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 12/126 (9%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF P  +   +++E+  P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFE 205
             D AG+I   + ++F  +    +    Y V+ S++E+YNE++ DLL N  +  S  G  
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLL-NYPSAKSPGGTY 250

Query: 206 GPFMKK 211
           G F  K
Sbjct: 251 GSFQSK 256

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 99/200 (49%), Gaps = 35/200 (17%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   +
Sbjct: 297 DDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 422
            ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 VKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 423 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 456
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 457 KVTSEETCSTLEYASKAKNI 476
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLLDNN 195
           L    G+IP  +  LF  +  Q       + V  S++E+YNE + DLL++ 
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESG 265

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 112/211 (53%), Gaps = 27/211 (12%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 366
           +D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L +  
Sbjct: 269 DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 367 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALA--- 420
            K   E    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L+   
Sbjct: 329 LKTGSEA--TSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 421 ---------DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
                      +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 472 KAKNIK---NKPQLGAFIMKDILVKNITMEL 499
           +AKNI     K ++ +   KD +++N+  +L
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF  G     ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLDNNSNNSSNNG 203
                G+IP+ +  +FD +  + +     Y VK S++E+YNE++ DLL+     + + G
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTG 256

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 98/206 (47%), Gaps = 41/206 (19%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 422
            +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 VRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 423 --------------------------------SGHIPFRESKLTRLLQDSLGGNTKTALI 450
                                           S HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414 GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 451 ATISPAKVTSEETCSTLEYASKAKNI 476
            T+      + ET +TL +AS+AKN+
Sbjct: 474 CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 61/111 (54%), Gaps = 12/111 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++++ + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLLDNN 195
           L    G+IP  +  LF  +  Q       + V  S++E+YNE + DLL++ 
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESG 265

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 98/189 (51%), Gaps = 28/189 (14%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 366
           +D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L +  
Sbjct: 270 DDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCE 329

Query: 367 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINAL---- 419
            K   E+   S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 330 LKTGTEV--TSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANS 382

Query: 420 ------------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
                       +   GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+
Sbjct: 383 AGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTV 442

Query: 468 EYASKAKNI 476
            +AS+AKNI
Sbjct: 443 RFASRAKNI 451

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 13/117 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 149 LSDAAGIIPRVLLKLFD-----TLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSS 200
                G+IP  +  +FD     T +  ++ Y VK S++E+YNE++ DLL     N +
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGA 253

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 108/199 (54%), Gaps = 28/199 (14%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK-HQDELF 373
           I I+NL+  ++T+ +E L+  ++G   R +AS       SRS  I  IT+ ++ +  E+F
Sbjct: 189 ISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEVF 238

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD----------KS 423
           +     LVDL  S+ I++   L    +    INQS++TL  V  +LA           +S
Sbjct: 239 KTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPRS 298

Query: 424 G--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 477
           G  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K    
Sbjct: 299 GNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLFQ 358

Query: 478 -NKPQLGAFIMKDILVKNI 495
            NK    +  M D+L+K+ 
Sbjct: 359 QNKAGTNSKAMLDLLMKDF 377

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 11/114 (9%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG- 122

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
              YN       G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 123 ---YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 93/184 (50%), Gaps = 19/184 (10%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   +
Sbjct: 237 DDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTN 296

Query: 369 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +     + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 297 LLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 424 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472
                       HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS+
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 473 AKNI 476
           AKN+
Sbjct: 414 AKNV 417

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 63/117 (53%), Gaps = 6/117 (5%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNN 198
              +N  +    G    V  ++ +  + +Q    V  S++E+YNE++ DLL++N  N
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRN 230

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 14/151 (9%)

Query: 332 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENIN 390
           L L+ +G ++R+V ST+ N  SSRSH +  + +     D +   ++ + L DLAGSE   
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI----TDSMGSKARVLTLCDLAGSER-- 294

Query: 391 RSGALNQRA--KEAGSINQSLLTLG---RVINALADKSGHIPFRESKLTRLLQDSLGGNT 445
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN 
Sbjct: 295 --ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNG 352

Query: 446 KTALIATISPAKVTSEETCSTLEYASKAKNI 476
              ++ T+S +    E++  TL +A +A  +
Sbjct: 353 LVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 52/117 (44%), Gaps = 31/117 (26%)

Query: 104 IFDEVAGPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRV 159
           IF     PL      D I G   T++ YG T +GKTYTM G         + A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 160 LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFD 216
            L + D L     +  +  S++E+YNE L DLL + +             K+LRI D
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDGT-------------KELRILD 211

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 5/144 (3%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFT--ITLYKKHQDELFRISKMNLVDLAGSENINR 391
           L++ G   R   ST MN+ SSRSH++F   IT + +   E     ++NLVDLAGSE + +
Sbjct: 527 LIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQ 585

Query: 392 SGALNQRA--KEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTAL 449
              +  +   KE  SIN+SL  L  VI+++  +  +IPFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP   +  ET ++L  A K 
Sbjct: 646 YVNISPNINSIRETINSLRLARKV 669

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 16/114 (14%)

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           Q++A  +T DK+FG       +FD++   L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 380 QLHA--FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---- 432

Query: 143 KLYNGELSDAAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
                 L++  GII +    ++     L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 ------LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 106/228 (46%), Gaps = 35/228 (15%)

Query: 281 SSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLK 340
           S S P + +    G  N+N         +D   G+ +  L E    ++ E L  +  G K
Sbjct: 269 SLSRPSTPSRLYMGKGNSNGLSAELKIRDDTQYGVKVIGLTERRCESSEELLKWIAIGDK 328

Query: 341 HRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRA 399
            R++  T  N  SSRSH I  I L     +    R S ++L DLAGSE   R+    +R 
Sbjct: 329 SRKIGETDYNARSSRSHAIVLIRLTSTDLESGTSRSSTLSLCDLAGSE---RATGQQERR 385

Query: 400 KEAGSINQSLLTLGRVINAL-ADK------------------------------SGHIPF 428
           KE   IN+SLL LG VI+ L ADK                              + HIP+
Sbjct: 386 KEGSFINKSLLALGTVISKLSADKINPTGSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPY 445

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
           R+SKLTRLLQ +L G++    I T+      + ET +TL +AS+AKN+
Sbjct: 446 RDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETINTLRFASRAKNV 493

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 12/111 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNEELKDLLDNN 195
           L    G+IP  +  LF + +EL  N    + V  S++E+YNE + DLL++ 
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESG 265

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 104/207 (50%), Gaps = 17/207 (8%)

Query: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 371
           NG  ++NL+   +    E   L+   L +++    + N+   RSHTI  +++ K+++ DE
Sbjct: 191 NGFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--DKSGHI--- 426
              +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L   ++ G I   
Sbjct: 248 SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 427 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
                   P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308 ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 479 KPQLGAFIMKDILVKNITMELAKIKSD 505
            P++  F +      +I +   K+K D
Sbjct: 368 NPRINRFGLNSKATMDIFLTDMKLKED 394

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 86/171 (50%), Gaps = 50/171 (29%)

Query: 71  SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFI--------K 118
           SIN T DT +T     Q+   +Y  DKVF   AS D       G   Q+FI        +
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASND------TGVEHQEFIESNLESLLQ 101

Query: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND----- 173
           GYN +++ YG + TGK++ + G+++          G+I ++L KLF+ ++ +  +     
Sbjct: 102 GYNTSIVTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNI 152

Query: 174 -YVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKK-LRIFDSNTANN 222
            Y VK SF+E+Y E++ DL+D+            P +KK L+I DS  A N
Sbjct: 153 HYTVKFSFLEVYQEKMFDLMDS------------PSVKKHLKINDSTYAMN 191

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 82/172 (47%), Gaps = 24/172 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          L+
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 151 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL-DNNSNN 198
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL  D+++ N
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTEN 510

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
           S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 81/172 (47%), Gaps = 24/172 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM   E        
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPED------- 461

Query: 151 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL-DNNSNN 198
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL  D+++ N
Sbjct: 462 ---GIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTEN 510

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
           S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 19/124 (15%)

Query: 73  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           NTTGDT  T Q        DKVF   A+Q  + D +  P   D + GYN T+L YG + +
Sbjct: 67  NTTGDTHSTFQF-------DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEEL 188
           GK+Y++ G +        D  GI+P +   LF TLE ++    N++ V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 189 KDLL 192
            DLL
Sbjct: 172 YDLL 175

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query: 354 SRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           SRSH +F + + ++  + ++ + S + L+DL G+E  ++             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 413 GRVINAL----------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
              + +L          A  S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 463 TCSTLEYASKAKNIKNK 479
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 107/215 (49%), Gaps = 16/215 (7%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DEL 372
           G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + DE 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS--------- 423
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L+  S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 424 ---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 515
           Q+  F + +    +I +E  K+K +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA 153
           +F   ++ DLI + +   +  + ++GYN  ++ YG   +GKTY+      LY  ++ D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 154 GIIPRVLLKLFDTLELQQND------YVVKCSFIELYNEELKDLL 192
           G+   +   LF  +     D      ++VK SF+E++ +++ DLL
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 66/128 (51%), Gaps = 19/128 (14%)

Query: 69  EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 128
           E S  TTGDT  T       +  DKVF   A+Q+ + D +  P   D + GYN T++ YG
Sbjct: 62  EPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYG 114

Query: 129 MTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELY 184
            + +GK+Y++ G +        +  GI+P +   LF+TL    E + N++ V     E++
Sbjct: 115 PSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIF 166

Query: 185 NEELKDLL 192
            E+  DLL
Sbjct: 167 MEKTYDLL 174

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 77/137 (56%), Gaps = 13/137 (9%)

Query: 354 SRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 413 GRVI---------NALADKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
             ++         +A + K+ H   +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 463 TCSTLEYASKAKNIKNK 479
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q  + D +  P  +D + GYN T+L YG + +GK+Y++ G +  YN  
Sbjct: 75  FQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN-- 130

Query: 149 LSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                G++P +   LF+TL    E +  ++ V     E+Y E+  DLL
Sbjct: 131 ----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 354 SRSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 410
           S+SH +F + + ++++ E + + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 411 TLGRVINALADK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
            L  ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 461 EETCSTLEYASKAKNIKNK 479
             T STLE+    + I NK
Sbjct: 351 --TISTLEFGDNIRQIINK 367

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q+ +   +  P+  D + GYN TV+ YG + +GK+Y++ G +      
Sbjct: 75  FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK------ 128

Query: 149 LSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
             ++ GI+P +   LFDTL    E + + + V     E+Y E+  DLL
Sbjct: 129 --ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 354 SRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 410
           SRSH +F + + ++  +D++ + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 411 TLGRVINAL----------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
            L   + +L          A  S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 461 EETCSTLEYASKAKNIKNK 479
             T STLE+    + I NK
Sbjct: 351 --TLSTLEFGDSIRQINNK 367

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 89/176 (50%), Gaps = 20/176 (11%)

Query: 306 MAPNDQSN--GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 363
           + PN + N   + I+NL++ ++ +  E  + L  G  +R      M   +SRS+ +  I 
Sbjct: 226 IRPNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKIN 280

Query: 364 LYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK 422
           L +   +D+L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN LA+ 
Sbjct: 281 LEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE- 339

Query: 423 SGHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
           +G  P+ +           S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 340 TGTSPYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 74  TTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           TTG+T          + VDKVF     Q DL+  ++      +   G+N +++ +G + T
Sbjct: 45  TTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGT 95

Query: 133 GKTYTMTGDEKL 144
           GK++TM G+  L
Sbjct: 96  GKSFTMFGNNSL 107

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 124/250 (49%), Gaps = 31/250 (12%)

Query: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 372
           +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195 HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK----SGHIPF 428
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L ++    S H  F
Sbjct: 250 TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 483
           ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308 KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 484 AFIMKDILVKNITME----LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE- 538
           A    D+LV+++ ++    LAKI  +LL T+ K    +  ++    NS   S +N +QE 
Sbjct: 365 AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKT---LKTENDSTTNSTSNSLENALQEN 419

Query: 539 --CKRDIESL 546
              K  +ESL
Sbjct: 420 SKLKLQLESL 429

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D +F   + +   +D +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 149 LSDAAGIIPRVLL-KLFDTLELQQNDYVVKCSFIELYNEELKDLLDNN 195
           L +   I  R+L  +  D L+      +   S  ELY +++ DLL NN
Sbjct: 146 LINH--IADRLLFPQCEDNLKT-----LCSISMWELYIDKVYDLLLNN 186

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  +KV+  G  Q  + +++ G    + + G+N +++ +G   +GKTYTM G++     
Sbjct: 67  KFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH---- 122

Query: 148 ELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                 GI+ R+   +FD L    E   N+  +  +F EL+ E + DLL
Sbjct: 123 ----EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 113/241 (46%), Gaps = 27/241 (11%)

Query: 354 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           SRS     IT+ ++++ +E  + S + L+DLA S+ ++++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 413 GRVINALAD--------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 464
            +V+  L++         S     R S+L + LQ ++GG++KT  +   S  K   E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 465 STLEYASKAKNIKNKP-----QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 519
            TL   S+ ++I N P      L +  + D+ +KN++      + D   T+ K   Y+ +
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK---YL-E 394

Query: 520 DHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTIN 579
           D    L   ++  KN+V   K    SL+ KN  L+      + + Q+Q S  E   LT  
Sbjct: 395 DEVSKLGGTIQQNKNQVSTNK----SLTEKNMKLMDQLELYRKSQQTQKSGSEEENLTSQ 450

Query: 580 Q 580
           Q
Sbjct: 451 Q 451

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           + +++DKVF P ASQ  +   + GP+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEELKDLLDNNS 196
                + G++ R+L K+F  +   +   V    S +EL N+++ DLL+  S
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLNKRS 145

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 92/190 (48%), Gaps = 23/190 (12%)

Query: 313 NGI----YIQNLQEFHITNAMEGLNLLQRGLK-HRQVASTKMNDFSSRSHTIFTITLYKK 367
           NGI    +++NL    I      L+ LQ+  K   Q +S  +N  +++     +I + K 
Sbjct: 198 NGIKGDKHVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 368 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
           H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L+D
Sbjct: 254 HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 422 KSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 475
               +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313 PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 476 IKNKPQLGAF 485
           IKN   +  F
Sbjct: 372 IKNPLIMNVF 381

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 57  VVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDF 116
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   + +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 117 IKGYNCTVLVYGMTSTGKTYTM 138
             GYN + + YG +++GK+ T+
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL 115

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 355 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 413
           RS TI  I L +  +DE L   S +  VDLAGS+  ++        + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 414 RVINALADKSG----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 469
            ++  LA+          +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 470 ASKAKNIKNKPQL 482
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 68/169 (40%), Gaps = 50/169 (29%)

Query: 70  VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 129
           +++N++ + G     N  R+  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQYRF--DKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 130 TSTGKTYTMTGDEKLYNGELSDA------------------------------------- 152
           T TGKTYT+ G    +N   +D                                      
Sbjct: 99  TGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSIL 156

Query: 153 ----AGIIPRV---LLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
                G+I +V   L ++ D +   +    ++V  SF+E+Y EE+ DLL
Sbjct: 157 QKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 104 IFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKL 163
           +++ + G L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 164 FDTLELQQND--YVVKCSFIELYNEELKDLLDNN 195
           +D ++   ND  + V  S IE++ E++ DLL N+
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLLVND 162

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 100/221 (45%), Gaps = 28/221 (12%)

Query: 311 QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDF--SSRSHTIFTITLYKKH 368
           Q +  Y ++L    +T+  E +N +     +R   S    ++   S+SH I  I + +++
Sbjct: 174 QDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRN 233

Query: 369 QDE-LFRISKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINALADKS-- 423
            +E + +   ++  DLA  + I++    +L   + E   +N    TL   I ++++ S  
Sbjct: 234 LNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSEN 293

Query: 424 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 477
               IP++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I     
Sbjct: 294 PNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVH 353

Query: 478 -NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM 517
            NK  L +    D++V+++              KSKE  YM
Sbjct: 354 MNKHALNSKKKLDLIVEDM--------------KSKEANYM 380

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 89/203 (43%), Gaps = 37/203 (18%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373
           G+Y Q     +I +  E   +++    +++ +  KM+   S SH +   ++     ++L 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSV-----EQLD 259

Query: 374 RI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD--KSGH 425
           R+      S +   DL GS    +        +    +N S+  L  V+N++    +  H
Sbjct: 260 RVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNH 319

Query: 426 ------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
                             +P+++S+LT L+Q++LGGN++T ++      K   EET +TL
Sbjct: 320 LYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATL 379

Query: 468 EYASKAKNIKNKPQLGAFIMKDI 490
            +  + +NI N      F+  D+
Sbjct: 380 RFGVQLQNILN------FVRADV 396

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  +KV+  G     I   ++  + +D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYV-VKCSFIELYNEELKDLL 192
             D+ GII      +      LE  QN  V ++ S +E+  E++ D+L
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML 186

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 72  INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTS 131
           + T  DT +  ++  + ++  KV    A++   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 132 TGKTYTMTGDEKLYNGELSDA---AGIIPRVLLKLFDTLELQQ-NDYVVKCSFIELYNEE 187
              +  M G +   + E  D+   +G++ +    +F+ ++    ++Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 188 LKDLL 192
           + DLL
Sbjct: 193 VFDLL 197

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 64/154 (41%), Gaps = 32/154 (20%)

Query: 337 RGLKHRQVAS-TKMNDF--------SSRSHTIFTITL--YKKHQDELFRISKMNLVDLAG 385
           +GLK   V+S  ++ D+        +S  HT   I+L     H+D  FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 386 SENINRSGALNQRAKEAGSINQSLLTLGRVINALA-DKSGHIPFRESKLTRLLQDSLGGN 444
            E++                   L  +  ++  L+ D    I   +S+  +LL +S+GGN
Sbjct: 225 QEDV-------------------LQLVCSLVAVLSNDNDKKIGKEKSQFCKLLSNSIGGN 265

Query: 445 TKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
            KT  I   S  +   + +  TLE+  K   + N
Sbjct: 266 RKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 115 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN-D 173
           +  +G +C+++ YG ++TGKT+ +               GIIP  + +L+  LE Q +  
Sbjct: 75  ELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYIYLEAQSDLQ 124

Query: 174 YVVKCSFIELYNE-ELKDLL 192
           Y +  S  E  ++ +++DLL
Sbjct: 125 YQIGLSVWEADSKGKIRDLL 144

>NCAS0I02300 Chr9 complement(426211..435288) [9078 bp, 3025 aa] {ON}
           Anc_3.124 YBR140C
          Length = 3025

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 17/101 (16%)

Query: 214 IFDSNTANNTTSNSASSSR-SNSRNSSPRSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQ 272
           IF ++ AN+TTS+ +  +  + +   +P SL  +TP  AL       +S P+ +      
Sbjct: 833 IFPTSQANSTTSSVSDVAEIAETGTPTPNSLKSITP--ALTHGAQNNQSFPDLV------ 884

Query: 273 QTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSN 313
            TT + N     PG  +   PG+ +TNN++R  ++P+ +S+
Sbjct: 885 -TTPTYNP----PGLIS---PGSTHTNNTRRFPLSPSGESD 917

>ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {ON}
           similar to Q12234 YOR216C uniprot|Q12234 Saccharomyces
           cerevisiae RUD3 Golgi matrix protein that is involved in
           the structural organization of the cis-Golgi
          Length = 452

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 855 MNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHSHITNI 914
           + K  S++K  ++E E    L +  ++FNDQ  Q   +   LK  +E S  ST SH+  I
Sbjct: 256 LTKENSILKDSLKEME--AELERTEQRFNDQLTQRNIEVNSLKAELERSKESTKSHVDTI 313

Query: 915 DDIYDTIENIMKNYGNKENAVKNEMIDNILK 945
           D +   +E  MK+   ++  ++ E  D +L+
Sbjct: 314 DTLRGEVER-MKDAVEQKEKLEKECKDRVLQ 343

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2.649
           YKL012W
          Length = 606

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 712 RVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN-HHIDSTYEDIEKKTSE 770
           R + + + N +A + +D S    + +Q L+N+ F+NN + + N H +  T+ED+ K+  +
Sbjct: 306 RTELRDYLNGVAFSPNDGS--LLSWQQLLQNYLFENNKRFVANKHFVVLTHEDVLKEYLD 363

Query: 771 FVENFKNTLNDHLEENK 787
            V+ ++  L D L+E K
Sbjct: 364 IVDTYETKLRDALKEEK 380

>Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W
           (TID3) - Product of gene unknown [contig 159] FULL
          Length = 676

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 120/266 (45%), Gaps = 41/266 (15%)

Query: 654 ISQETNIQPNLDIIKNEVLTL--METMQEKAELMYKDCVKKILNESPKFF----NVIVEK 707
           ISQ T    +L +++  + T    E  QEK EL+ +      + +S K F    +   + 
Sbjct: 239 ISQNTQ---DLTVLRQPIGTFDEQEDKQEKYELIVERLFIDYIVQSYKSFLQLDDDYSQY 295

Query: 708 IDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKK 767
           +  + + F++F   I  +++DI  +NN+L    ++   K    ++     ++   D+ K 
Sbjct: 296 MKELELGFEKFSQIIRSDIADIGMQNNDLSVKYQDMVEKGQEVKVAKDKFNALNSDLTK- 354

Query: 768 TSEFVENFKNTLNDH----------LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE 817
                +N+ N +             +E  K+  ++ L + T   I++  DL + K +   
Sbjct: 355 ----FQNYVNAMQHKSQEWPRKLAKMEAEKESKLEQLKD-TEREISEIRDLIKDKDID-- 407

Query: 818 NSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA-VSLL 876
                + + D +N E           +K  +DT+SN+M++++S +K Q  E+E+A +SLL
Sbjct: 408 -----MAEVDRLNTE--------REGLKKALDTTSNNMDQAVSRLKAQKIETESAYMSLL 454

Query: 877 KNNKKFNDQFKQLVNKHTILKDNIEN 902
              K++    + L+     L  +++N
Sbjct: 455 DVGKQYESSVENLIAARAQLGHHLDN 480

>NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 91/215 (42%), Gaps = 14/215 (6%)

Query: 704 IVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYED 763
           ++ K + + V       + AE +S++ +    L          NN   L+N    ++  D
Sbjct: 339 VIPKFETVAVVAFPTVGDAAECVSNVIQSGIQLTAM---ELLDNNMMHLINKGGATSRTD 395

Query: 764 -IEKKTSEF--VENFKNTLNDHLEENKKLI----MQNLTNATSAVINQEMDLFEPKRVKW 816
            IEK T  F    + + T++D + E +KL      QN   A     +++++L+E ++V  
Sbjct: 396 WIEKPTVFFRIGGHTQKTIDDLVSEVEKLAKSNKCQNFEFAKDE--DEKVELWEARKVAL 453

Query: 817 ENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS--ISVMKGQVEESENAVS 874
            +  D     D     +  ++A  LSQ+  T++ +   M+KS  I+ + G V +      
Sbjct: 454 WSVLDAGRNTDPKARVWTTDVAVPLSQLPQTIEKTKQEMDKSKLINAIVGHVGDGNFHSF 513

Query: 875 LLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHS 909
           ++  N     + ++LV         +E + T  H 
Sbjct: 514 IIYRNADERKKCEKLVENMVHRALEVEGTCTGEHG 548

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 87/175 (49%), Gaps = 36/175 (20%)

Query: 492 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNS 551
           ++N+ +EL  +K   L+TK KE +   ++   N++S+ E YK +  E    I   S    
Sbjct: 350 IENLELELNDLKD--LNTKLKESLNDKENELTNVSSEYEKYKLDA-EAHMGIMKDSD--- 403

Query: 552 LLLKDKLKSKDT-IQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQ 610
               DKLK++   I+ +N ++ S  L +N++   L             N++L  L +I++
Sbjct: 404 ----DKLKNQVIEIRKKNIELNSKLLQMNEVNENL-------------NDELMSLKDIIE 446

Query: 611 LALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLD 665
              QD K +             +E+KSLK++  SQ+  ++QNN++ E  ++ NLD
Sbjct: 447 KLEQDKKAK------------LQELKSLKSSDISQIEDLKQNNLTLERKLKENLD 489

>NCAS0B03980 Chr2 (712826..716380) [3555 bp, 1184 aa] {ON} Anc_8.235
          Length = 1184

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 81/173 (46%), Gaps = 33/173 (19%)

Query: 540 KRDIES-LSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598
           K+DIE  L S  +L+  + ++ +DTI+S  +++  ++  + ++       H   L++  F
Sbjct: 610 KKDIEKRLDSIETLM--NNVELRDTIESTFTKLPDVERMLARI-------HSGTLKVKDF 660

Query: 599 NNKLQKLTEIMQL--ALQDYKRRELDLNKKFETHISKEIKSL------KTTLFSQLSGME 650
           +  +Q   +I+ L  +++D+     DL      + S+  KSL       T  F ++  +E
Sbjct: 661 DRVIQAFEDIVTLQNSIKDF-----DLKGALSVYFSQIPKSLIDDVENWTNAFDRIKAVE 715

Query: 651 QNNISQETNIQPNLDIIKNEVLTLMETMQEKAELM----------YKDCVKKI 693
           +N I     I+P  D   +++  L + +Q++  L           YKD  K+I
Sbjct: 716 ENIIIPHRGIEPEFDKSLDDIQELEDQLQDQLNLYKKRFKNSNIQYKDSGKEI 768

>KNAG0G00480 Chr7 (82725..84221) [1497 bp, 498 aa] {ON} Anc_1.483
           YEL040W
          Length = 498

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%)

Query: 264 NTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPNDQSNGIYIQNLQEF 323
           N   QQ++   T S+ + S  PG  + N PG I     + +  AP+   NG Y   L+E 
Sbjct: 234 NETTQQYRYPQTPSKVDISIWPGGNSTNAPGTIAWAGGEINWDAPDITENGYYYTILKEI 293

Query: 324 HIT 326
           ++T
Sbjct: 294 NVT 296

>YDR460W Chr4 (1383811..1384776) [966 bp, 321 aa] {ON}  TFB3Subunit
           of TFIIH and nucleotide excision repair factor 3
           complexes, involved in transcription initiation,
           required for nucleotide excision repair; ring finger
           protein similar to mammalian CAK and TFIIH subunit
          Length = 321

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 98/219 (44%), Gaps = 46/219 (21%)

Query: 682 AELMYKDCVKKILNESPK---FFNVIVEK-IDIIRVDFQRFYNNIAENLSDISEENNNLK 737
           A+  YK C K +     K   F +V VEK +DI +  F  F   I +   D+ E N  L+
Sbjct: 52  AQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLE 111

Query: 738 QYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNA 797
           + +++  +K      L+H ID        KT E        L  + E NK+LIM NL  +
Sbjct: 112 E-VEDIIYK------LDHGIDVA------KTEE-------KLRTYEELNKQLIMNNLERS 151

Query: 798 TSAVINQEMDLFEPKRVKWENSFDL--------INKCDSMNNEF-----YNNMATTLSQI 844
            +     E++ FE +R K+E    L        I + + MN E+      N ++TT   I
Sbjct: 152 RT-----EIESFE-QRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLSTTTQDI 205

Query: 845 KNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFN 883
             T++   N++    S  + ++EE      +LKNN  FN
Sbjct: 206 NETIEGVKNTVKLKKSSARRKLEELN---RVLKNNPYFN 241

>KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239C ADY3 Protein required for spore wall formation
           thought to mediate assembly of a Don1p- containing
           structure at the leading edge of the prospore membrane
           via interaction with spindle pole body components
           potentially phosphorylated by Cdc28p
          Length = 754

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 81/157 (51%), Gaps = 19/157 (12%)

Query: 449 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLS 508
           LI ++  AK+ +++T    E+ +K +N+ ++      + K+   K+ T+ + K+K++L S
Sbjct: 267 LINSVDEAKIRAQKTEK--EFQTKIQNLTDE-----LLKKE---KSHTVTVKKLKAELKS 316

Query: 509 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLL--LKDKLKSKDTIQS 566
           TK  +   + +   + L  D+E   N + +       + S++S +  L  KLKS D  Q 
Sbjct: 317 TKELQAGLVEKASMQKLQEDMEERLNSLSDV------VKSRDSTINDLTAKLKSADAEQE 370

Query: 567 QNS-QMESLKLTINQLKAQLDKQHKTELEISGFNNKL 602
           Q S Q+   K  + QL ++L+ +   E E+S   +KL
Sbjct: 371 QLSLQLLESKTLVEQLNSKLESKLTVEAEVSDLKSKL 407

>TBLA0B03520 Chr2 (819266..821713) [2448 bp, 815 aa] {ON} Anc_8.727
           YMR212C
          Length = 815

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query: 745 FKNNHQELLNH-HIDSTYEDIEKKTSE--FVENFKNTLNDHLEENKKLIMQNLTNATSAV 801
           F   HQ+L+NH +      D++  +SE  ++  + N+    LE+    +   LT  T+  
Sbjct: 6   FTPKHQKLVNHCYPKGRSPDMKPNSSETSYLLYYVNSRRSKLEK----VSNYLTRKTAGD 61

Query: 802 INQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISV 861
           +N +   F    V  +    +I  C    N F +N  +  S I   +D S   +N  + +
Sbjct: 62  LNHKR--FGHISVTLQLMDKIIIDCKENINIFISNFLSIYSSI--ILDPS---INNDLPI 114

Query: 862 MKGQVEESENA-----VSLLKNNKKFNDQFKQLVNKH-TILKDNIEN-----SITSTHSH 910
           M+   E   N      +SLL  N     QFK+ ++   T+++  I+N     ++  + SH
Sbjct: 115 MELIYENLNNLSLNIDMSLLNGNPTIFKQFKEFIDYFITLIEKRIKNDDLLLNVFISLSH 174

Query: 911 ITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSK 952
           ITN+  + DT E++  NY  K++  K   I   +K  P+ +K
Sbjct: 175 ITNLSILKDTNEDLSLNYLIKDSIDKTLAI--FIKRFPTYAK 214

>KNAG0E02930 Chr5 (588769..590532) [1764 bp, 587 aa] {ON} Anc_2.16
           YNL225C
          Length = 587

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 96/194 (49%), Gaps = 30/194 (15%)

Query: 607 EIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET--NIQPNL 664
           +++++A+    R  L++ + F+ + S+E+++LK++ FS L+      ++ +T  N +   
Sbjct: 125 DVLEVAMTKLARTRLEIQEAFQWY-SQELQNLKSS-FSSLT-----TVAAQTGKNYEAKE 177

Query: 665 DIIKNEVLTLMETMQ--------EKA-ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDF 715
            II+ +   ++E +Q        EKA EL  KD     L +S      +  K++I + +F
Sbjct: 178 RIIRRQFKQVVEKLQFEYNQFTEEKAKELSEKDMS---LTQSTNLVKELSSKLNISQTEF 234

Query: 716 QRFYNNIAE------NLSDI---SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEK 766
           +RF + I+       N+ D+   + E+ N+   + +  FK N+  +         E +EK
Sbjct: 235 ERFKSQISRMSLFGTNIGDVLKSALESENVGNCILDPSFKKNNPNVSGFAYTPITEVVEK 294

Query: 767 KTSEFVENFKNTLN 780
           + +E + ++K  L 
Sbjct: 295 QCTETINSYKEILG 308

>ZYRO0A02244g Chr1 complement(179204..180214) [1011 bp, 336 aa] {ON}
           similar to uniprot|P40505 Saccharomyces cerevisiae
           YIL084C
          Length = 336

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 191 LLD-NNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSPRSLNDLTPK 249
           L+D  N+++ + + + G + K  R   +N    ++SN    + +   +S+  S  D   +
Sbjct: 133 LMDVANAHSYAIDYYRGKYQKHTRSHGAN-GWESSSNEVGGAGTGRGDSANESATDTGTE 191

Query: 250 AALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGN 295
              LR+R  TK  P T +     + ++ + N SS  G TNN   G 
Sbjct: 192 RRSLRRRAATKGAPATSRLASHAEESDFQTNYSSAQGGTNNQNAGG 237

>YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON}
           CNM67Component of the spindle pole body outer plaque;
           required for spindle orientation and mitotic nuclear
           migration
          Length = 581

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 135/283 (47%), Gaps = 24/283 (8%)

Query: 502 IKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSLLLKDKLKSK 561
           IK  L +++ +E   +SQ  +KN  ++ E  +NE++  K +I+++  KN+ L    + + 
Sbjct: 303 IKGFLCASQQEELSRISQ-RFKNAKAEAEDLRNELENKKIEIQTMREKNNTL----IGTN 357

Query: 562 DTIQSQNSQM--ESLKLTINQLKAQLDKQHKTELEISGFNNKL---QKLTEIMQLALQDY 616
            T+  QN  +  +  KLTI++ +       + ++++   N +L   +K  E  + +L+D 
Sbjct: 358 KTLSKQNKILCDKFDKLTIDEKEILKGCNEEIKIKLERLNERLGSWEKSKEKYETSLKDK 417

Query: 617 KRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLME 676
           ++   D  KK  T +SKE+ +L++  F  L G     I+ +  +Q   DI   E   LM 
Sbjct: 418 EKMLADAEKKTNT-LSKELDNLRSR-FGNLEGNTSERITIKNILQSRPDISAEECNFLMV 475

Query: 677 TMQEKAEL-MYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR---FYNNIAENL-SDISE 731
              + A L   ++ VK+I+      +  +  KI ++ +  +      +N A+ L   +  
Sbjct: 476 EQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYS 535

Query: 732 ENNNLKQYLKNHFF---KNNHQELLNHH----IDSTYEDIEKK 767
           +  NLK++    ++        + ++HH    +D  Y+ I +K
Sbjct: 536 QEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYDHILEK 578

>TPHA0E01380 Chr5 (278339..281998) [3660 bp, 1219 aa] {ON} Anc_5.307
           YDR293C
          Length = 1219

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 108/226 (47%), Gaps = 39/226 (17%)

Query: 379 NLVDLAGSENINRSGALNQRAKEAGS----INQSLLTLGRVINALADKSGHIPFRESKLT 434
           ++VD   +E+I  + +L++RA++  +      +S+  L +V N        + F+E K++
Sbjct: 699 HIVD--ATESIEPNSSLDRRARKRSTGVFLPQKSVNLLPKVFNEF------LTFKEDKVS 750

Query: 435 RLLQ-----DSLGGNTKTALIA--TISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIM 487
             +      D+    T++  I   TI P+ V SEE+ + +     +K +    Q+    +
Sbjct: 751 LAISVVFTLDAETFETESIWIGETTIKPSMVISEESLNDIVEQGSSKTVAKLQQIANQFL 810

Query: 488 K---DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIE 544
           +   D +  ++++ L      L+++   E + +  + ++N  S      N ++E KR + 
Sbjct: 811 RERIDYVDADVSVSLP-----LINSLDDEKVLVDLNIFENRIS-----SNIIEEIKRRVN 860

Query: 545 SLSSKNSLLLKDKLKSKDTIQSQ----NSQMESLKLTINQLKAQLD 586
           S+ +K    + DKL  K  ++ Q    +++ME  K  +NQL  ++D
Sbjct: 861 SIVAKE---IYDKLGDKAFLRRQAIPNDTKMEFFKKKVNQLGFEID 903

>NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON}
           Anc_5.416 YDR358W
          Length = 585

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 13/90 (14%)

Query: 832 EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQ-------VEESENAVSLLKNNKKFND 884
           + +N M +T +    + D S+ ++ +  S +KG        +EE  +  +L+++  KFND
Sbjct: 248 DLFNEMMSTSA----SPDVSNETIEELFSALKGAQPKFQKIIEEEHDDDALVQDLLKFND 303

Query: 885 QFKQLVNKHTILKDNIENSITSTHSHITNI 914
              QL+ K+++LK  I NS  ++  H   I
Sbjct: 304 TVNQLLEKYSLLK--IGNSSAASQIHPVAI 331

>Skud_12.509 Chr12 complement(906950..908206) [1257 bp, 418 aa] {ON}
           YLR423C (REAL)
          Length = 418

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 83/188 (44%), Gaps = 23/188 (12%)

Query: 764 IEKKT-SEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDL 822
           I+K T ++  E F   L D LE++   IM +LT      +     L + K+V  E   DL
Sbjct: 188 IDKSTETDVAEQFSRELTD-LEKDLVEIMNSLTQHFDKTL-----LLQDKKVGNEERGDL 241

Query: 823 INKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKF 882
                  + E YN +  TL +I N VD +  ++N+ +     +  E  N VS + N+  F
Sbjct: 242 FKVVQGDDQELYN-ITKTLHEIINDVDKTILNLNQFLQKKMDEKAEIHNGVSEIIND--F 298

Query: 883 NDQFKQLVNKHTI--LKDNIENSITSTHSHITNIDDIYDTIENIMKNYGN--------KE 932
           N   + L+    I  L D  +NS T        + + YD+ E   K+Y N        +E
Sbjct: 299 NRNLEYLIIFKDISNLIDTFKNSCTQDIQITKELCEFYDSFE---KSYSNLVSEAKRRRE 355

Query: 933 NAVKNEMI 940
            A K E+I
Sbjct: 356 VASKMEII 363

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
           (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 108/254 (42%), Gaps = 71/254 (27%)

Query: 620 ELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQ 679
           E+++N+KF  + +  I SL TT    LS +E +    +  I   LD IKN ++  ++  Q
Sbjct: 123 EVEINEKFLNYHT--ITSLITTNLGWLSALEIDMHYFQIQISDTLDYIKN-IIESLKICQ 179

Query: 680 EKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS--------- 730
              EL   D V+ + N + KF N +    +I++ ++  +Y+NI   LSDI+         
Sbjct: 180 NYLELYCYD-VENLYNSNVKFLNQLANN-EILK-NWLNYYDNILTKLSDINGNKLSSYLN 236

Query: 731 -----------EE-----NNNLKQYL----KNHFFKNNHQELLNHHIDSTYEDI------ 764
                      EE     N+NLK++     KN   +NN    +N  I S  E I      
Sbjct: 237 KNELVSISSKIEELDQRVNSNLKKFKIVIDKNIDLRNN----INKEISSLSEKITPSSEK 292

Query: 765 --------------------------EKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 798
                                     EK  +EF +N+   L   LE++KK+ + NL   +
Sbjct: 293 YKLEETMLEKFTELVKNLRNDSKVILEKDENEFDKNYMQNLAKSLEKDKKVTVTNLLTIS 352

Query: 799 SAVINQEMDLFEPK 812
            A+ +Q  D+ E K
Sbjct: 353 KALYSQANDISEIK 366

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 135 TYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQ 170
           T T   D++ Y GE +D  GI P+  +K+ +T   Q
Sbjct: 33  TVTNVEDDEWYYGEYADKEGIFPKSFVKILETAPAQ 68

>Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON}
           (19685..21463) [1779 nt, 593 aa]
          Length = 592

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 81/166 (48%), Gaps = 10/166 (6%)

Query: 635 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 694
           ++++  T+ S L G   N    E NI  + D+I  + L   E + +  EL+  D   K L
Sbjct: 430 VEAVDKTIISLLQG--DNKDILEKNIPMSADVISKKYLKEAEVVTQ--ELV--DITLKRL 483

Query: 695 NESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 754
           +   K  + + + ++  R+ F+     +A+N SD+S++  +L  +L+     +    L++
Sbjct: 484 HLKFKELDRLEDTLEKERIKFEEQTKQLADNRSDLSKQITDLNSHLEK-LSVSKKLVLIS 542

Query: 755 HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 800
             +DST + +EK+     E   N     L++ K L ++ LTNA  A
Sbjct: 543 EQVDSTIKVVEKEEQTAAEEADNK---ELQKKKNLELEALTNAAPA 585

>KNAG0A02280 Chr1 complement(208088..210670) [2583 bp, 860 aa] {ON}
           Anc_8.484 YDR251W
          Length = 860

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 104/245 (42%), Gaps = 49/245 (20%)

Query: 582 KAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTT 641
            A LD+Q   +  ISG   +  K+   M + L      E  L KK+  H + E+ SL   
Sbjct: 236 PAGLDQQILAKPLISGLVAEALKIAASMGVKLGPSWDNEASLLKKWAQHNADEVPSLLYH 295

Query: 642 LFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFF 701
              + + +             N+D++  +V+ L +    K   M             +F 
Sbjct: 296 FIHRTASL-------------NIDLLWLQVILLADDYNIKTPYM-------------EFL 329

Query: 702 NVIVEKIDIIRVDFQRFYNNIAE-NLSDISEENNNLK---QYLKNHFF-KNNHQELLNHH 756
             ++ ++  I     +++  I + N    +E  +NL    Q L N    K+N  + LN++
Sbjct: 330 YSMITQLQNINQGASKWFVRIEDHNGQATAEHTDNLNRKIQELSNTLVAKDNQLDTLNNN 389

Query: 757 IDSTYEDI---EKKTSEFVENFK---NTLNDHLEENKKLIMQNLTNATS----AVINQEM 806
           +    + +   +++T+E V+N++   NTLN+ L        + LT ATS    AV N  +
Sbjct: 390 VTELQKQLQSNQRETAETVKNYQTQINTLNEKL--------KTLTVATSVHDTAVSNTNV 441

Query: 807 DLFEP 811
           D ++P
Sbjct: 442 DNYKP 446

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,698,939
Number of extensions: 5919058
Number of successful extensions: 75855
Number of sequences better than 10.0: 3868
Number of HSP's gapped: 63502
Number of HSP's successfully gapped: 6496
Length of query: 999
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 879
Effective length of database: 39,721,479
Effective search space: 34915180041
Effective search space used: 34915180041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)