Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.66.16ON99999945420.0
YEL061C (CIN8)6.16ON1000100041590.0
Skud_5.286.16ON998100141420.0
Smik_5.266.16ON1002100241370.0
TDEL0G045306.16ON95893923530.0
ZYRO0C07898g6.16ON97465816410.0
NCAS0H008806.16ON100463315660.0
CAGL0B03641g6.16ON98855815360.0
SAKL0E01078g6.16ON94868714940.0
NDAI0D008706.16ON106962014990.0
Kpol_1032.66.16ON100462114750.0
KLLA0D01045g6.16ON96568014520.0
KAFR0L003706.16ON96356214490.0
Kwal_56.224036.16ON94367814001e-178
KNAG0M011306.16ON95056013661e-172
KLTH0C11330g6.16ON94167413161e-165
Ecym_30206.16ON94459513111e-164
TBLA0A072306.16ON109758613221e-164
ACR010C6.16ON94559712871e-161
TPHA0M002406.16ON93962012831e-160
Kpol_1045.736.16ON96271110701e-129
TPHA0J003006.16ON98291710231e-122
Smik_2.537.387ON11132206509e-70
YBL063W (KIP1)7.387ON11112216491e-69
Suva_2.547.387ON11102206481e-69
Skud_2.417.387ON11102216482e-69
ACR228C7.387ON11292276402e-68
SAKL0F12298g7.387ON11122166392e-68
Ecym_46887.387ON11342256295e-67
TPHA0E008907.387ON12322206298e-67
TDEL0C016007.387ON11052146224e-66
ZYRO0B03234g7.387ON11382136111e-64
NDAI0E043007.387ON11862186111e-64
NCAS0E026407.387ON11022166073e-64
KAFR0L017107.387ON11512195976e-63
TBLA0D006407.387ON11421984678e-47
KLTH0G03850g5.531ON4731733602e-35
Kwal_47.186085.531ON4791753503e-34
SAKL0G18920g2.633ON6491853556e-34
KLLA0B00759g5.531ON4561743432e-33
SAKL0G05016g5.531ON5041733453e-33
ADR145C2.633ON6351693192e-29
Ecym_34152.633ON6621823192e-29
Ecym_40665.531ON4781723052e-28
KAFR0F042103.528ON6721783093e-28
CAGL0I07029g3.528ON7051803076e-28
SAKL0F01760g3.528ON8091783087e-28
Suva_7.443.528ON8051783061e-27
Skud_7.533.528ON8051783042e-27
TDEL0D059603.528ON7331813032e-27
NCAS0E005503.528ON7841803015e-27
Kwal_47.190933.528ON8191793006e-27
Smik_7.483.528ON8051782997e-27
KNAG0B005203.528ON7231832988e-27
TBLA0C039403.479ON7391832988e-27
KLLA0A01606g3.528ON7691822989e-27
YGL216W (KIP3)3.528ON8051782981e-26
ZYRO0E08668g3.528ON7781812961e-26
TBLA0C049603.528ON8011882962e-26
CAGL0D04994g3.479ON6921482924e-26
ZYRO0D12650g5.531ON4781712874e-26
TPHA0D034803.528ON8471792934e-26
KLTH0G01606g3.528ON8191792935e-26
NDAI0I029603.528ON8681852926e-26
Kpol_1050.1033.479ON6971522906e-26
Kpol_423.83.528ON8061812901e-25
Kpol_1004.255.531ON5061912813e-25
KNAG0A078803.479ON7641432853e-25
TPHA0D032003.479ON7241512844e-25
KAFR0B065903.479ON7061502835e-25
AER441C3.528ON8181812836e-25
NCAS0F034703.479ON6981512827e-25
NCAS0C013508.678ON6551832782e-24
Ecym_12003.528ON8331782802e-24
AGR253W3.479ON7091692764e-24
NDAI0B057703.479ON7631562764e-24
Kpol_505.393.479ON6921502711e-23
TDEL0F036403.479ON7041482712e-23
SAKL0F03168g3.479ON7061452702e-23
ZYRO0F07414g8.678ON6541942692e-23
Kpol_1013.78.678ON6201912673e-23
YPR141C (KAR3)3.479ON7291442684e-23
Suva_16.4693.479ON7311442675e-23
Skud_16.4353.479ON7291442666e-23
ZYRO0B04290g3.479ON7311482666e-23
Ecym_44073.479ON7111662659e-23
Smik_16.3883.479ON7291442649e-23
KLLA0D05951g8.678ON6682502622e-22
NDAI0E02090singletonON6851962612e-22
KAFR0H024108.678ON6582282585e-22
TBLA0C053103.479ON6761812576e-22
KLTH0F14498g3.479ON7021672577e-22
KLLA0B10956g3.479ON6901512532e-21
Kwal_26.88068.678ON7152522489e-21
CAGL0M02189g8.678ON6721942452e-20
SAKL0H06490g8.678ON6572252452e-20
TPHA0D012708.678ON6961882452e-20
YPL155C (KIP2)8.678ON7062002417e-20
ACR145W8.678ON6852112408e-20
TDEL0A062408.678ON6373722398e-20
KLTH0D11286g8.678ON6781882398e-20
Smik_6.3528.678ON7152062362e-19
Skud_16.1278.678ON7062002344e-19
Ecym_23958.678ON6872152344e-19
TDEL0B072702.633ON6441992282e-18
TBLA0C018808.678ON4681512209e-18
KNAG0J017208.678ON6251842211e-17
TPHA0D041903.479ON6721442149e-17
Suva_16.1558.678ON7042002068e-16
Kpol_1019.112.633ON6472071987e-15
Suva_11.1452.633ON6571241853e-13
Kwal_55.21164singletonOFF5881651853e-13
Kwal_YGOB_55.211643.479ON6571651843e-13
TPHA0N016502.633ON6822151772e-12
Smik_11.1602.633ON6561281674e-11
Skud_11.1482.633ON6561081612e-10
YKL079W (SMY1)2.633ON6561081593e-10
TBLA0A008202.633ON8031761523e-09
NCAS0H031802.633ON6602131495e-09
ZYRO0E01078g2.633ON6681091452e-08
KNAG0M025402.633ON5221081361e-07
NDAI0C004802.633ON5981901334e-07
TBLA0C008002.633ON6931331291e-06
KAFR0C040202.633ON667911156e-05
CAGL0L05104g2.633ON6752031112e-04
KNAG0H003602.633ON6811251067e-04
NCAS0C052002.633ON572154820.46
KNAG0M024702.649ON60677800.81
KNAG0E029302.16ON587194791.1
TPHA0H016805.414ON989174771.8
Kpol_1065.363.330ON1219279763.1
NCAS0A142107.364ON600172743.7
Kpol_1063.77.204ON592166726.3
NCAS0C028308.401ON874135728.5
NCAS0D019505.170ON93936719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.6
         (999 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1754   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1606   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1600   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1598   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   910   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   636   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   607   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   596   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   580   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   582   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   572   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   563   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   562   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   543   e-178
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   530   e-172
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   511   e-165
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   509   e-164
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   513   e-164
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   500   e-161
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   498   e-160
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   416   e-129
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   398   e-122
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   254   9e-70
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   254   1e-69
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   254   1e-69
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   254   2e-69
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   251   2e-68
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   250   2e-68
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   246   5e-67
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   246   8e-67
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   244   4e-66
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   239   1e-64
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   239   1e-64
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   238   3e-64
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   234   6e-63
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   184   8e-47
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   143   2e-35
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   139   3e-34
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   141   6e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   136   2e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   137   3e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   127   2e-29
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   127   2e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   122   2e-28
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   123   3e-28
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   122   6e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   123   7e-28
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   1e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   2e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   121   2e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   120   5e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   120   6e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   7e-27
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   119   8e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   119   8e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   119   9e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   119   1e-26
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   118   1e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   118   2e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   117   4e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   115   4e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   117   4e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   117   5e-26
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   117   6e-26
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   116   6e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   116   1e-25
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   112   3e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   114   3e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   114   4e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   113   5e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   113   6e-25
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   113   7e-25
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   111   2e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   2e-24
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   110   4e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   110   4e-24
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   108   1e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   108   2e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   2e-23
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   108   2e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   3e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   107   4e-23
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   107   5e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   107   6e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   107   6e-23
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   106   9e-23
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   106   9e-23
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   105   2e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   105   2e-22
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   103   5e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   103   6e-22
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   103   7e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   2e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   100   9e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    99   2e-20
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    99   2e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    99   2e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    97   7e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    97   8e-20
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    97   8e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    97   8e-20
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   2e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    95   4e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    95   4e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    92   2e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    89   9e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    90   1e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    87   9e-17
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    84   8e-16
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    81   7e-15
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    76   3e-13
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    76   3e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    75   3e-13
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    73   2e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    69   4e-11
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    67   2e-10
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    66   3e-10
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    63   3e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     62   5e-09
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    60   2e-08
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    57   1e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   4e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   1e-06
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    49   6e-05
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    47   2e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    45   7e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    36   0.46 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    35   0.81 
KNAG0E02930 Chr5 (588769..590532) [1764 bp, 587 aa] {ON} Anc_2.1...    35   1.1  
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    34   1.8  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    34   3.1  
NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON}             33   3.7  
Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON} (19685.....    32   6.3  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     32   8.5  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   9.2  

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score = 1754 bits (4542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 891/999 (89%), Positives = 891/999 (89%)

Query: 1   MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
           MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN
Sbjct: 1   MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60

Query: 61  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
           VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61  VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121 NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
           NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121 NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181 IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
           IELYNEELKDLLD         GFEGPFMKKLRIFD                        
Sbjct: 181 IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240

Query: 241 XXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
             LNDLTPKAALLRKRLRTKSL                                      
Sbjct: 241 RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300

Query: 301 XXRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360
             RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF
Sbjct: 301 SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIF 360

Query: 361 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA
Sbjct: 361 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP
Sbjct: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540
           QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK
Sbjct: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECK 540

Query: 541 RDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600
           RDIE                  TIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN
Sbjct: 541 RDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNN 600

Query: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660
           KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI
Sbjct: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660

Query: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720
           QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN
Sbjct: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720

Query: 721 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 780
           NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN
Sbjct: 721 NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLN 780

Query: 781 DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 840
           DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT
Sbjct: 781 DHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATT 840

Query: 841 LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNI 900
           LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVS               VNKHTILKDNI
Sbjct: 841 LSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNI 900

Query: 901 ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 960
           ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN
Sbjct: 901 ENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLSN 960

Query: 961 TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
           TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE
Sbjct: 961 TNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1606 bits (4159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1000 (79%), Positives = 853/1000 (85%), Gaps = 1/1000 (0%)

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
            MPAENQNT Q+RSSN+IS N N+Q+GCH VPNEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEELKDLLD         GF+G FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSP 240

Query: 241  XXLNDLTPKAALLRKRLRTKSL-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
              LNDLTPKAALLRKRLRTKSL                                      
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTN 300

Query: 300  XXXRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 359
               RSSMAPNDQ+NGIYIQNLQEFHITNAMEGLNLLQ+GLKHRQVASTKMNDFSSRSHTI
Sbjct: 301  NGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360

Query: 360  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419
            FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL
Sbjct: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420

Query: 420  ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
             DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK
Sbjct: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480

Query: 480  PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 539
            PQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC
Sbjct: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540

Query: 540  KRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFN 599
            KR+IE                  TIQSQN Q+ESLK TI+ L+AQLDKQHKTE+EIS FN
Sbjct: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600

Query: 600  NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETN 659
            NKLQKLTE+MQ+AL DYK+RELDLN+KFE HI+KEIK LK+TLF QL+ M+Q +I QETN
Sbjct: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660

Query: 660  IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFY 719
            IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIRVDFQ+FY
Sbjct: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720

Query: 720  NNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL 779
             NIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYE+IEK+T+EFVENFK  L
Sbjct: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780

Query: 780  NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 839
            NDHL+ENKKLIMQNLT ATSAVI+QEMDLFEPKRVKWENSFDLIN CDSMNNEFYN+MA 
Sbjct: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840

Query: 840  TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDN 899
            TLSQIK+TVDTSSNSMN+SISVMKGQVEESENA+S               +NKH +LKDN
Sbjct: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900

Query: 900  IENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLS 959
            I+NSITSTHSHITN+DDIY+TIENIMKNYGNKENA K+EMI+NILKEIP+LSK++PLRLS
Sbjct: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLS 960

Query: 960  NTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
            N N NS Q+++SPKKHAI+DEN S+E  D E SRK+ K E
Sbjct: 961  NINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score = 1600 bits (4142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/1001 (80%), Positives = 856/1001 (85%), Gaps = 5/1001 (0%)

Query: 1   MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVV 58
           MPAE+QNTIQERSSN+IS+N N   Q+GCH VPNEELNITVAVRCRGRNEREIGMKSSVV
Sbjct: 1   MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 59  VNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118
           VNVPDITGS+EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 61  VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178
           GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 121 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 179 SFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 238
           SFIELYNEELKDLLD         GF+G FMKKLRIFD                      
Sbjct: 181 SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 239 XXXXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 298
               LNDLTPKAALLRKRLRTKSL                                    
Sbjct: 241 SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNG 300

Query: 299 XXXXRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHT 358
               RS M  NDQSNGIYIQNLQEFHITNA+EGLNLLQRGLKHRQVASTKMNDFSSRSHT
Sbjct: 301 Q---RSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHT 357

Query: 359 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 418
           IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA
Sbjct: 358 IFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 417

Query: 419 LADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
           L D+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN
Sbjct: 418 LVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 477

Query: 479 KPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQE 538
           KPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQE
Sbjct: 478 KPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQE 537

Query: 539 CKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGF 598
           CKR+IE                  TIQSQNSQMESLK TIN LKAQLDKQHK ELEISGF
Sbjct: 538 CKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGF 597

Query: 599 NNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET 658
           NNKLQK+TE+MQ+ALQDYK+RELDLNKKFETHISKEIKSLKT LF QL  M+Q NI QET
Sbjct: 598 NNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQET 657

Query: 659 NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRF 718
           +IQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR++FQ F
Sbjct: 658 DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNF 717

Query: 719 YNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNT 778
           Y NIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYE+IEKKT++FVENFK T
Sbjct: 718 YKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMT 777

Query: 779 LNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMA 838
           LNDHLEENKKLIMQN+TNATSAVI+QEMDLFEP+R KWENSFDLINKCDSMNNEFYNNMA
Sbjct: 778 LNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMA 837

Query: 839 TTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKD 898
            TLSQIK TVDTSSNSMN+SISVMKGQVEESENA+S               ++KH ILKD
Sbjct: 838 ATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKD 897

Query: 899 NIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRL 958
           NIE+SITSTHSHITN+DDIY+TIE+IM N+GNKENA K+EMIDNILKEIP+LSKR+PLR+
Sbjct: 898 NIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLRI 957

Query: 959 SNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
           SN NG S Q+I+SPKKH I+DENPS+E  D E SRKI KTE
Sbjct: 958 SNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1598 bits (4137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1002 (79%), Positives = 849/1002 (84%), Gaps = 3/1002 (0%)

Query: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60
            MP ENQN+ QER+SNNIS N N+QIGCH V NEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDXXXXXXXXXGFEGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEELKDLLD         GF+G FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNSSP 240

Query: 241  XXLNDLTPKAALLRKRLRTKSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
              LNDLTPKAALLR+RLRTKSL                                      
Sbjct: 241  RSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTN 300

Query: 301  X---XRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 357
                 R+S+APNDQSNGIYIQNLQEFHITNAMEGL LLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 301  NNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360

Query: 358  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 417
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420

Query: 418  ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
            AL DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480

Query: 478  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 537
            NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540

Query: 538  ECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 597
            ECKR+IE                  TIQSQNSQ+ESLK TI+ L+ QLDKQHKTELEISG
Sbjct: 541  ECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600

Query: 598  FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 657
            FN+KLQKLTE+MQ+ALQDYKRRELDLNKKFETHI+ EIK++KTTLFSQLS ++Q NI QE
Sbjct: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660

Query: 658  TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 717
            T+IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII VDF+R
Sbjct: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720

Query: 718  FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 777
            FY NIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKT++FVENFK 
Sbjct: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780

Query: 778  TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 837
             LNDHLEENKKLIM+NLT  TSAVI+QEM LFEPKRVKWE+SFDLIN+CDSMNNEFYN+M
Sbjct: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840

Query: 838  ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILK 897
            ATTLSQIK+TVDTSSNSMNKSISVMKGQVEESENA+S               +NKHTILK
Sbjct: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900

Query: 898  DNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLR 957
            DNIE+SITST+SHITNIDDIY+TIE IM NYGNKENA K+EMI+N+L EIP+LSKR+PLR
Sbjct: 901  DNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960

Query: 958  LSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999
            +SNTN NS QNI+SPKKHAI+DEN SN   D E SRKI KTE
Sbjct: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/939 (51%), Positives = 625/939 (66%), Gaps = 50/939 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS EVSINTTGD GITAQ+N+K YTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL            E    +KL
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQ--------EIASSRKL 184

Query: 213 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXXXXXXXXXX 272
           RIFD                           +   P A  LRKR +T             
Sbjct: 185 RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP----------- 233

Query: 273 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEFHITNAMEGL 332
                                         +S     DQ+ GIYIQNLQ+FHITNA EG+
Sbjct: 234 ---------------------------SVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGI 266

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRS 392
            LLQ+GLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+RS
Sbjct: 267 KLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRS 326

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIAT 452
           GA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIAT
Sbjct: 327 GAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIAT 386

Query: 453 ISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSK 512
           ISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKDILVKNIT ELAKIK+DLLSTKSK
Sbjct: 387 ISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSK 446

Query: 513 EGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQNSQME 572
           EGIYMSQD+YK L +DLESYK EV+ECKR IE                      Q  +++
Sbjct: 447 EGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQ 506

Query: 573 SLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHIS 632
           +++  ++ L ++ +KQ+K E  +    + L+     MQ  +++++RRE D+  K     +
Sbjct: 507 NMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFN 566

Query: 633 KEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKK 692
            E   +K T+ S +  +EQ    +   +Q N+D I+ E+  L+E  Q++ + MYKDCV+K
Sbjct: 567 NEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEK 626

Query: 693 ILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQEL 752
           IL+E+P  F +  EK+  +       + ++ ENLSD+SEE NNL+QYL +HFFKNNH+E+
Sbjct: 627 ILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEI 686

Query: 753 LNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 812
           L  HID TY  I+    +  + FK  +++HLE+NK L++++L  AT  VI +EM LFEP+
Sbjct: 687 LVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQ 746

Query: 813 RVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENA 872
           + KWE+SF  INKCDS+N  F N + + L  IK+T+ +S  ++NK+I+ +K Q++E E+ 
Sbjct: 747 KKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHESP 806

Query: 873 VSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKE 932
            S               +NK ++L ++++ S+  T  H   +D + + I++++   G+  
Sbjct: 807 ASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSM 866

Query: 933 NAVKNEMIDNILKEIPSLS----KRVPLRLSNTNGNSAQ 967
              + E +D IL+ +   +     R PLR +N   N ++
Sbjct: 867 EGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNKSE 905

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/658 (49%), Positives = 458/658 (69%), Gaps = 17/658 (2%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  +G+YIQNLQ+FHIT+A +GL LLQ+GL++RQVA+TKMNDFSSRSHTIFTITLY++HQ
Sbjct: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            E+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+LADKS H+PFR
Sbjct: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 549
           ILVKNIT ELAK+KSDLLSTK +EG+YMSQD+YK + +DLESYK E+QE KR IE     
Sbjct: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 550 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609
                          + Q  +++++K  ++ L  +L+ QHK E E+      L+    + 
Sbjct: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNI-------SQETNIQP 662
           Q  +++Y +RE  ++++ +  + +E    +  L + +  +  N+         ++  IQ 
Sbjct: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631

Query: 663 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 722
           NL++++ EV+ L+   Q++AE MYKD ++KIL E+P  F  I  K+D + V    ++  +
Sbjct: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691

Query: 723 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 782
            ENLSDISE  NNLKQY  +HFFKNNH+E+LN HID TY+ ++      ++ FK  ++DH
Sbjct: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751

Query: 783 LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLS 842
           L++NK L+M++L +AT+  I++EM LFEP+R KWE SFDLIN CDS++N F  +M + LS
Sbjct: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811

Query: 843 QIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIEN 902
            IK+T  +S++ +++S+S +K +V+  E+A +               +NK + L++ +  
Sbjct: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871

Query: 903 SITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSL---SKRVPLR 957
           SI S+  HI+  D++ + I N + +    EN+  ++   N +   P L   S+R PL+
Sbjct: 872 SIKSSQGHISAFDELKERIRNTIAS----ENSTLHQ---NKIATTPPLGQNSERSPLK 922

 Score =  278 bits (711), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 153/188 (81%), Gaps = 8/188 (4%)

Query: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           G   EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS EV+INTT D GITAQMN+K 
Sbjct: 9   GEDAEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKT 68

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y VDKVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN E
Sbjct: 69  YAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDE 128

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPF 208
           LSD+AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD           E   
Sbjct: 129 LSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--------DSVENSS 180

Query: 209 MKKLRIFD 216
           M+KLRI+D
Sbjct: 181 MRKLRIYD 188

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/633 (52%), Positives = 444/633 (70%), Gaps = 14/633 (2%)

Query: 304 SSMA-PNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 362
           SS+A P++ +NGIYIQNLQEFHITNA EGL+LLQ+GLKHRQVASTKMNDFSSRSHTIFTI
Sbjct: 289 SSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTI 348

Query: 363 TLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK 422
           TLYK+H+D LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LADK
Sbjct: 349 TLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADK 408

Query: 423 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           S H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL
Sbjct: 409 SPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 468

Query: 483 GAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRD 542
           G+ I+KDIL+KNIT ELAK+KSDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR 
Sbjct: 469 GSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRM 528

Query: 543 IEXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKL 602
           IE                    + Q  ++ +LK +++ L  +L+ Q+  E ++     +L
Sbjct: 529 IEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQL 588

Query: 603 QKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQP 662
           +K  E +   +++Y+ ++  L  +    +++ +  LK  L S    + Q+      +++ 
Sbjct: 589 EKSREKLNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQS--EGNFDVEM 646

Query: 663 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNI 722
           NL +IK+E+ +++E  Q K E+MYK+ +++ L ++P     I E +  +      +YN I
Sbjct: 647 NLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEI 706

Query: 723 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDH 782
            ENLSDISEE NNLKQYL N FF+NNH++LLN HI++T + + + ++E    FK  ++ H
Sbjct: 707 TENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAH 766

Query: 783 LEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLS 842
           L ENKKL++ N   AT+ VI +EM+LF+PKR KWE S +LIN+CDS+NN F++NM   +S
Sbjct: 767 LMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVS 826

Query: 843 QIKNTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKH--------T 894
           +IK  + +SS+S++ +I+ +K QV E    +S                NKH         
Sbjct: 827 KIKTNLASSSSSIHNAIASIKSQVLEQ---LSNDDSDVKTALENDPMFNKHFNEIIEKNM 883

Query: 895 ILKDNIENSITSTHSHITNIDDIYDTIENIMKN 927
           IL+ N +N+I  T   + NID++ +T++  + N
Sbjct: 884 ILQKNRKNAINYTDKSLLNIDELSETVKIALNN 916

 Score =  279 bits (714), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 139/194 (71%), Positives = 156/194 (80%), Gaps = 13/194 (6%)

Query: 34  ELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDK 93
           ELNITVAVRCRGRNEREI  KS VVV VPDITG++E+SINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LSD 151
           VFGP A QDLIF EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 152 AAGIIPRVLLKLFDTLELQQN--------DYVVKCSFIELYNEELKDLLDXXXXXXXXXG 203
           AAGIIPR+L KLFDTL+  ++        D+VVKCSF+ELYNE+LKDLL+          
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 204 FE-GPFMKKLRIFD 216
            + G   +KLRIFD
Sbjct: 208 QQLGS--RKLRIFD 219

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 405/558 (72%)

Query: 308 PNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK 367
           P DQS  IYIQNL+EFHIT+AMEGL LLQ+GLK RQVASTKMNDFSSRSH+IFTITLYK+
Sbjct: 302 PIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKE 361

Query: 368 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIP 427
              ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+LADKS HIP
Sbjct: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421

Query: 428 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIM 487
           FRESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIM
Sbjct: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481

Query: 488 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXX 547
           KDILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IE   
Sbjct: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLT 541

Query: 548 XXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTE 607
                                + + SLK  +  L++ L +Q   E  I      +Q   E
Sbjct: 542 AQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANE 601

Query: 608 IMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDII 667
            M+  +  ++ ++ +L +   T IS EI +++ TL   +  ++ N   ++T I  NL  +
Sbjct: 602 EMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRL 661

Query: 668 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLS 727
           + EV+ +++  +E+A   Y +CVK +L E+P+ F  +  ++D I    +  ++ IAE LS
Sbjct: 662 EKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLS 721

Query: 728 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENK 787
           D+SEE NNLKQYL N+FFKNNH+ELL+HH+ +TY  +E+ +++ ++NF   L+ H++ENK
Sbjct: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781

Query: 788 KLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNT 847
           + +++N+   T  VIN E+ +F  +R KWE S  LIN+CDS+N+ F+  + + L +I++ 
Sbjct: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841

Query: 848 VDTSSNSMNKSISVMKGQ 865
           V +S +++  +IS ++ +
Sbjct: 842 VSSSRDNIGATISSIQSR 859

 Score =  287 bits (734), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 151/187 (80%), Gaps = 6/187 (3%)

Query: 30  VPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRY 89
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + EVSINTT D GI A+MN+K Y
Sbjct: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86

Query: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149
           TVDKVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146

Query: 150 SDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFM 209
            DAAGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD                
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200

Query: 210 KKLRIFD 216
           KKLRIFD
Sbjct: 201 KKLRIFD 207

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/687 (47%), Positives = 437/687 (63%), Gaps = 21/687 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           ++QS+ IYIQNLQEFHITNA +G+NLLQRGLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 548
           DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE+YK EVQECKR+IE    
Sbjct: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 549 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608
                           + Q  +++ L   I  L  ++DKQHK E ++    + L+     
Sbjct: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668
           +Q +L++ +  +L    + E  +   + S K ++  QL+ M+ ++ S+   I  N+DII+
Sbjct: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728
            E+  ++E++   +  + + CV+KIL  +PK F  I   +  I      + N + +NL D
Sbjct: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788
           ISEE NN ++YL  H FKNNH+E L+ H+D TY  ++K   E    FK  ++ HLEENK 
Sbjct: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848
           L++++L  A+  V+ +E+ LF P + KWE+S + INKCDS+NN F + +   L +++  +
Sbjct: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 849 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 908
           + S      +   +K  +++ +                     KHT L+D +E     T 
Sbjct: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVER----TS 850

Query: 909 SHITNIDDIYDTIENIMKN----------YGNKE--NAVKNEMIDNILKEIPSLSKRVPL 956
           S+I   ++ ++ I+  ++            GN E  N +  ++    LK I S S R P 
Sbjct: 851 SYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSAS-RTPS 909

Query: 957 RLS----NTNGNSAQNILSPKKHAIDD 979
             S     T  N+  N +SP K  +D+
Sbjct: 910 SRSVSPMKTLDNNIFNGISPSKRKVDE 936

 Score =  296 bits (757), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 153/184 (83%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           E   +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186

Query: 213 RIFD 216
           RIFD
Sbjct: 187 RIFD 190

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/620 (50%), Positives = 424/620 (68%), Gaps = 6/620 (0%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D +NGIYIQNLQEFHI+NA EGL LLQ+GLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400

Query: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+LAD++ HIPF
Sbjct: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I K
Sbjct: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520

Query: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 548
           DIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE    
Sbjct: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580

Query: 549 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608
                           + Q  ++   + +IN L+ +++ Q+  E  +    +KLQ   + 
Sbjct: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640

Query: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668
            +  +++Y+ +++D+  K E  +  ++ SL+  L    + ++  N   + +I  NLD+I+
Sbjct: 641 FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQ 700

Query: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  Q  +  +A+NLSD
Sbjct: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760

Query: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788
           ISEE NNLKQYL  + F+NNH++L+N HI+ST + +          FK+ +N HLE N+ 
Sbjct: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820

Query: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848
           L++ +   AT  VIN+EM+LF P++ KWE S DLIN+CDS+NN F   +   LS  ++ +
Sbjct: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880

Query: 849 DTSSNSMNKSISVMKGQVEE------SENAVSXXXXXXXXXXXXXXXVNKHTILKDNIEN 902
             S N M  + + +K ++        S N  +                 K++I +DN+EN
Sbjct: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940

Query: 903 SITSTHSHITNIDDIYDTIE 922
           S+    + + N++ + D+I+
Sbjct: 941 SLKCAVASVNNLNHLEDSIK 960

 Score =  295 bits (754), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 135/159 (84%), Positives = 145/159 (91%)

Query: 35  LNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           LNITVAVRCRGRNEREI +KSSV+V VPDI GS EVSINTT D GITAQMN+K YTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           FGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 155 IIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
           IIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+LKDLL+
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLN 210

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/621 (48%), Positives = 431/621 (69%), Gaps = 4/621 (0%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D+  GIYIQNL+EFHIT+A EG+ LLQRGL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 549
           ILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECKR I+     
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 550 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609
                            Q  +++S+K +I+ L   ++KQH+ E  +     KL+  +  M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669
           Q  ++ +  RE     K +   ++E+  LK+ L   L  + +  +   T++  N++ IK+
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD-FQRFYN-NIAENLS 727
           EV ++++T Q +A  +YKDC+++++ ESP     + +  DII++      YN  ++ ++S
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKMQKISDLYNEQLSISIS 715

Query: 728 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENK 787
           +++ E+N+LKQYL   FFK++H+E+LN HI+ TY++I + ++  VE  K  L  +LEE++
Sbjct: 716 ELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESR 775

Query: 788 KLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNT 847
            +I+ +L N TS ++  EM+LF PK+ KWE+SF++INKCDS+NN+++ +++  LS +K +
Sbjct: 776 NIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTS 835

Query: 848 VDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITST 907
           V ++S+ ++  +S M+   + +  +                 + K++ L+ ++  SIT  
Sbjct: 836 VTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMN 895

Query: 908 HSHITNIDDIYDTIENIMKNY 928
            S I   D + ++I +  + Y
Sbjct: 896 ESSINAFDKLSESIHSAFEKY 916

 Score =  280 bits (715), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 150/184 (81%), Gaps = 7/184 (3%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS E++INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD                KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183

Query: 213 RIFD 216
           RIFD
Sbjct: 184 RIFD 187

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/680 (46%), Positives = 440/680 (64%), Gaps = 14/680 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+QS+ IYIQ+LQEFHIT+A EGL LLQ+GL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPF
Sbjct: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 548
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +R+IE    
Sbjct: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 549 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608
                         TI+SQ  Q+ +L+ +++ L  ++D +HK E+E++    KL+     
Sbjct: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668
           MQ AL+ ++  E  L    +  +   I   +  + ++L  ++Q  + Q   I  +++ +K
Sbjct: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSD 728
           + + TL+ET+++ A +M ++  +K++ + PKFFN ++ +++ +        + + E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 729 ISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKK 788
           I+ ENNNLK YL  HFF+NNHQE+LN H D TY  +   +   +    N ++DH+E+N+ 
Sbjct: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 789 LIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTV 848
           L+M  L  AT+ VI QEM  FEP R  WE SF+ IN CDS++N+F ++   +L+ +K+ +
Sbjct: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 849 DTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTH 908
           +++    +     +K  +   ++                   NKH++L+D +E +++  H
Sbjct: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862

Query: 909 SHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSK-------RVPLRL--- 958
           +       I  +++ IM N+   E   +  + D+++K I S S        + PLR    
Sbjct: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKTET-LADDLIKHIDSSSVAPVASSGKTPLRPLLK 920

Query: 959 SNTNGNSAQNILSPKK--HA 976
           S T   S    +SP K  HA
Sbjct: 921 SETKQRSLSKSVSPAKSSHA 940

 Score =  296 bits (757), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 138/192 (71%), Positives = 158/192 (82%), Gaps = 7/192 (3%)

Query: 26  GCHGVP-NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQM 84
             +G P  +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ EVSINT+GD GITA+M
Sbjct: 3   ATNGSPEGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARM 62

Query: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 144
           N+K YTVDKVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKL
Sbjct: 63  NSKTYTVDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL 122

Query: 145 YNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGF 204
           Y+GELS+AAGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD           
Sbjct: 123 YDGELSEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSG----- 177

Query: 205 EGPFMKKLRIFD 216
            G   +KLRI+D
Sbjct: 178 -GNNSRKLRIYD 188

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/562 (52%), Positives = 404/562 (71%), Gaps = 11/562 (1%)

Query: 305 SMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
           S   +DQ+ GIYIQNLQEFHIT A EG+ LLQ+GLK+RQVASTKMNDFSSRSHTIFTITL
Sbjct: 280 STIQSDQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITL 339

Query: 365 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 424
           +K+ + E+FR+SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+LADK+ 
Sbjct: 340 FKEVKGEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNV 399

Query: 425 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 484
           H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+
Sbjct: 400 HVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGS 459

Query: 485 FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIE 544
           FIMKDIL+KNIT EL KIKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IE
Sbjct: 460 FIMKDILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIE 519

Query: 545 XXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG----FNN 600
                               + Q  +++++  ++ +L A++++Q   E E+ G    F  
Sbjct: 520 SLTSQNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTK 579

Query: 601 KLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNI 660
              KLT+I    + + K RE  +N KF+T +   +  +   L  Q+   +   I+Q   +
Sbjct: 580 TNSKLTKI----IDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTV 635

Query: 661 QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYN 720
             NL +IK+E+  L+ T ++  E  Y++C+ K L+++P  F+ I + +  ++     +Y+
Sbjct: 636 DENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYS 695

Query: 721 NIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 777
            IAENLSD+SEE NN KQ++ + F+   K +  ELLN +I++T   IE  +++ +   +N
Sbjct: 696 QIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQN 755

Query: 778 TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 837
            LN+HL  NK+LI+ +L+N T+ +++ E+D  +PK  KWE S +LIN+ D++NNEF +N+
Sbjct: 756 LLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNV 815

Query: 838 ATTLSQIKNTVDTSSNSMNKSI 859
            ++++ + + +  +++S+N +I
Sbjct: 816 ESSMTTMTDKIKQTNDSINNNI 837

 Score =  286 bits (732), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 151/184 (82%), Gaps = 6/184 (3%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GS+EV+INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL             G F KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDN-----GNF-KKL 188

Query: 213 RIFD 216
           RIFD
Sbjct: 189 RIFD 192

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  543 bits (1400), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/678 (44%), Positives = 428/678 (63%), Gaps = 8/678 (1%)

Query: 306 MAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLY 365
           ++P + S+ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LY
Sbjct: 229 VSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288

Query: 366 KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH 425
           KK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS H
Sbjct: 289 KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348

Query: 426 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAF 485
           IPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+F
Sbjct: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408

Query: 486 IMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEX 545
           IMKD+L+K++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE+YK EV+ECKR +E 
Sbjct: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468

Query: 546 XXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKL 605
                              +SQ  ++  L   I  L  ++D+QHK E E+S    +L + 
Sbjct: 469 VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528

Query: 606 TEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLD 665
              MQ +L+ Y+ +    + + E  +   I S K +L  ++  ++ N      +++ N+D
Sbjct: 529 LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVD 588

Query: 666 IIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAEN 725
            +  E+  + + M      ++++ +KK+ +++P +F  I  +++ I      + +N+  +
Sbjct: 589 AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIH 648

Query: 726 LSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEE 785
           LS ISEE NNLK YL  HFFKNN QE L+ H+D TY  ++   +      +  LN+ L+ 
Sbjct: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708

Query: 786 NKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIK 845
           NK+ +MQ+L +A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I 
Sbjct: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768

Query: 846 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSIT 905
            T+D    +   +    K ++     A S                 KH +LK  +++S  
Sbjct: 769 KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828

Query: 906 STHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEI--PSL-----SKRVPLRL 958
              +      +I ++I++++      +   +N  ID +L+++   SL     S + P+R 
Sbjct: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENP-IDGLLEQLNDKSLKPLGPSGKTPMRT 887

Query: 959 SNTNGNSAQNILSPKKHA 976
              +  +   +L P+K +
Sbjct: 888 VQRSVTNTDQLLPPQKSS 905

 Score =  292 bits (748), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKK 211
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           +    KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175

Query: 212 LRIFD 216
           LRIFD
Sbjct: 176 LRIFD 180

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  530 bits (1366), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/560 (48%), Positives = 391/560 (69%), Gaps = 7/560 (1%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373
           GIYIQNL++FHI+ A EGL LLQRGL+ RQVA+TK+ND SSRSHTIFTITLYKK +D+L+
Sbjct: 269 GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 433
           R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+LADKS HIPFRESKL
Sbjct: 329 RLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKL 388

Query: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 493
           TRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+FI+KDIL+K
Sbjct: 389 TRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLK 448

Query: 494 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXX 553
           +++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K E+ E KR  +         
Sbjct: 449 DVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELL 508

Query: 554 XXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI---MQ 610
                       S  S++++L+   +QLK+  +K  +T  + +  + ++  +  I   ++
Sbjct: 509 GKEKKSGAERADSLKSELDNLR---SQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELK 565

Query: 611 LALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNE 670
             ++ Y+++      KF+  +  E+ +L   + SQ   ++  N S    I  ++D I+ E
Sbjct: 566 SLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGE 624

Query: 671 VLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDIS 730
           V+ L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  +A N SD+S
Sbjct: 625 VMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLS 684

Query: 731 EENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLI 790
           EE N  KQYL   FF+NNH E++  H D    +++K + + +++ +N++ ++L  N +++
Sbjct: 685 EEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMV 744

Query: 791 MQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 850
             ++ +    VIN+EMDLF PK+ KWE S DLIN+ DS++N+F NNM  ++  I + +  
Sbjct: 745 TNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRN 804

Query: 851 SSNSMNKSISVMKGQVEESE 870
           S+ SM++SIS +K  + E++
Sbjct: 805 SNESMDRSISTIKKHIIEND 824

 Score =  219 bits (559), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 150/210 (71%), Gaps = 14/210 (6%)

Query: 17  ISNNLNAQIG-CHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTT 75
           + N+   +IG    +  +++NITVAVRCRGRN+REI  KS +VV VPD+T + EVSINT+
Sbjct: 6   LGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTS 65

Query: 76  GDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKT 135
           G +GI AQ+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKT
Sbjct: 66  GGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKT 125

Query: 136 YTMTGD-EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDX 194
           YTMTGD E    G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DLL  
Sbjct: 126 YTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLL-S 181

Query: 195 XXXXXXXXGFEGP--------FMKKLRIFD 216
                   G E            KKLRIFD
Sbjct: 182 EGQDDFSNGTENSSKQPESLNASKKLRIFD 211

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  511 bits (1316), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 288/674 (42%), Positives = 419/674 (62%), Gaps = 15/674 (2%)

Query: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 372
           + I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESK 432
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFRESK
Sbjct: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354

Query: 433 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 492
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414

Query: 493 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXX 552
           KN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE+YK EVQECKR IE        
Sbjct: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474

Query: 553 XXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLA 612
                       +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +    MQ +
Sbjct: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534

Query: 613 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQ---LSGMEQNNISQETNIQPNLDIIKN 669
           L+ Y+ +      + E  + + I S K +L ++   L G E++      ++  N+D +  
Sbjct: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF----DVDANIDTLTK 590

Query: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729
           E+  + + +      + +  + KI  ++P +   I  +++ I      + +++  +LS I
Sbjct: 591 ELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSI 650

Query: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789
           SEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   +      +  +N+ LE NK++
Sbjct: 651 SEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEI 710

Query: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849
           +MQ+L NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + +  +   ++
Sbjct: 711 MMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKIN 770

Query: 850 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 909
                   ++      +   ++A                   KH +LK  +++S +   +
Sbjct: 771 EGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEA 830

Query: 910 HITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEI---P----SLSKRVPLRLSNTN 962
                 +I D+I+ ++ +    +   +N  I+ +L+++   P      S + P+R++   
Sbjct: 831 ATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGC 889

Query: 963 GNSAQNILSPKKHA 976
             S+  +  P+K +
Sbjct: 890 IASSDQLSLPRKRS 903

 Score =  289 bits (740), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 152/184 (82%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           +    +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176

Query: 213 RIFD 216
           RIFD
Sbjct: 177 RIFD 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  509 bits (1311), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/595 (45%), Positives = 395/595 (66%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           +QS+ IYIQNLQEFHITNA EG+++LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 549
           ILVK+I+ EL+K+KSD LSTK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR +E     
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 550 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609
                          + Q+ ++  L+ TI  L  ++++QH+ E+++    +KL++    M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669
           + +LQ+Y+  EL L    +  + + I S + ++   L  ++   + +  +I  N+D I+ 
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729
                +++++     M  + VK + ++    +    E +  +    Q +   +   L+++
Sbjct: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789
           +EENNN+K+YL  HF KNN+QE+L+  ++  Y   +  +   + +  + +  H+EE++ L
Sbjct: 662 TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849
           ++ ++ +A S +I++E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K   D
Sbjct: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 850 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSI 904
            S  + +     ++  V   E  V                 +KH +L+D+ EN+I
Sbjct: 782 NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNI 836

 Score =  291 bits (745), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (82%), Gaps = 12/186 (6%)

Query: 32  NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS EVSINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGP-FMK 210
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD           + P + K
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLD-----------DTPDYSK 186

Query: 211 KLRIFD 216
           +LRIFD
Sbjct: 187 RLRIFD 192

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  513 bits (1322), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 291/586 (49%), Positives = 388/586 (66%), Gaps = 22/586 (3%)

Query: 304 SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 363
           S  AP D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 324 SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382

Query: 364 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
           LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+LADKS
Sbjct: 383 LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 543
           +FIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 503 SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562

Query: 544 EXXXXXXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 603
           E                    + Q  Q+E     I +L   LD+ +K E  +     +L+
Sbjct: 563 ERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLK 622

Query: 604 KLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS-------- 655
            +   MQ  +++Y+ R+L++ +  +  +  E K LK  L   LS +  N I         
Sbjct: 623 NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIIS 682

Query: 656 --------QETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 707
                     +N Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 683 NNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740

Query: 708 IDIIRVDFQR--FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 765
           I+I  +DFQ    +N I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE
Sbjct: 741 IEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIE 800

Query: 766 KKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK 825
             ++  + N    +N+    N KL  + L N  + ++ +E +  +P + KW  S ++IN 
Sbjct: 801 SFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINS 860

Query: 826 CDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK-GQVEESE 870
            D +NN F+N+M   + QI N +  S N +N SI+ +K  ++ E+E
Sbjct: 861 TDKINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENE 906

 Score =  289 bits (740), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (82%), Gaps = 9/184 (4%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSD+
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD                KKL
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT---------YKKL 179

Query: 213 RIFD 216
           RIFD
Sbjct: 180 RIFD 183

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  500 bits (1287), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 268/597 (44%), Positives = 393/597 (65%), Gaps = 2/597 (0%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301

Query: 369 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPF 428
             ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADKS HIPF
Sbjct: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 488
           RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MK
Sbjct: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421

Query: 489 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXX 548
           DILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR IE    
Sbjct: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481

Query: 549 XXXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI 608
                           + QNS+++ L+ TI  L  ++++QH  E E++   +KL++    
Sbjct: 482 QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541

Query: 609 MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIK 668
           MQ +L+ Y+  EL L    +  + + I S + ++   L  ++ + + +  +I+ N++ I 
Sbjct: 542 MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601

Query: 669 NEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNVIVEKIDIIRVDFQRFYNNIAENLS 727
                 +++++     M  D + K++ E+P  +     E +  ++ +   + N +   L+
Sbjct: 602 TIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLT 660

Query: 728 DISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENK 787
           +ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  + + +    + +  H+EE++
Sbjct: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720

Query: 788 KLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNT 847
            L++ ++ +  + +I+ E  LF+P R +W  S D IN+CD+ +  F     + L ++K  
Sbjct: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780

Query: 848 VDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSI 904
            D S  S   +++  K + +   + V                 +KH +L+D+ ++++
Sbjct: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNV 837

 Score =  285 bits (729), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 149/184 (80%), Gaps = 10/184 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKL 212
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD                K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188

Query: 213 RIFD 216
           RIFD
Sbjct: 189 RIFD 192

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  498 bits (1283), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/620 (43%), Positives = 402/620 (64%), Gaps = 8/620 (1%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373
            IYIQNL+EFHI NA EG+ LLQ+GLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKL 433
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ADK+ HIPFRESKL
Sbjct: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356

Query: 434 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 493
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416

Query: 494 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXX 553
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++         
Sbjct: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476

Query: 554 XXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTEL----EISGFNNKLQKLTEIM 609
                      + Q   +  +  T++ ++  L+ QHK E     E++    K  K    M
Sbjct: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK----M 532

Query: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669
           +  +++Y  +E  +    ++  + E+  LK  L   L+G+ + N+  +TN++ N+ +IK+
Sbjct: 533 KTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKD 592

Query: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729
           +V++++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I
Sbjct: 593 DVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESI 652

Query: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789
            ++ + L +Y  N FFK+NH  ++N H+++T   IEK  S+  + F+  +    E+N+KL
Sbjct: 653 KQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKL 712

Query: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849
           I++NL   +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + 
Sbjct: 713 ILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQ 772

Query: 850 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 909
           +S   + K ++ +K  V+   +                  ++K   L D+++ S+ ST +
Sbjct: 773 SSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQN 832

Query: 910 HITNIDDIYDTIENIMKNYG 929
            +   D+I  +I+    NY 
Sbjct: 833 SLLVFDEICKSIQFAFANYS 852

 Score =  276 bits (707), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 128/186 (68%), Positives = 153/186 (82%), Gaps = 11/186 (5%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGD--TGITAQMNAKRYT 90
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS E+SINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMK 210
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL                +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183

Query: 211 KLRIFD 216
           KLRIFD
Sbjct: 184 KLRIFD 189

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  416 bits (1070), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 243/711 (34%), Positives = 412/711 (57%), Gaps = 22/711 (3%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           +++   YIQNL+EFHITNA EG+ LL RGLK+RQ+AS+K   +SSR+ TIFTI LYK+ +
Sbjct: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311

Query: 370 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            E+FR+SK N VDLAG+E+ ++    NQR K+   INQ +  L +++N+L +K   IPF+
Sbjct: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK 371

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+
Sbjct: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXX 549
            L+K+I+ ELAK+KSDLLSTKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+     
Sbjct: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491

Query: 550 XXXXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIM 609
                          + Q  +++S++ +++ +   ++KQ + E ++    +KL++    M
Sbjct: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551

Query: 610 QLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKN 669
            + +  Y  RE  +  + +T  ++E+  LK+ L   L   E+N +     I+ NL+    
Sbjct: 552 NVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHE 611

Query: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729
           E+  +++  + + + ++ DC+KK+  ESPK F+  ++ +  +       YNN+AE LSD+
Sbjct: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDV 671

Query: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789
           SEE NNLKQY+   FFKNNH+ELL  +++ TY  ++K + +F+  F + L  +LE NK +
Sbjct: 672 SEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSV 731

Query: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849
           ++QN+ +ATS VI  EM+ F P++ KWE S +LI K    +NEF       + ++++T+ 
Sbjct: 732 LLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLK 791

Query: 850 TSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHS 909
            +S S+  ++S MK ++ E + A +               + K+ ILKD +  ++TST  
Sbjct: 792 GTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEE 851

Query: 910 HITNIDDIYDTIENIMKNYGNKE----NAVKNEMIDNILKE--IPSLSKR-VPLRLSNTN 962
            I   D + D+I N+ KN  +       ++  E+ D + ++   P++  R  P+R S + 
Sbjct: 852 SIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVSP 911

Query: 963 GNSAQNILS---------------PKKHAIDDENPSNEITDGEESRKIQKT 998
             ++  I S                 KH++D  +  ++I +G   +++ + 
Sbjct: 912 SRTSPQIQSLMNSDLLQFNEARSFAVKHSLDKAHDEDKIDEGSSKKRVHRA 962

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 109/194 (56%), Gaps = 23/194 (11%)

Query: 29  GVPNE-ELNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSEEVSINTTG-DTGITAQM 84
           GV ++ E NI V  R +G+  NE+   ++  +++  P +       I   G D  +    
Sbjct: 6   GVKDKVECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-------IKFKGKDDAV---- 54

Query: 85  NAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-K 143
             + + +D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  
Sbjct: 55  -KREFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDS 113

Query: 144 LYNGELSD-AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXX 202
           L + E S  + G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL          
Sbjct: 114 LLHSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLL-----VDQHN 168

Query: 203 GFEGPFMKKLRIFD 216
                 +KKLRI D
Sbjct: 169 SLLSASIKKLRIVD 182

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  398 bits (1023), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 295/917 (32%), Positives = 472/917 (51%), Gaps = 65/917 (7%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNV---PDITGSEEVSIN-TTGDTGITAQMNAKRYTV 91
           NITVAVRCR   + E    S  ++++    D T +E + ++ +TG   I        YT+
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKI--------YTL 60

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNG 147
           D V+G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N 
Sbjct: 61  DAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNA 120

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DXXXXXXXXXGF 204
           E S+  G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL             G 
Sbjct: 121 E-SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGA 179

Query: 205 EGPFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLXX 264
            G   KKLRI D                           N      A++RKR+  +SL  
Sbjct: 180 TGSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPP 235

Query: 265 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSSMAPNDQSNGIYIQNLQEFH 324
                                                  S  + +++ N IYIQNLQE  
Sbjct: 236 NNSISNNTANNNRLSLSRTNSFSDY--------------SLQSSHERLNSIYIQNLQEIT 281

Query: 325 ITNAMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-DELFRISKMN 379
           IT   EG+ ++++GLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++
Sbjct: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341

Query: 380 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQD 439
            V+ AGSE  + + + N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ+
Sbjct: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395

Query: 440 SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVKNITMEL 499
           +  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I K+ L+K ++ EL
Sbjct: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455

Query: 500 AKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXX 558
            K KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I               
Sbjct: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515

Query: 559 XXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLALQDYKR 618
                 + Q  ++++L+ TI+ L   L+KQ K E E+     KL  +   MQ +++ Y  
Sbjct: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSD 575

Query: 619 RELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETM 678
           +E+ L  K +    KE+  LK +L S  + ++        N+  N+D IK E+L +    
Sbjct: 576 KEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQS 635

Query: 679 QEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQ 738
           Q K + +  +   ++L+ SPK+F  +   +  +    +  +N  +E LSDISEE NNL  
Sbjct: 636 QSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNN 695

Query: 739 YLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNAT 798
           Y+ ++F K++H+EL++ +I+ TY +++  + EF ENFK  L+ ++E+N K + +++T+ T
Sbjct: 696 YINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLT 755

Query: 799 SAVINQEMDLFEPKRVKW--------ENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDT 850
           S ++  E+  F P++ KW        EN  + I K  + N+E    +A  LS+  +T + 
Sbjct: 756 SEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEI---LAKLLSESTSTSEL 812

Query: 851 SSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTILKDNIENSITSTHSH 910
             N+M    S +K  VE  E                   +NK+  LKD I ++  S+ + 
Sbjct: 813 FINNM----SSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENS 868

Query: 911 ITNIDDIYDTIENIMKN 927
           I + D++ + ++N+ KN
Sbjct: 869 IDSFDNLKEAMQNVFKN 885

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  254 bits (650), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
           Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  132 bits (333), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 96/164 (58%), Gaps = 16/164 (9%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E +  N +  +  +++   K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 189
            GE    AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK 209

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  254 bits (649), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 8/221 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD 
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 455

 Score =  134 bits (337), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 110/197 (55%), Gaps = 13/197 (6%)

Query: 3   AENQNTIQERSSNNISNNLNAQIG--CH-GVPNEELNITVAVRCRGRNEREIGMKSSVVV 59
           A  + TI    S ++SN ++      C+ G    + NI V VRCR RN+REI  KSSVV+
Sbjct: 16  ANKRRTIAHAPSPSLSNGMHTLTPPTCNNGAATSDSNIHVYVRCRSRNKREIEEKSSVVI 75

Query: 60  NVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKG 119
           +     G E +  N +  +  +++   K Y  D+VFG  + Q+ +F+  A    ++ + G
Sbjct: 76  STLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVFGAESDQETVFNATAKNYIKEMLHG 132

Query: 120 YNCTVLVYGMTSTGKTYTMTGD-------EKLYNGELSDAAGIIPRVLLKLFDTLELQQN 172
           YNCT+  YG T TGKTYTM+GD       +   N  L + AGIIPRVL+ LF  L     
Sbjct: 133 YNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNK 192

Query: 173 DYVVKCSFIELYNEELK 189
           +Y VK SF+ELYNE LK
Sbjct: 193 EYSVKISFLELYNENLK 209

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  254 bits (648), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 109/207 (52%), Gaps = 22/207 (10%)

Query: 26  GCHGVP---------NEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTG 76
           G H VP           E NI V VRCR RN REI  KSSVV++     G E +  N + 
Sbjct: 33  GKHPVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSH 92

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
            +  +++   K Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTY
Sbjct: 93  QSYSSSK---KTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTY 149

Query: 137 TMTGD-------EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 189
           TM+GD       +   N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 150 TMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLK 209

Query: 190 DLLDXXXXXXXXXGFEGPFMKKLRIFD 216
           DLL                 K++RIFD
Sbjct: 210 DLLSDNEDDDPTANDSK---KQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  254 bits (648), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 168/221 (76%), Gaps = 8/221 (3%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ ++ I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 369 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL 
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 421 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD 
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 454

 Score =  136 bits (342), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 98/164 (59%), Gaps = 10/164 (6%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E +  N +  +  +++   K Y  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 107

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-------EKLYNGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE LKDLL
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLL 211

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  251 bits (640), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/227 (55%), Positives = 170/227 (74%), Gaps = 7/227 (3%)

Query: 307 APNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT--- 363
           +PN  S  I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT   
Sbjct: 245 SPNGYS--IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNV 302

Query: 364 --LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
             ++    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D
Sbjct: 303 TKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 362

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 481
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 363 HSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQ 422

Query: 482 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD 528
           +   + K+  +     E+ +++ +L ++ SKEGIY++Q+ ++   S+
Sbjct: 423 VNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESN 469

 Score =  148 bits (374), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 113/200 (56%), Gaps = 23/200 (11%)

Query: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           G P  E NI V VRCR RNEREI  KSSVV++     G E   I T   TG     + K 
Sbjct: 49  GEP--EYNIKVYVRCRSRNEREIREKSSVVISTLGNNGRE--VILTNPGTG-----SNKT 99

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D+VFG  + Q+ +F++VA     + I+GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 100 YTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSS 159

Query: 149 --------LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL----DXXX 196
                   LS+ AGIIPRVL++LF  L     DY VK SF+ELYNE+L+DLL    D   
Sbjct: 160 EDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSL 219

Query: 197 XXXXXXGFEGPFMKKLRIFD 216
                 G   P  + +RI+D
Sbjct: 220 EDHNFNGMAPP--ESIRIYD 237

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  250 bits (639), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 162/216 (75%), Gaps = 5/216 (2%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD- 370
           S+ I ++ ++E +I +A EGL LL  G   RQVASTK ND SSRSHT+FTIT      D 
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 371 ----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 426
               E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 427 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 487 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
            KD  +     E+ +++ +L +T++K+GIY++Q+ Y
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  148 bits (373), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 102/167 (61%), Gaps = 10/167 (5%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REIG KSSVV++     G + +  N +  +  +     K YT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+++F+ VA     + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 149 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
              LS+ AGIIPRVL+ LF  L+ +  DY VK SF+ELYNE LKDLL
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLL 220

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  246 bits (629), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/225 (54%), Positives = 165/225 (73%), Gaps = 5/225 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT----- 363
           N   + I ++ ++E +I +A EGL LL  G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 364 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
           ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD 528
             + K+  +     E+ K++ +L +  +KEGIY++++ Y+   S+
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESN 473

 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 104/172 (60%), Gaps = 15/172 (8%)

Query: 29  GVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           G   +  NI V VRCR RN REI  KSSVVV+     G E +  N +  TG     N K 
Sbjct: 49  GSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKT 101

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D+VFG  + Q+ +FD+VA     + ++GYNCTV  YG T TGKTYTM+GD  +    
Sbjct: 102 YTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGAS 161

Query: 149 LSDA--------AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L D         AGIIPRVL++LF  L+ +  DY VK SF+ELYNE+L+DLL
Sbjct: 162 LEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  246 bits (629), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/220 (56%), Positives = 161/220 (73%), Gaps = 5/220 (2%)

Query: 307 APNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK 366
           A N   + I ++ ++E +I +A EGL LL  G   R+VASTK+ND SSRSHTIFTI    
Sbjct: 332 ASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNV 391

Query: 367 KHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
              D        +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D
Sbjct: 392 TKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 451

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 481
           +S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 452 RSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQ 511

Query: 482 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
           +   + KD  +     E+ +++++L   ++KEGIY++QD 
Sbjct: 512 INQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  119 bits (299), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 102/223 (45%), Gaps = 69/223 (30%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEV----------SINTTGDTGITAQ-- 83
           NI V VRCR R +REI  KSSVV++     G++ +          + N  G T       
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 84  ---------------MNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 128
                           N + YT DKVFG  + Q+ +F+ VA     + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 129 MTSTGKTYTMTGD----------EKLYNGELSDAAGIIPRVLLKLFDTLE---------- 168
            T TGKTYTM+GD          +K+  GE    AGIIPRVL+ LF  L           
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKELSKNDTITNTKV 227

Query: 169 -------------------LQQNDYVVKCSFIELYNEELKDLL 192
                              L+  +Y VK SF+ELYNE+L DLL
Sbjct: 228 NNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  244 bits (622), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/214 (56%), Positives = 162/214 (75%), Gaps = 5/214 (2%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 370
           I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT      D    
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 371 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 523
             +     E+ +++ +L +++ KEG+Y+++D ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  149 bits (377), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 103/167 (61%), Gaps = 17/167 (10%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           N+ V VRCR RNE+EI  KSSVV++     G E +  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +FDEVA     + ++GYNCTV  YG T TGKTYTM+GD          +K+ 
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            GE S   GIIPRVL+ LF  L  + N+Y VK SF+ELYNE+LKDLL
Sbjct: 157 LGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL 200

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  239 bits (611), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 159/213 (74%), Gaps = 5/213 (2%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 370
           I ++ ++E +I +A EGL LL +G   R+VA+TK ND SSRSHTIFTI  +    D    
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 371 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR 429
            +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINAL + S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 489
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 490 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
             +     E+ +++ +L +++ +EG+Y++Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 13/165 (7%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVVV+     G   +  N +           K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKKTYMFDEVF 99

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 149 -LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            L + AGIIPRVL+ LF  L  +  ++ VK SF+ELYNE LKDLL
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLL 203

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  239 bits (611), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 159/218 (72%), Gaps = 5/218 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+ S+ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 369 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
            D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 521
             + KD  +     E+ +++ +L +++ K+GI ++QD 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/164 (47%), Positives = 99/164 (60%), Gaps = 12/164 (7%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR R+EREI  KSSVV++     G++ +  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGE------ 148
           G  + Q+ +F++ A     + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL+ LF  L L +NDY VK SF+ELYNE LKDL 
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNERLKDLF 266

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  238 bits (607), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 161/216 (74%), Gaps = 5/216 (2%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 366
           S+ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 367 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI 426
              ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINAL D + HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 427 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 487 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
            KD  +     E+ +++ +L +++ K+GI ++QD +
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQF 454

 Score =  139 bits (349), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 99/164 (60%), Gaps = 12/164 (7%)

Query: 37  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFG 96
           I V VRCR RNEREI  KSSVV++     G+ + +     +  +      + YT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 97  PGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE-------- 148
             + Q+ +F++ A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE LKDLL
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLL 220

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  234 bits (597), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 122/219 (55%), Positives = 163/219 (74%), Gaps = 5/219 (2%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           N+  + I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHTIFTIT     
Sbjct: 248 NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITK 307

Query: 369 QD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
            D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVINAL D S
Sbjct: 308 IDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHS 367

Query: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+ 
Sbjct: 368 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQIN 427

Query: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 522
             + KD+ +     E+ +++ +L +++ K+G+Y++Q+ +
Sbjct: 428 QSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 96/167 (57%), Gaps = 17/167 (10%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G E V      D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQGKEVV----LSDPSSVLSHTKKTYIFDQVF 114

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+++F+  A     + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            GE    AGIIPRVL+ LF  L  +  +Y VK SF+ELYNE LKDLL
Sbjct: 175 LGE---HAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL 218

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  184 bits (467), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 133/198 (67%), Gaps = 31/198 (15%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 370
            I ++ +QE  I NAMEGLNLL +G   R+V STK+ND SSRSHTIFTIT      D   
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 371 --ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--- 425
             E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL+DK+ +   
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 426 ---------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 464
                                IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 465 STLEYASKAKNIKNKPQL 482
           STLEYA++A +IKN P++
Sbjct: 385 STLEYATRAMSIKNNPKI 402

 Score =  140 bits (352), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 102/172 (59%), Gaps = 24/172 (13%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN++EI  KSSVVV+     G++ +  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ IF+ VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 149 LSDAAGIIPRVLLKLFDTLEL----QQN----DYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL++LF +LE     Q+N     Y VK SF+ELYNE LKDLL
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL 171

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  143 bits (360), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-- 373
           +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L   
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 374 --RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 15/123 (12%)

Query: 101 QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVL 160
           Q  +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 161 LKLFDTLELQQND-------YVVKCSFIELYNEELKDLLDXXXXXXXXXGFEGPFMKKLR 213
            +LF+  E+ ++        + ++CS++E+YNE ++DLL            +  F++ L+
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLGANKCRIRERADKTTFVEGLQ 174

Query: 214 IFD 216
            F+
Sbjct: 175 EFE 177

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  139 bits (350), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 116/175 (66%), Gaps = 8/175 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 375
           +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 376 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 484
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 90/192 (46%), Gaps = 29/192 (15%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREV--DESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 96  GPG----ASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
                  A Q  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 152 AAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLLDXXXXXXXXXGF 204
           + GI+ R+  +LF+  E+ ++        + ++CS++E+YNE ++DLL            
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 205 EGPFMKKLRIFD 216
           +  F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  141 bits (355), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 118/185 (63%), Gaps = 9/185 (4%)

Query: 303 RSSMAPND-QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 361
           R S++ +D + +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I  
Sbjct: 184 RISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVR 243

Query: 362 ITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           I L K++  +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL 
Sbjct: 244 INLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALT 303

Query: 421 D-------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 473
                    S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+A
Sbjct: 304 QVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRA 363

Query: 474 KNIKN 478
           K IKN
Sbjct: 364 KKIKN 368

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 69/115 (60%), Gaps = 11/115 (9%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           + Q N + +T D+VF  G++Q+ +++ VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
            +        +  G+IPR+   +F  +E    +   + V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 375
           ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT+++ ++  D   R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 376 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALADKSGH-IPFRESK 432
           S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ LA  S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 433 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 486
           LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 56/113 (49%), Gaps = 9/113 (7%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDY-VVKCSFIELYNEELKDLL 192
                    +   GIIP +   LFD LEL +     V  ++ E+YNE+L DLL
Sbjct: 89  T--------NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLL 133

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 371
           +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGH--IPFR 429
             R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ LA K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 430 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARV 368

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 22/178 (12%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R    RE G      V  P     ++  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 96  ----GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 148
                    Q++I+D +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 149 LS-------DAAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLL 192
            +        A GIIPRV   LFD   +  ++       + + CS++E+YNE+++DLL
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 104/169 (61%), Gaps = 3/169 (1%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL- 372
           G+Y++      +++  E LN +  G   R   ST MN  SSRSH I  I L K+   E  
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--DKSGHIPFRE 430
            + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL   +K  HIP+R+
Sbjct: 248 IQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYRD 307

Query: 431 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK
Sbjct: 308 SQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 17/133 (12%)

Query: 64  ITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 123
           +  ++E ++   G     A   A+ +  D VFG  A Q+ +FD VA  +   F  GYN T
Sbjct: 40  VVAADEGTVEFAG-----AADEARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNST 94

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +L YG T +GK+YTM G             G+IPR+  ++F+ + L +N    +YVV  S
Sbjct: 95  ILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVS 146

Query: 180 FIELYNEELKDLL 192
           F+E+Y E++ DLL
Sbjct: 147 FLEIYLEKVYDLL 159

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 112/182 (61%), Gaps = 5/182 (2%)

Query: 303 RSSMAPNDQSN-GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFT 361
           R+S+  ++ S  G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I  
Sbjct: 203 RTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVK 262

Query: 362 ITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA 420
           I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL 
Sbjct: 263 INLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALT 322

Query: 421 DKS---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
            K     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+
Sbjct: 323 QKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIE 382

Query: 478 NK 479
           NK
Sbjct: 383 NK 384

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 69/118 (58%), Gaps = 12/118 (10%)

Query: 79  GITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 138
           G+  +  ++ +  D VFG  ++QD ++D VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 139 TGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLL 192
            G          D  G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E++ DLL
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 7/172 (4%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK----KHQDE 371
           YI+ L +  + +  E L  ++ G   R VA T +N+ SSRSH I TI + +       D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA-DKSGHIPFRE 430
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 431 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 482
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 79/166 (47%), Gaps = 23/166 (13%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVF 95
           NI VA+R R +  RE    S +         S E+++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGI 155
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 156 IPRVLLKLFDTLELQQND---------YVVKCSFIELYNEELKDLL 192
           IP V  +LF  +++ Q++         + V  S+ ++YNE++ D+L
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/178 (41%), Positives = 111/178 (62%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK--K 367
           DQ++ I + NL      N  + ++L+ RG  +R  + T+ N+ SSRSH++  I + +  K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 368 HQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--D 421
           + D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 13/110 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ++Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND-----YVVKCSFIELYNEELKDLL 192
             S+  GII R + +LF  +E+   D       +  S++E+YNE ++DLL
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 104/180 (57%), Gaps = 10/180 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL +   T   E ++L+ RG  +R  + T+ N+ SSRSH +  I + +K++
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 420
                E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 421 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 207

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  GI+ + + +LF  +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 208 -TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D   GI + NL         + ++L+ RG  +R  + T  N+ SSRSH +  I + +K++
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 187

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
               +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 188 --TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 66/129 (51%), Gaps = 16/129 (12%)

Query: 71  SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 126
           SIN+ G     +Q        ++  DK+F   +SQ  ++ E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 127 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIEL 183
           YG T  GKTYT++G             G+I   + +LF   D L+ ++N + +  S++E+
Sbjct: 191 YGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKN-FEISLSYLEI 241

Query: 184 YNEELKDLL 192
           YNE ++DLL
Sbjct: 242 YNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + ++ +  S++E+YNE + DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 105/181 (58%), Gaps = 13/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + +  +
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 370 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                 D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL    
Sbjct: 300 TAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 424 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
           G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 479 K 479
           K
Sbjct: 418 K 418

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------ 181

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 182 --PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 107/180 (59%), Gaps = 10/180 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +N I + NL   +     E ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 370 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----- 420
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 421 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            ++S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ASQ+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------ 203

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
              +  GII RV+ +LF+ +E  ++   + +  S++E+YNE ++DLL
Sbjct: 204 --PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 109/179 (60%), Gaps = 9/179 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D    I + NL    ++   + ++L+ +G  +R  ++T  N+ SSRSH +  + + ++++
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 370 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---ADK 422
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL     K
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 423 SG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
            G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D+VF   +SQ  +++    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG------ 176

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 193
               +  GII   + +LF  +E  Q+   + +  S++E+YNE ++DLL+
Sbjct: 177 --TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ +     + ++ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 103/183 (56%), Gaps = 17/183 (9%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL----- 364
           D +  I + NL      +  + L+L+ RG  +R  + T+ N  SSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 365 ---YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
               K+HQ        ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 422 KSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
             G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 477 KNK 479
           K K
Sbjct: 430 KTK 432

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 10/114 (8%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
                     +  GII R + +LF  ++      D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 103/183 (56%), Gaps = 15/183 (8%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YK 366
           +DQS   Y+ N++ F I N  + + L+ +    R  +ST +N  SSRSH IF I L  Y 
Sbjct: 556 DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 367 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 419
              +E   ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL       
Sbjct: 616 HKTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNH 674

Query: 420 -----ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
                  K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  
Sbjct: 675 LNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVN 734

Query: 475 NIK 477
           N K
Sbjct: 735 NTK 737

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF        +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIEQ-LIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           L+   G+IP  +  +F++++ L++N  +Y V C FIELYNE + DL 
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF 539

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 107/182 (58%), Gaps = 14/182 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 368
           D  N  ++ NL +    N  E ++L+ +G  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 369 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   S
Sbjct: 295 TADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 424 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
                  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 478 NK 479
            K
Sbjct: 413 TK 414

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 12/110 (10%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F    +Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 122 QKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT----- 176

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLLD 193
              S+  GII   + +LF  +E Q  D   + ++ SF+E+YNE++ DLLD
Sbjct: 177 ---SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 370 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA----D 421
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 422 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + D+ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 107/181 (59%), Gaps = 13/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +  I + NL  ++     + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 370 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--- 420
                 D  F  + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 299 TADLKSDHTF--ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 421 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
              +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 479 K 479
           K
Sbjct: 417 K 417

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  D++F   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------ 180

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  GII + + +LF+ +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 181 --PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 112/188 (59%), Gaps = 23/188 (12%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D +N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 370 --------DELFRISKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTLGRVINA 418
                   ++LF  S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  INA
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 419 LADKSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
           L   +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 472 KAKNIKNK 479
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (52%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  DK+    ++Q  +F     PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------ 162

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
              +  GII   L  LF+ +E  ++  +  +  S++E+YNE +KDLLD
Sbjct: 163 --PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 93/148 (62%), Gaps = 4/148 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N S
Sbjct: 540 VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT +
Sbjct: 600 MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIK 477
              ISPA +   ET ++L +ASK  N K
Sbjct: 660 FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (49%), Gaps = 17/123 (13%)

Query: 76  GDTGITAQMNAKR---YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           GD G+T      +   +  DK+F    + D IF EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELK 189
           GKTYTM          L+   GI+P  +  +F   D L  +   Y V C FIE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 190 DLL 192
           DLL
Sbjct: 490 DLL 492

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 104/171 (60%), Gaps = 11/171 (6%)

Query: 316 YIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL-----YKKHQD 370
           +++ L+E  + N  E ++ + +G ++R V ST MN  SSRSH IF I++     +KK   
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 371 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD----KSGHI 426
            +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    +S  I
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 427 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
           P+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASLTKKVK 347

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 21/120 (17%)

Query: 86  AKRYTVDKVFGPGAS----QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           AK +  D  FG   S    Q +I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQN---------DYVVKCSFIELYNEELKDLL 192
           +           GI+PR   +LF+   +            D+ VKCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 99/179 (55%), Gaps = 9/179 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D    I + NL         E ++ + RG  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 370 DELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG- 424
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 425 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 58/108 (53%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG------- 179

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
              +  GII   + +LF  +E  ++  +  +  S++E+YNE ++DLL+
Sbjct: 180 -TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  117 bits (293), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 107/179 (59%), Gaps = 9/179 (5%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D    I + NL    +    + ++L+ +G  +R  ++T  N+ SSRSH +  + + +K++
Sbjct: 236 DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 370 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--ADKS 423
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    K 
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 424 G---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
           G   H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK K
Sbjct: 356 GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 17/131 (12%)

Query: 71  SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVL 125
           SI T   +     MN++R     +  D+VF   ASQ+ +++    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 126 VYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIE 182
            YG T  GKTYT++G         ++  GII   + +LF  +E Q  D   + +  S++E
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLE 212

Query: 183 LYNEELKDLLD 193
           +YNE ++DLL+
Sbjct: 213 IYNESIRDLLE 223

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 108/185 (58%), Gaps = 17/185 (9%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 368
           D+ + I + NL   +  +  + ++L+ RG  +R  +ST+ N+ SSRSH +  I + + + 
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 369 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423
                 +  F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 424 G---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474
                     HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 475 NIKNK 479
            IK K
Sbjct: 480 EIKTK 484

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 10/113 (8%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
           +        +  GII RV+ +LF+ +E  +++  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 101/152 (66%), Gaps = 4/152 (2%)

Query: 326 TNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 384
           +N  E   L+QR  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 385 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSL 441
           GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKA 473
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 149 LSDAAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNEELKDLLD 193
           L++  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLL+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLN 504

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 106/181 (58%), Gaps = 13/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  + I + NL         + ++L+ +G  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 370 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--- 420
                   +F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 317 TVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 421 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
              +S H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 375 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 479 K 479
           K
Sbjct: 435 K 435

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------ 198

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 193
              +  GII   + +LF  +E      ++ +  S++E+YNE ++DLL+
Sbjct: 199 --PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  112 bits (281), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 106/191 (55%), Gaps = 28/191 (14%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           ++   +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ +   
Sbjct: 184 NRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDI 243

Query: 370 D-----ELFRISKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGRVINALA 420
           D      +   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ +L 
Sbjct: 244 DLNTNSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLK 300

Query: 421 DK-----------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 466
            +           S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ ST
Sbjct: 301 KREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESAST 358

Query: 467 LEYASKAKNIK 477
           L YA  A+ IK
Sbjct: 359 LRYADIAQTIK 369

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 76/171 (44%), Gaps = 20/171 (11%)

Query: 37  ITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFG 96
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 97  PGA----SQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
            G     SQ   +        +D + GYNC +L YG T +GKTYTM G+ K      +D 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 153 AGIIPRVLLKLFDTLE----------LQQNDYVVKCSFIELYNEELKDLLD 193
            G+IPR    LF  +E           Q+++Y V CS  E+YNE++ DLL+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG--HIPFRESKLTRLLQDSLGGNTKTALI 450
               +R +E  +IN+SL  LG VI AL DK+   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 451 ATISPAKVTSEETCSTLEYASKA 473
             ISP+     ET ++L +ASK 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F  G S D +F EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           L    G+IP  +  +FD +E L++   +Y + C F+E+YNE + DLL
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK---MNLVDLAGSENI 389
           N+L++  K R  A+T  N+ SSRSH++F I  Y K ++E+   S    +NLVDLAGSE +
Sbjct: 570 NVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERL 627

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTK 446
           N S A+  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++K
Sbjct: 628 NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSK 687

Query: 447 TALIATISPAKVTSEETCSTLEYASKAKNIK 477
           T +   ISP K    ET ++L +ASK  + K
Sbjct: 688 TLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D++F    S   +F E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
           L+D  G+IP  +  +FD  E  +     Y + C FIE+YNE + DLL
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL 525

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  113 bits (283), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 390
           +L R  K R  ASTK N+ SSRSH+IF I L+ K+    ++ + I  +NLVDLAGSE IN
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERIN 612

Query: 391 RSGALNQRAKEAGSINQSLLTLGRVINAL---ADKSGHIPFRESKLTRLLQDSLGGNTKT 447
            S    +R +E   IN+SL  LG VI+AL     K  HIPFR SKLT LL+ SL GN+KT
Sbjct: 613 SSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKT 672

Query: 448 ALIATISPAKVTSEETCSTLEYASKAKNIK 477
            +   IS +     ET ++L +ASK  + K
Sbjct: 673 LMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 61/116 (52%), Gaps = 14/116 (12%)

Query: 80  ITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMT 139
           IT   N  +Y  DK+F    S   IF EV G L Q  + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 140 GDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
                    L+ + GIIP  +  +F   D L+ +  +Y + C F+E+YNE + DLL
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (59%), Gaps = 14/181 (7%)

Query: 310 DQSNGIYIQNLQEFHITNAMEG-LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           D  +   + NL  +H    +E  ++L+ RG  +R  + T  N+ SSRSH +  + + +  
Sbjct: 239 DSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSS 297

Query: 369 ------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA-- 420
                 +D+++  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL   
Sbjct: 298 RTVDLKEDKMY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMT 355

Query: 421 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
                 H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK 
Sbjct: 356 GRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKT 415

Query: 479 K 479
           K
Sbjct: 416 K 416

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   ASQ  +F     PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG------ 179

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
               D+ GII   + +LF  +   ++   + +  S++E+YNE ++DLL+
Sbjct: 180 --TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 91/151 (60%), Gaps = 8/151 (5%)

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 389
           N+L+R  K R  AST  N+ SSRSH+IF I L   +    +E + I  +NLVDLAGSE I
Sbjct: 547 NILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERI 604

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTK 446
           N S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+K
Sbjct: 605 NSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSK 664

Query: 447 TALIATISPAKVTSEETCSTLEYASKAKNIK 477
           T +   ISP+     ET ++L +ASK  + K
Sbjct: 665 TLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 14/110 (12%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
            +R+  DK+F    +   +F EV G L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 401 PQRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM------- 452

Query: 146 NGELSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
              L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL
Sbjct: 453 ---LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 103/183 (56%), Gaps = 18/183 (9%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L+E    ++ E +  ++RG  HR+ A T  N  SSRSH I  I L   +
Sbjct: 273 DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTN 332

Query: 369 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 333 VIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 424 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 473
                     GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+A
Sbjct: 390 HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 474 KNI 476
           KN+
Sbjct: 450 KNV 452

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D V+ P  S   I++ +  P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
                  +  +  K+ +   + +  + V  S++E+YNE + DLLD
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 103/178 (57%), Gaps = 8/178 (4%)

Query: 310 DQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 369
           D  N   + NL      +  + ++L+ +G  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 370 DELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-- 423
               +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 301 SVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 360

Query: 424 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479
              H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 361 TYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG------ 181

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
               +  GII   + +LF  +E  ++   + +  S++E+YNE ++DLL+
Sbjct: 182 --TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 98/169 (57%), Gaps = 6/169 (3%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKK--HQDE 371
           G YI N+    +T+  +   +L++  K R  A+T+ N+ SSRSH++F + +  +  H  E
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPF 428
             +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI AL        +IPF
Sbjct: 598 TSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPF 656

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
           R SKLT LLQ SL G++KT +   I P      ET ++L +ASK  + K
Sbjct: 657 RNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 81/167 (48%), Gaps = 24/167 (14%)

Query: 33  EELNITVAVRCRGR----NEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKR 88
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN   + G     N   
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINR--NEGRILSYN--- 414

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D +F P  +   IF+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
           L+   G+IP  L  +F     L+ +  +Y ++C +IE+YNE + DLL
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 13/156 (8%)

Query: 333 NLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 389
           N+L+R  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602 NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 390 NRSGALNQRAKEAGSINQSLLTLGRVINALAD--------KSGHIPFRESKLTRLLQDSL 441
           N S    +R +E  +IN+SL  LG VI+AL          K  HIPFR SKLT LLQ SL
Sbjct: 660 NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 442 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
            GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720 IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 14/108 (12%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F    + D +F EV G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 452 KFKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 501

Query: 148 ELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
            L    GIIP  +  +F   + L+ +   Y ++C F+E+YNE + DLL
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 390
           L+++  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 391 RSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKT 447
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597 SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 448 ALIATISPAKVTSEETCSTLEYASKAKNIK 477
            +   ISP +   +ET ++L +ASK    K
Sbjct: 657 LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 14/109 (12%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F        +FDE+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
             L+   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE + DLL
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 4/148 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 392
           LL+R  K R  AST  N+ SSRSH+IF + L  ++     R    +NLVDLAGSE IN S
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINTS 608

Query: 393 GALNQRAKEAGSINQSLLTLGRVINAL--ADKSG-HIPFRESKLTRLLQDSLGGNTKTAL 449
             + +R +E  SIN+SL  LG VI+AL  AD S  HIPFR SKLT LLQ SL GN+KT +
Sbjct: 609 QVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLM 668

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIK 477
              IS     + ET ++L +ASK  + K
Sbjct: 669 FVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (46%), Gaps = 20/161 (12%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R    RE    + + V    D  G++ + +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    +   +F E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 155 IIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
           IIP  +  +F+    L+ +   Y V C F+E+YNE + DLL
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 87/145 (60%), Gaps = 6/145 (4%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELFRISKMNLVDLAGSENINR 391
           LL+R  K R  A+T  N+ SSRSH++F I L  Y  +  E  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 392 SGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTA 448
           S     R +E  +IN+SL  LG VI+ALA       HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 449 LIATISPAKVTSEETCSTLEYASKA 473
           +   ISP      ET ++L +ASK 
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKV 697

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 66/138 (47%), Gaps = 22/138 (15%)

Query: 66  GSE--EVSINTTGDTGITAQMNAKR------YTVDKVFGPGASQDLIFDEVAGPLFQDFI 117
           GSE   V IN   D   T  MN  R      +  DK+F P  S D IF+E+   L Q  +
Sbjct: 382 GSESCHVHINLFNDDEGTQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSL 440

Query: 118 KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DY 174
            GYN  +  YG T +GKTYTM          L    G+IP  L  +F  + L +    +Y
Sbjct: 441 DGYNVCIFAYGQTGSGKTYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEY 490

Query: 175 VVKCSFIELYNEELKDLL 192
            +   FIE+YNE + DLL
Sbjct: 491 EISSQFIEIYNETIIDLL 508

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 101/194 (52%), Gaps = 23/194 (11%)

Query: 303 RSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           RSS  P       D   G+ I  L E    ++ E L  ++ G K R+   T  N  SSRS
Sbjct: 244 RSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRS 303

Query: 357 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
           H I  I L K    E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG V
Sbjct: 304 HAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTV 360

Query: 416 INALADKS-------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
           I+ L+ +S             GHIP+R+SKLTR+LQ +L GN     I TI      S E
Sbjct: 361 ISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSE 420

Query: 463 TCSTLEYASKAKNI 476
           T +TL +AS+AKN+
Sbjct: 421 TLNTLRFASRAKNV 434

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++ + + P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 149 LSDAAGIIPRVLLKLFDTL--ELQQND--YVVKCSFIELYNEELKDLLD 193
             +  G+IP  +  L+  +  E  Q D  + +  S++E+YNE++ DLLD
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD 222

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 108/191 (56%), Gaps = 21/191 (10%)

Query: 303 RSSMA-P-----NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           RSS+A P     +D + G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRS
Sbjct: 213 RSSIAVPELKIRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRS 272

Query: 357 HTIFTITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 414
           H I  I L        E+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG 
Sbjct: 273 HAIILIRLISSDLSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGT 328

Query: 415 VINALADK---------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 465
           VI+ L+ +         + HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +
Sbjct: 329 VISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVN 388

Query: 466 TLEYASKAKNI 476
           TL +AS+AKN+
Sbjct: 389 TLRFASRAKNV 399

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 149 LSDAAGIIP----RVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
           +   AG+IP     +  K+FD+   +   Y    S++E+YNE++ DLL+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 392
           +L++  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 79/164 (48%), Gaps = 17/164 (10%)

Query: 33  EELNITVAVRCRGRNE-REIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   + +    + ++NV +   +  V          TAQ++   +  
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVH--EFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 392
           +L+R  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 78/164 (47%), Gaps = 17/164 (10%)

Query: 33  EELNITVAVRCRGRNERE-IGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E +    + ++NV +   +    + +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNR--GVQSMEVTKIQNTPQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 392
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 82/169 (48%), Gaps = 27/169 (15%)

Query: 33  EELNITVAVRCRGRNEREI--GMKSSVV-VN-VPDITGSEEVSINTTGDTGITAQMNAKR 88
           +EL   + V CR R   E    + +S++ VN   D  G + + +     T I +      
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEV-----TKIQSTTQVHE 435

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 146
           +  DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
                  GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (58%), Gaps = 4/148 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLY-KKHQDELFRISKMNLVDLAGSENINRS 392
           LL++  + R  AST  N+ SSRSH++F I L    H         +NLVDLAGSE IN S
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSS 625

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             L +R +E  +IN+SL  LG V++AL        HIPFR SKLT LLQ SL GN+KT +
Sbjct: 626 QVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLM 685

Query: 450 IATISPAKVTSEETCSTLEYASKAKNIK 477
              IS  +    ET ++L +ASK  + K
Sbjct: 686 FVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 81/161 (50%), Gaps = 18/161 (11%)

Query: 36  NITVAVRCRGRNEREIGMKSSVVVN-VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    + + +F+E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 155 IIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           IIP  +  +F  +E L++   +Y + C FIE+YNE + DLL
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 79/196 (40%), Gaps = 20/196 (10%)

Query: 741 KNHFFKNNHQELLNHHIDSTYEDIEKKTSEF--------------VENFKNTLNDHLEEN 786
           KN F +  HQ  L         DI K  +E+               EN +N+L D +EE 
Sbjct: 162 KNGFLEQGHQLHLQQLRAKNDADINKMENEYRVQLERLKFAKVKKFENERNSLLDKVEEV 221

Query: 787 KKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCD-SMNNEFYNNMATTLSQIK 845
           +  I+ N TN  + +   E + +  K   W   +    K +  MN  F N++     QIK
Sbjct: 222 RNNIITNETNLQNMLRECETNHYRAKE-NWLQDYQKNWKENVQMNENFSNDVTVLGQQIK 280

Query: 846 NTVDTSSNSMNKSISVMKGQVEESENAVSXXXXXXXXXXXXXXXVNKHTIL----KDNIE 901
             ++   N   + ++ ++G+++  +N++                +   T+     +  + 
Sbjct: 281 TVLEPQCNEKMQEVAALRGKLQNLQNSLKQRQDDTQSMKRQIDEIKGKTVQTKRKRQELH 340

Query: 902 NSITSTHSHITNIDDI 917
           + I +T S +  ID+I
Sbjct: 341 DYIHNTKSELQQIDEI 356

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 6/166 (3%)

Query: 317 IQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 376
           I N+ +  +T+  +  ++L+R  + R  A T+ N+ SSRSH++F + +   H D+   +S
Sbjct: 543 ITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQTGEVS 601

Query: 377 --KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRES 431
             K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI AL        HIPFR S
Sbjct: 602 HGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRNS 661

Query: 432 KLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
           KLT LLQ SL G++KT +   I   +  + ET ++L +ASK  + K
Sbjct: 662 KLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F P  +   +F E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 417 FHFDKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM---------- 465

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQND--YVVKCSFIELYNEELKDLL 192
           L+   G+IP  L  +F   E L ++   Y + C +IE+YNE + DLL
Sbjct: 466 LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 392
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 393 GALNQRAKEAGSINQSLLTLGRVINALADKSG---HIPFRESKLTRLLQDSLGGNTKTAL 449
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 77/164 (46%), Gaps = 17/164 (10%)

Query: 33  EELNITVAVRCRGRNEREIGMKS-SVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E    S + ++NV +    +   I +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTAQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
             GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 129/250 (51%), Gaps = 36/250 (14%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++   
Sbjct: 230 DDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--C 287

Query: 369 QDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-- 423
            DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S  
Sbjct: 288 TDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSG 344

Query: 424 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 477
                GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI  
Sbjct: 345 LSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISL 404

Query: 478 -----------NKPQLGAFIMKDILVKNITME---------LAKIKSDLLSTKSKEGIYM 517
                      +K QL   + K +  + IT++          + I SD    +  E + M
Sbjct: 405 AVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKM 464

Query: 518 SQDHYKNLNS 527
             +HY+ L +
Sbjct: 465 KVEHYERLET 474

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 10/107 (9%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF P  + D +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 149 LSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 193
                GIIP  +  +FD +   L +  + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 100/196 (51%), Gaps = 31/196 (15%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ E +N + +G K R+ A T  N  SSRSH I  I L    
Sbjct: 275 DDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD 334

Query: 369 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 335 MKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 424 -----------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
                                  GHIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392 SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 461 EETCSTLEYASKAKNI 476
            ET +TL +AS+AKNI
Sbjct: 452 AETLNTLRFASRAKNI 467

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 57/120 (47%), Gaps = 9/120 (7%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF    S   I+  +  P+     +G+N T+  YGMT +GKTY
Sbjct: 125 DEKTIAHDDVGEFKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTY 184

Query: 137 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLL 192
           TM G       E     G+IP  +  LF  +  +  D    + +  S++E+YNE++ DLL
Sbjct: 185 TMMG-----CPEREQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLL 239

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 112/228 (49%), Gaps = 36/228 (15%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   +
Sbjct: 261 DDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHN 320

Query: 369 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 321 VIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 424 --------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 463
                                HIP+R+SKLTRLLQ +L GN+    I TI P   T  ET
Sbjct: 378 KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 464 CSTLEYASKAKNI-------KNKPQLG-AFIMKDILVKNITMELAKIK 503
            +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K
Sbjct: 438 INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   N   Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 193
           D +       +  GI+P  +  LF+ +   +ND  Y V  S++E+YNE++ DLLD
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLD 232

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 103/181 (56%), Gaps = 8/181 (4%)

Query: 303 RSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTI 362
           R  +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF I
Sbjct: 492 RHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFII 551

Query: 363 TLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419
            ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N+L
Sbjct: 552 KIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSL 609

Query: 420 ADKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 476
                   HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  + 
Sbjct: 610 GSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNST 669

Query: 477 K 477
           K
Sbjct: 670 K 670

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (52%), Gaps = 14/108 (12%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           +Y+ DKVF    +   IF EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
            L+   GIIP     +FD ++    +   Y V C F+E+YN+E+ DLL
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL 478

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 98/167 (58%), Gaps = 14/167 (8%)

Query: 324 HITN-------AMEGLN-LLQRGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELF 373
           HITN       + E +N +L+R LK R  A+T  N  SSRSH++F I L  Y     E  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--ADKSG-HIPFRE 430
               +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL  AD S  HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 431 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 23/165 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   E    SS  + +   +       + TG   IT + ++K  ++T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHKFT 410

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 151 DAAGIIPRVLLKLFDTLE-LQQNDYV--VKCSFIELYNEELKDLL 192
              GIIP  L  +F  +E L++  +V  +   F+E+YNE +KDL 
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 12/151 (7%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK------KHQDELFRISKMNLVDLAGSE 387
           +L+   K + +A+T  N+ SSRSH++FTI ++       +  D +     +NLVDLAGSE
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV-----LNLVDLAGSE 595

Query: 388 NINRSGALNQRAKEAGSINQSLLTLGRVINALADKS-GHIPFRESKLTRLLQDSLGGNTK 446
            I+ S     R +E  +IN+SL  LG VI AL  K   HIPFR SKLT LLQ SL G++K
Sbjct: 596 RIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSK 655

Query: 447 TALIATISPAKVTSEETCSTLEYASKAKNIK 477
           T +   +SP+    +ET ++L +ASK  + K
Sbjct: 656 TLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 78/161 (48%), Gaps = 23/161 (14%)

Query: 36  NITVAVRCRGRNEREIGMKSSV-VVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   E E+   S + V N  +  GS+ + I+              R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNS--------RFLFDKV 409

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F   AS   +F+EV G L Q  + GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 155 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
           +IP  L  +FD   L +    DY  +  FIE+YNE++ DLL
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 130/252 (51%), Gaps = 28/252 (11%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L    
Sbjct: 272 DDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT- 330

Query: 369 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS- 423
             +L       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  S 
Sbjct: 331 --DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSM 385

Query: 424 --------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 475
                    HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN
Sbjct: 386 HTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKN 445

Query: 476 I-----KNKPQLGAFIMKDILVKNITMELAKIKSDLLSTK-SKEGIYMSQDHYKNLNSDL 529
           +     +N+ +L     KD L+ N+  +L + +  +   K ++E    + D Y  L  + 
Sbjct: 446 VSMTVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKES 502

Query: 530 ESYKNEVQECKR 541
           ++ K ++Q C+R
Sbjct: 503 DALKRKLQLCER 514

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF P ++   ++ ++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 137 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE++ DLL+
Sbjct: 187 TMSGT--------PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (52%), Gaps = 29/194 (14%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L +     + E L+ + +G K+R+ + T+ N  SSRSH I  I L  K 
Sbjct: 263 DDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKD 322

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN---------- 417
            +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+          
Sbjct: 323 IRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 418 ----------ALADKSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
                     +LA  +G     HIP+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380 HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 463 TCSTLEYASKAKNI 476
           T +TL +AS++KN+
Sbjct: 440 TLNTLRFASRSKNV 453

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 68/134 (50%), Gaps = 23/134 (17%)

Query: 64  ITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 123
           I G + +S N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L  + N       V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 180 FIELYNEELKDLLD 193
           ++E+YNE++ DLLD
Sbjct: 220 YLEIYNEKINDLLD 233

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 115/225 (51%), Gaps = 16/225 (7%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L    
Sbjct: 267 DDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTD 326

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG--- 424
            +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 327 LKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNM 383

Query: 425 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 477
                 HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI  
Sbjct: 384 GVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISL 443

Query: 478 --NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 520
              + ++     KD +++N+  +L +    +   KS  G   + D
Sbjct: 444 VVKRNEMDISNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTD 488

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           ++ D VF P      +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
            S+  G+IP  +  +F  +    L    + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 101/188 (53%), Gaps = 23/188 (12%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L    
Sbjct: 243 DDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATD 302

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
            +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L+ +S    
Sbjct: 303 LETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHR 359

Query: 424 ---------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 468
                           HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL 
Sbjct: 360 NADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLR 419

Query: 469 YASKAKNI 476
           +AS+AKN+
Sbjct: 420 FASRAKNV 427

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 57  VVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDF 116
           +V   P    + E  +    D    A  +   + +D++F    S   I+ E+  PL    
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKL 136

Query: 117 IKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLE----LQQN 172
             GYN T+  YGMT +GKT+TM+G +        +  G+IP  +  LF+T+     L + 
Sbjct: 137 AMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKK 188

Query: 173 DYVVKCSFIELYNEELKDLLD 193
            Y +  S++E+YNE+L DLLD
Sbjct: 189 KYEMLVSYMEIYNEKLYDLLD 209

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 99/200 (49%), Gaps = 35/200 (17%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   +
Sbjct: 297 DDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 422
            ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 VKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 423 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 456
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 457 KVTSEETCSTLEYASKAKNI 476
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF  +  Q       + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLE 263

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 112/211 (53%), Gaps = 27/211 (12%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 366
           +D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L +  
Sbjct: 269 DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 367 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALA--- 420
            K   E    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L+   
Sbjct: 329 LKTGSEA--TSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 421 ---------DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 471
                      +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 472 KAKNIK---NKPQLGAFIMKDILVKNITMEL 499
           +AKNI     K ++ +   KD +++N+  +L
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF  G     ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLD 193
                G+IP+ +  +FD +  + +     Y VK S++E+YNE++ DLL+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 173/372 (46%), Gaps = 56/372 (15%)

Query: 303 RSSMAP------NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRS 356
           RSS  P      +D   G+ I  L E    ++ E    +Q G K+R+ + T  N  SSRS
Sbjct: 233 RSSGGPVELRIRDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRS 292

Query: 357 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 415
           H I  + L          +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG V
Sbjct: 293 HAIVLVRLNNTDLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTV 349

Query: 416 INAL------------------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 457
           I+ L                   + + HIP+R+SKLTR+LQ +L GN+    I TI    
Sbjct: 350 ISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRN 409

Query: 458 VTSEETCSTLEYASKAKN----IKNKPQL--GAFIMKDILVKNITMELAKIKSDLLSTKS 511
             + ET +T+ +AS+AKN    +  +P +  G++  KD  ++N+T +L K    ++  K 
Sbjct: 410 EAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQ 469

Query: 512 KEGIYMSQ---DHYKNLNSDLESYKNEVQECKRDIEXXXXXXXXXXXXXXXXXXTIQSQN 568
           +  +  S    D   + NS L   +N V +CK                      TI+ ++
Sbjct: 470 RTSMTSSSHNDDSTVDPNSTLLKAENRVLKCK-----------LSNCEKLLDKDTIELED 518

Query: 569 SQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI---MQLALQDYKRRELDLNK 625
           S+M ++   I+ L   +D     E +  G  ++L++  E    ++  L ++ RRE    +
Sbjct: 519 SEMVAI---IDMLP--IDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAE 573

Query: 626 KFETHISKEIKS 637
            F  H++  I+S
Sbjct: 574 PFTAHVNSVIQS 585

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 64/113 (56%), Gaps = 14/113 (12%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A  +T D+VF    +   I++  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQ-----NDYVVKCSFIELYNEELKDLLD 193
                D AG+IP  +  LF  + L+      + Y V  S++E+YNE++ DLLD
Sbjct: 166 -----DEAGLIPLSVTYLFSKI-LEHSMRGTSKYEVVVSYLEIYNEKIYDLLD 212

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 99/188 (52%), Gaps = 26/188 (13%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D  +G+ +  L E  + ++ + L  ++ G  +R+   T  N  SSRSH I TI   K  
Sbjct: 269 DDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KVT 325

Query: 369 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSG 424
             EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L+  SG
Sbjct: 326 CTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSG 382

Query: 425 ----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 468
                           H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ 
Sbjct: 383 ASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIR 442

Query: 469 YASKAKNI 476
           +AS+AKN+
Sbjct: 443 FASRAKNV 450

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF P  +   +++E+  P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
             D AG+I   + ++F  +    +    Y V+ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 98/206 (47%), Gaps = 41/206 (19%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 422
            +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 VRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 423 --------------------------------SGHIPFRESKLTRLLQDSLGGNTKTALI 450
                                           S HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414 GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 451 ATISPAKVTSEETCSTLEYASKAKNI 476
            T+      + ET +TL +AS+AKN+
Sbjct: 474 CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++++ + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF  +  Q       + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLE 263

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 96/200 (48%), Gaps = 35/200 (17%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    +  E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTD 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---- 422
             +   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK    
Sbjct: 357 VNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSV 413

Query: 423 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 456
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 DSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 457 KVTSEETCSTLEYASKAKNI 476
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++    P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLE 263

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 110/215 (51%), Gaps = 31/215 (14%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 366
           +D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L +  
Sbjct: 270 DDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCE 329

Query: 367 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINAL---- 419
            K   E+   S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 330 LKTGTEV--TSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANS 382

Query: 420 ------------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
                       +   GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+
Sbjct: 383 AGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTV 442

Query: 468 EYASKAKNIK---NKPQLGAFIMKDILVKNITMEL 499
            +AS+AKNI     K ++     KD +++N+  +L
Sbjct: 443 RFASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 149 LSDAAGIIPRVLLKLFD-----TLELQQNDYVVKCSFIELYNEELKDLL 192
                G+IP  +  +FD     T +  ++ Y VK S++E+YNE++ DLL
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 107/199 (53%), Gaps = 28/199 (14%)

Query: 315 IYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 373
           I I+NL+  ++T+ +E L+  ++G   R +AS       SRS  I  IT+ ++    E+F
Sbjct: 189 ISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEVF 238

Query: 374 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD----------KS 423
           +     LVDL  S+ I++   L    +    INQS++TL  V  +LA           +S
Sbjct: 239 KTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPRS 298

Query: 424 G--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 477
           G  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K    
Sbjct: 299 GNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLFQ 358

Query: 478 -NKPQLGAFIMKDILVKNI 495
            NK    +  M D+L+K+ 
Sbjct: 359 QNKAGTNSKAMLDLLMKDF 377

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 11/114 (9%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG- 122

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
              YN       G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 123 ---YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 14/151 (9%)

Query: 332 LNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENIN 390
           L L+ +G ++R+V ST+ N  SSRSH +  + +     D +   ++ + L DLAGSE   
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI----TDSMGSKARVLTLCDLAGSER-- 294

Query: 391 RSGALNQRA--KEAGSINQSLLTLG---RVINALADKSGHIPFRESKLTRLLQDSLGGNT 445
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN 
Sbjct: 295 --ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNG 352

Query: 446 KTALIATISPAKVTSEETCSTLEYASKAKNI 476
              ++ T+S +    E++  TL +A +A  +
Sbjct: 353 LVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 44/93 (47%), Gaps = 18/93 (19%)

Query: 104 IFDEVAGPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRV 159
           IF     PL      D I G   T++ YG T +GKTYTM G         + A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 160 LLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            L + D L     +  +  S++E+YNE L DLL
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLL 200

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 93/184 (50%), Gaps = 19/184 (10%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   +
Sbjct: 237 DDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTN 296

Query: 369 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS---- 423
             +     + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L+ +S    
Sbjct: 297 LLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 424 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472
                       HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS+
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 473 AKNI 476
           AKN+
Sbjct: 414 AKNV 417

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 6/112 (5%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
              +N  +    G    V  ++ +  + +Q    V  S++E+YNE++ DLL+
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 5/144 (3%)

Query: 334 LLQRGLKHRQVASTKMNDFSSRSHTIFT--ITLYKKHQDELFRISKMNLVDLAGSENINR 391
           L++ G   R   ST MN+ SSRSH++F   IT + +   E     ++NLVDLAGSE + +
Sbjct: 527 LIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQ 585

Query: 392 SGALNQRA--KEAGSINQSLLTLGRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTAL 449
              +  +   KE  SIN+SL  L  VI+++  +  +IPFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 450 IATISPAKVTSEETCSTLEYASKA 473
              ISP   +  ET ++L  A K 
Sbjct: 646 YVNISPNINSIRETINSLRLARKV 669

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 16/114 (14%)

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           Q++A  +T DK+FG       +FD++   L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 380 QLHA--FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---- 432

Query: 143 KLYNGELSDAAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
                 L++  GII +    ++     L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 ------LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 96/200 (48%), Gaps = 35/200 (17%)

Query: 309 NDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 368
           +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 369 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-ADK---S 423
            +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L ADK   +
Sbjct: 357 LESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPT 413

Query: 424 GH----IP-----------------------FRESKLTRLLQDSLGGNTKTALIATISPA 456
           G      P                       +R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 457 KVTSEETCSTLEYASKAKNI 476
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETINTLRFASRAKNV 493

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF + +EL  N    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLE 263

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 104/207 (50%), Gaps = 17/207 (8%)

Query: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 371
           NG  ++NL+   +    E   L+   L +++    + N+   RSHTI  +++ K+++ DE
Sbjct: 191 NGFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 372 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALA--DKSGHI--- 426
              +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L   ++ G I   
Sbjct: 248 SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 427 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
                   P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308 ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 479 KPQLGAFIMKDILVKNITMELAKIKSD 505
            P++  F +      +I +   K+K D
Sbjct: 368 NPRINRFGLNSKATMDIFLTDMKLKED 394

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 37/141 (26%)

Query: 71  SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFI--------K 118
           SIN T DT +T     Q+   +Y  DKVF   AS D       G   Q+FI        +
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASND------TGVEHQEFIESNLESLLQ 101

Query: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL--ELQQND--- 173
           GYN +++ YG + TGK++ + G+++          G+I ++L KLF+ +  E+  N+   
Sbjct: 102 GYNTSIVTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNI 152

Query: 174 -YVVKCSFIELYNEELKDLLD 193
            Y VK SF+E+Y E++ DL+D
Sbjct: 153 HYTVKFSFLEVYQEKMFDLMD 173

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 19/124 (15%)

Query: 73  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           NTTGDT  T Q        DKVF   A+Q  + D +  P   D + GYN T+L YG + +
Sbjct: 67  NTTGDTHSTFQF-------DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEEL 188
           GK+Y++ G +        D  GI+P +   LF TLE ++    N++ V     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 189 KDLL 192
            DLL
Sbjct: 172 YDLL 175

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 70/137 (51%), Gaps = 13/137 (9%)

Query: 354 SRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           SRSH +F + + ++  + ++ + S + L+DL G+E  ++             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 413 GRVINAL----------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
              + +L          A  S    +RES+LT +L+DSLGGN KT +I T   + V +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 463 TCSTLEYASKAKNIKNK 479
           T STL++    + I N+
Sbjct: 352 TLSTLKFGDSIRQINNR 368

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          L+
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 151 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL 
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
           S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   +   + S  +++   +       +  G   IT +  AK  ++T
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDSSSISIDGFS-------DENGTQCITIKREAKYHKFT 409

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM          L+
Sbjct: 410 FDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------LN 458

Query: 151 DAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
              GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL 
Sbjct: 459 PEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 312 SNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 364
           S   +I N+    +TN     ++L R +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 107/215 (49%), Gaps = 16/215 (7%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DEL 372
           G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + DE 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS--------- 423
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L+  S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 424 ---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 480
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 481 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 515
           Q+  F + +    +I +E  K+K +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 55/105 (52%), Gaps = 12/105 (11%)

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA 153
           +F   ++ DLI + +   +  + ++GYN  ++ YG   +GKTY+      LY  ++ D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 154 GIIPRVLLKLFDTLELQQND------YVVKCSFIELYNEELKDLL 192
           G+   +   LF  +     D      ++VK SF+E++ +++ DLL
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 66/128 (51%), Gaps = 19/128 (14%)

Query: 69  EVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYG 128
           E S  TTGDT  T       +  DKVF   A+Q+ + D +  P   D + GYN T++ YG
Sbjct: 62  EPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYG 114

Query: 129 MTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELY 184
            + +GK+Y++ G +        +  GI+P +   LF+TL    E + N++ V     E++
Sbjct: 115 PSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIF 166

Query: 185 NEELKDLL 192
            E+  DLL
Sbjct: 167 MEKTYDLL 174

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 77/137 (56%), Gaps = 13/137 (9%)

Query: 354 SRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 413 GRVI---------NALADKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 462
             ++         +A + K+ H   +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 463 TCSTLEYASKAKNIKNK 479
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q  + D +  P  +D + GYN T+L YG + +GK+Y++ G +  YN  
Sbjct: 75  FQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN-- 130

Query: 149 LSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                G++P +   LF+TL    E +  ++ V     E+Y E+  DLL
Sbjct: 131 ----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 17/139 (12%)

Query: 354 SRSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 410
           S+SH +F + + ++++ E + + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 411 TLGRVINALA---------DKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
            L  ++  LA          K+ H   +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 461 EETCSTLEYASKAKNIKNK 479
             T STLE+    + I NK
Sbjct: 351 --TISTLEFGDNIRQIINK 367

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q+ +   +  P+  D + GYN TV+ YG + +GK+Y++ G +      
Sbjct: 75  FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK------ 128

Query: 149 LSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
             ++ GI+P +   LFDTL    E + + + V     E+Y E+  DLL
Sbjct: 129 --ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 354 SRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 410
           SRSH +F + + ++  +D++ + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 411 TLGRVINAL----------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 460
            L   + +L          A  S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 461 EETCSTLEYASKAKNIKNK 479
             T STLE+    + I NK
Sbjct: 351 --TLSTLEFGDSIRQINNK 367

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 89/176 (50%), Gaps = 20/176 (11%)

Query: 306 MAPNDQSN--GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 363
           + PN + N   + I+NL++ ++ +  E  + L  G  +R      M   +SRS+ +  I 
Sbjct: 226 IRPNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKIN 280

Query: 364 LYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK 422
           L +   +D+L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN LA+ 
Sbjct: 281 LEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE- 339

Query: 423 SGHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
           +G  P+ +           S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 340 TGTSPYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 74  TTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           TTG+T          + VDKVF     Q DL+  ++      +   G+N +++ +G + T
Sbjct: 45  TTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGT 95

Query: 133 GKTYTMTGDEKL 144
           GK++TM G+  L
Sbjct: 96  GKSFTMFGNNSL 107

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 108/213 (50%), Gaps = 25/213 (11%)

Query: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 372
           +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195 HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADK----SGHIPF 428
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L ++    S H  F
Sbjct: 250 TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 429 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 483
           ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308 KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 484 AFIMKDILVKNITME----LAKIKSDLLSTKSK 512
           A    D+LV+++ ++    LAKI  +LL T+ K
Sbjct: 365 AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIK 395

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D +F   + +   +D +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 149 LSDAAGIIPRVLL-KLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L +   I  R+L  +  D L+      +   S  ELY +++ DLL
Sbjct: 146 LINH--IADRLLFPQCEDNLKT-----LCSISMWELYIDKVYDLL 183

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  +KV+  G  Q  + +++ G    + + G+N +++ +G   +GKTYTM G++     
Sbjct: 67  KFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH---- 122

Query: 148 ELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                 GI+ R+   +FD L    E   N+  +  +F EL+ E + DLL
Sbjct: 123 ----EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 79/157 (50%), Gaps = 14/157 (8%)

Query: 354 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412
           SRS     IT+ ++++ +E  + S + L+DLA S+ ++++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 413 GRVINALAD--------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 464
            +V+  L++         S     R S+L + LQ ++GG++KT  +   S  K   E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 465 STLEYASKAKNIKNKP-----QLGAFIMKDILVKNIT 496
            TL   S+ ++I N P      L +  + D+ +KN++
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS 380

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 8/108 (7%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           + +++DKVF P ASQ  +   + GP+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEELKDLLD 193
                + G++ R+L K+F  +   +   V    S +EL N+++ DLL+
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLN 142

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 92/190 (48%), Gaps = 23/190 (12%)

Query: 313 NGI----YIQNLQEFHITNAMEGLNLLQRGLK-HRQVASTKMNDFSSRSHTIFTITLYKK 367
           NGI    +++NL    I      L+ LQ+  K   Q +S  +N  +++     +I + K 
Sbjct: 198 NGIKGDKHVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 368 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALAD 421
           H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L+D
Sbjct: 254 HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 422 KSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 475
               +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313 PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 476 IKNKPQLGAF 485
           IKN   +  F
Sbjct: 372 IKNPLIMNVF 381

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 57  VVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDF 116
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   + +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 117 IKGYNCTVLVYGMTSTGKTYTM 138
             GYN + + YG +++GK+ T+
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL 115

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 355 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 413
           RS TI  I L +  +DE L   S +  VDLAGS+  ++        + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 414 RVINALADKSG----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 469
            ++  LA+          +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 470 ASKAKNIKNKPQL 482
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 70  VSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 129
           +++N++ + G     N  R+  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQYRF--DKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 130 TSTGKTYTMTG 140
           T TGKTYT+ G
Sbjct: 99  TGTGKTYTLYG 109

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 8/91 (8%)

Query: 104 IFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKL 163
           +++ + G L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 164 FDTLELQQND--YVVKCSFIELYNEELKDLL 192
           +D ++   ND  + V  S IE++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 102/223 (45%), Gaps = 28/223 (12%)

Query: 311 QSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDF--SSRSHTIFTITLYKKH 368
           Q +  Y ++L    +T+  E +N +     +R   S    ++   S+SH I  I + +++
Sbjct: 174 QDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRN 233

Query: 369 QDE-LFRISKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINALADKS-- 423
            +E + +   ++  DLA  + I++    +L   + E   +N    TL   I ++++ S  
Sbjct: 234 LNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSEN 293

Query: 424 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 477
               IP++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I     
Sbjct: 294 PNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVH 353

Query: 478 -NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQ 519
            NK  L +    D++V+++              KSKE  YM++
Sbjct: 354 MNKHALNSKKKLDLIVEDM--------------KSKEANYMNR 382

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 88/203 (43%), Gaps = 37/203 (18%)

Query: 314 GIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 373
           G+Y Q     +I +  E   +++    +++ +  KM+   S SH +   ++     ++L 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSV-----EQLD 259

Query: 374 RI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 419
           R+      S +   DL GS    +        +    +N S+  L  V+N++        
Sbjct: 260 RVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNH 319

Query: 420 ------------ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 467
                       +     +P+++S+LT L+Q++LGGN++T ++      K   EET +TL
Sbjct: 320 LYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATL 379

Query: 468 EYASKAKNIKNKPQLGAFIMKDI 490
            +  + +NI N      F+  D+
Sbjct: 380 RFGVQLQNILN------FVRADV 396

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  +KV+  G     I   ++  + +D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYV-VKCSFIELYNEELKDLL 192
             D+ GII      +      LE  QN  V ++ S +E+  E++ D+L
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML 186

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 6/125 (4%)

Query: 72  INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTS 131
           + T  DT +  ++  + ++  KV    A++   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 132 TGKTYTMTGDEKLYNGELSDA---AGIIPRVLLKLFDTLELQQ-NDYVVKCSFIELYNEE 187
              +  M G +   + E  D+   +G++ +    +F+ ++    ++Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 188 LKDLL 192
           + DLL
Sbjct: 193 VFDLL 197

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 64/154 (41%), Gaps = 32/154 (20%)

Query: 337 RGLKHRQVAS-TKMNDF--------SSRSHTIFTITL--YKKHQDELFRISKMNLVDLAG 385
           +GLK   V+S  ++ D+        +S  HT   I+L     H+D  FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 386 SENINRSGALNQRAKEAGSINQSLLTLGRVINALA-DKSGHIPFRESKLTRLLQDSLGGN 444
            E++                   L  +  ++  L+ D    I   +S+  +LL +S+GGN
Sbjct: 225 QEDV-------------------LQLVCSLVAVLSNDNDKKIGKEKSQFCKLLSNSIGGN 265

Query: 445 TKTALIATISPAKVTSEETCSTLEYASKAKNIKN 478
            KT  I   S  +   + +  TLE+  K   + N
Sbjct: 266 RKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 12/80 (15%)

Query: 115 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN-D 173
           +  +G +C+++ YG ++TGKT+ +               GIIP  + +L+  LE Q +  
Sbjct: 75  ELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYIYLEAQSDLQ 124

Query: 174 YVVKCSFIELYNE-ELKDLL 192
           Y +  S  E  ++ +++DLL
Sbjct: 125 YQIGLSVWEADSKGKIRDLL 144

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2.649
           YKL012W
          Length = 606

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 712 RVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN-HHIDSTYEDIEKKTSE 770
           R + + + N +A + +D S    + +Q L+N+ F+NN + + N H +  T+ED+ K+  +
Sbjct: 306 RTELRDYLNGVAFSPNDGS--LLSWQQLLQNYLFENNKRFVANKHFVVLTHEDVLKEYLD 363

Query: 771 FVENFKNTLNDHLEENK 787
            V+ ++  L D L+E K
Sbjct: 364 IVDTYETKLRDALKEEK 380

>KNAG0E02930 Chr5 (588769..590532) [1764 bp, 587 aa] {ON} Anc_2.16
           YNL225C
          Length = 587

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 96/194 (49%), Gaps = 30/194 (15%)

Query: 607 EIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQET--NIQPNL 664
           +++++A+    R  L++ + F+ + S+E+++LK++ FS L+      ++ +T  N +   
Sbjct: 125 DVLEVAMTKLARTRLEIQEAFQWY-SQELQNLKSS-FSSLT-----TVAAQTGKNYEAKE 177

Query: 665 DIIKNEVLTLMETMQ--------EKA-ELMYKDCVKKILNESPKFFNVIVEKIDIIRVDF 715
            II+ +   ++E +Q        EKA EL  KD     L +S      +  K++I + +F
Sbjct: 178 RIIRRQFKQVVEKLQFEYNQFTEEKAKELSEKDMS---LTQSTNLVKELSSKLNISQTEF 234

Query: 716 QRFYNNIAE------NLSDI---SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEK 766
           +RF + I+       N+ D+   + E+ N+   + +  FK N+  +         E +EK
Sbjct: 235 ERFKSQISRMSLFGTNIGDVLKSALESENVGNCILDPSFKKNNPNVSGFAYTPITEVVEK 294

Query: 767 KTSEFVENFKNTLN 780
           + +E + ++K  L 
Sbjct: 295 QCTETINSYKEILG 308

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 34/174 (19%)

Query: 492 VKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIEXXXXXXX 551
           ++N+ +EL  +K   L+TK KE +   ++   N++S+ E YK        D E       
Sbjct: 350 IENLELELNDLKD--LNTKLKESLNDKENELTNVSSEYEKYK-------LDAEAHMGIMK 400

Query: 552 XXXXXXXXXXXTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQL 611
                       I+ +N ++ S  L +N++   L             N++L  L +I++ 
Sbjct: 401 DSDDKLKNQVIEIRKKNIELNSKLLQMNEVNENL-------------NDELMSLKDIIEK 447

Query: 612 ALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETNIQPNLD 665
             QD K +             +E+KSLK++  SQ+  ++QNN++ E  ++ NLD
Sbjct: 448 LEQDKKAK------------LQELKSLKSSDISQIEDLKQNNLTLERKLKENLD 489

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
           (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 119/279 (42%), Gaps = 73/279 (26%)

Query: 595 ISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNI 654
           + G N+    L ++++     Y+  E+++N+KF  + +  I SL TT    LS +E +  
Sbjct: 100 LKGINHPTNNLNQLVKPVNSPYE--EVEINEKFLNYHT--ITSLITTNLGWLSALEIDMH 155

Query: 655 SQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVD 714
             +  I   LD IKN ++  ++  Q   EL   D V+ + N + KF N +    +I++ +
Sbjct: 156 YFQIQISDTLDYIKN-IIESLKICQNYLELYCYD-VENLYNSNVKFLNQLANN-EILK-N 211

Query: 715 FQRFYNNIAENLSDIS--------------------EE-----NNNLKQYL----KNHFF 745
           +  +Y+NI   LSDI+                    EE     N+NLK++     KN   
Sbjct: 212 WLNYYDNILTKLSDINGNKLSSYLNKNELVSISSKIEELDQRVNSNLKKFKIVIDKNIDL 271

Query: 746 KNNHQELLNHHIDSTYEDI--------------------------------EKKTSEFVE 773
           +NN    +N  I S  E I                                EK  +EF +
Sbjct: 272 RNN----INKEISSLSEKITPSSEKYKLEETMLEKFTELVKNLRNDSKVILEKDENEFDK 327

Query: 774 NFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPK 812
           N+   L   LE++KK+ + NL   + A+ +Q  D+ E K
Sbjct: 328 NYMQNLAKSLEKDKKVTVTNLLTISKALYSQANDISEIK 366

>NCAS0A14210 Chr1 (2797110..2798912) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 77/172 (44%), Gaps = 14/172 (8%)

Query: 704 IVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYED 763
           ++ K + + V       + AE +S++ +    L          NN   L+N    ++  D
Sbjct: 339 VIPKFETVAVVAFPTVGDAAECVSNVIQSGIQLTAM---ELLDNNMMHLINKGGATSRTD 395

Query: 764 -IEKKTSEF--VENFKNTLNDHLEENKKLI----MQNLTNATSAVINQEMDLFEPKRVKW 816
            IEK T  F    + + T++D + E +KL      QN   A     +++++L+E ++V  
Sbjct: 396 WIEKPTVFFRIGGHTQKTIDDLVSEVEKLAKSNKCQNFEFAKDE--DEKVELWEARKVAL 453

Query: 817 ENSFDLINKCDSMNNEFYNNMATTLSQIKNTVDTSSNSMNKS--ISVMKGQV 866
            +  D     D     +  ++A  LSQ+  T++ +   M+KS  I+ + G V
Sbjct: 454 WSVLDAGRNTDPKARVWTTDVAVPLSQLPQTIEKTKQEMDKSKLINAIVGHV 505

>Kpol_1063.7 s1063 (19685..21463) [1779 bp, 592 aa] {ON}
           (19685..21463) [1779 nt, 593 aa]
          Length = 592

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 83/166 (50%), Gaps = 10/166 (6%)

Query: 635 IKSLKTTLFSQLSGMEQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKIL 694
           ++++  T+ S L G  ++ +  E NI  + D+I  + L   E + +  EL+  D   K L
Sbjct: 430 VEAVDKTIISLLQGDNKDIL--EKNIPMSADVISKKYLKEAEVVTQ--ELV--DITLKRL 483

Query: 695 NESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLN 754
           +   K  + + + ++  R+ F+     +A+N SD+S++  +L  +L+     +    L++
Sbjct: 484 HLKFKELDRLEDTLEKERIKFEEQTKQLADNRSDLSKQITDLNSHLEK-LSVSKKLVLIS 542

Query: 755 HHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSA 800
             +DST + +EK+     E   N     L++ K L ++ LTNA  A
Sbjct: 543 EQVDSTIKVVEKEEQTAAEEADNK---ELQKKKNLELEALTNAAPA 585

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 18/135 (13%)

Query: 322 EFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI------ 375
           E  I +A+E   LL    K+  V S  +N     S T   + L +  Q   F        
Sbjct: 367 EIDIDDAIE---LLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSD 423

Query: 376 ---SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHI---PFR 429
              S+  +VD+ G++++ +S  +  +  E   +N SLLTLG+ IN L      I   P  
Sbjct: 424 KTNSEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLA 480

Query: 430 ESKLTRLLQDSLGGN 444
           E  + R L++S  GN
Sbjct: 481 EFLIRRALKNSRLGN 495

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 135 TYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQ 170
           T T   D++ Y GE +D  GI P+  +K+ +T   Q
Sbjct: 33  TVTNVEDDEWYYGEYADKEGIFPKSFVKILETAPAQ 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,883,348
Number of extensions: 4393551
Number of successful extensions: 23178
Number of sequences better than 10.0: 1053
Number of HSP's gapped: 23706
Number of HSP's successfully gapped: 1486
Length of query: 999
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 879
Effective length of database: 39,721,479
Effective search space: 34915180041
Effective search space used: 34915180041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)