Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.56.17ON61961927980.0
YEL062W (NPR2)6.17ON61562023540.0
Skud_5.276.17ON61562023400.0
Smik_5.256.17ON61562022810.0
ZYRO0C07876g6.17ON68149914160.0
TDEL0G045206.17ON67950514040.0
CAGL0L13288g6.17ON64666613511e-179
KNAG0M011406.17ON59463813051e-173
Kpol_1045.726.17ON69550113071e-172
KLLA0D01067g6.17ON66068012981e-171
KLTH0C11308g6.17ON69070012891e-169
KAFR0L003806.17ON54062312681e-168
TPHA0J003106.17ON67567712281e-160
ACR009W6.17ON68050311871e-154
SAKL0E01100g6.17ON71036011131e-143
Kwal_56.224116.17ON68935810851e-139
Ecym_30216.17ON67435610721e-137
TBLA0G010106.17ON71038410641e-135
NCAS0H008706.17ON61236210391e-133
NDAI0D008606.17ON6664558144e-99
NCAS0A142907.374ON46980732.9
TDEL0C065701.45ON81050716.5
NDAI0C054008.520ON183899707.3
ZYRO0F17578g1.45ON81033707.4
KNAG0C005101.45ON78033699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.5
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)   1082   0.0  
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   911   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   905   0.0  
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   883   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   550   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   545   0.0  
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   525   e-179
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   507   e-173
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   508   e-172
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   504   e-171
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   501   e-169
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   493   e-168
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   477   e-160
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   461   e-154
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   433   e-143
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   422   e-139
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   417   e-137
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   414   e-135
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   404   e-133
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   318   4e-99
NCAS0A14290 Chr1 complement(2813830..2815239) [1410 bp, 469 aa] ...    33   2.9  
TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1...    32   6.5  
NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_...    32   7.3  
ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} high...    32   7.4  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    31   9.9  

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/619 (87%), Positives = 542/619 (87%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           QNQLLSKSERDPVFFDLKAIENSLL                        DKDAKDLRSNR
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
           FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
           DSVDQDLTSF                                          KDWRQSQT
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480
           SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF
Sbjct: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540
           GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT
Sbjct: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540

Query: 541 QTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGKS 600
           QTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGKS
Sbjct: 541 QTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGKS 600

Query: 601 KQEVENYLSELGEFKVINS 619
           KQEVENYLSELGEFKVINS
Sbjct: 601 KQEVENYLSELGEFKVINS 619

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/620 (73%), Positives = 496/620 (80%), Gaps = 6/620 (0%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNT KNYIIPKPILCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           QNQLLSKSERDPVFFDLK +ENS                          +KD KD+RS+R
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
                Y+D+IKDLGLP+S FSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 -----YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           TTCVSLEDVPLSSVNLKKIIDVNWDPTMM IVPYIDGLNSIAKISK S+SDP LVIECIR
Sbjct: 236 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIR 295

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMA+DCQSYVTFPE+SK+SNLPLNK+ 
Sbjct: 296 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSL 355

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
            S DQD  SF                                          KDWRQSQT
Sbjct: 356 GSGDQDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQT 415

Query: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480
           SCSS+N H I+ RN+FLPTRSCLFDLYRSLSQGQTLK+WYE K+  LKENNIDIRRFITF
Sbjct: 416 SCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITF 475

Query: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540
           GLE+ IIYRCYSFPVMI+ GSR+ KEMTP+ TK+  N D  L+KR++NH LS TGS++T 
Sbjct: 476 GLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTA 535

Query: 541 QT-NVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599
           Q+ N+K ERPSKVSFEMQR +SLATGK+ +PKLSDEE+ ILE+SIR+AE FDKICVLL K
Sbjct: 536 QSGNLKPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSK 595

Query: 600 SKQEVENYLSELGEFKVINS 619
            K EVE+YL+ELGEFKVINS
Sbjct: 596 PKLEVESYLNELGEFKVINS 615

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/620 (73%), Positives = 491/620 (79%), Gaps = 6/620 (0%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNTIKNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           QNQLLSKSE+D VFFDLKA+ENS +                        DKDAKDLRS+R
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
                YND+ KDLGLPES+FSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 -----YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           TTCVSLEDVPLSSVNLKKIIDVNWDPTMM IVPYIDGLNSIAKISK S SDPSLVIECIR
Sbjct: 236 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIR 295

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HLIYYKCVTLSDIFQFSNIYAPSSLIR FLTD LMA+DCQSYV FPEISK+S+LPL+KN 
Sbjct: 296 HLIYYKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNL 355

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
           DS D+D  S                                           KDWRQSQT
Sbjct: 356 DSADRDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQT 415

Query: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480
           S SS+N  A   RN+FLPTRSCLFDLYRSLSQG+TLKSWYE K   LKENNID+RRFITF
Sbjct: 416 SLSSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITF 475

Query: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540
           GLER IIYRCYSFPVM++V SR+ KEMT +  K+  N+D SLKK++ + S SV GSK++ 
Sbjct: 476 GLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSG 535

Query: 541 Q-TNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599
           Q  NVKSERPSKVSFEMQRA SLATG+  IPKLSDEE++ILE SIRSAE+FD ICVLL K
Sbjct: 536 QPNNVKSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSK 595

Query: 600 SKQEVENYLSELGEFKVINS 619
           SK EVENYL+ELGEFKVINS
Sbjct: 596 SKLEVENYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/620 (71%), Positives = 489/620 (78%), Gaps = 6/620 (0%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNTIKNYIIPKP+LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           QNQLLSKSE+DPVFFDLKA+ENS +                        DKDAKDLR++R
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
                YND++KD  LPESTFSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 -----YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           TTCVSLEDVPLSSVNL+KIIDVNWDPTMM IVPYIDGLNSIAKISK S+SDPSLVIECIR
Sbjct: 236 TTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIR 295

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HLIYYKCVTLSDIFQFSNIYAPSS IRNFLTDPLMA DCQ YVTFPE+SK+S+LPLNKN 
Sbjct: 296 HLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNL 355

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
            S D D  SF                                          +DWRQSQT
Sbjct: 356 TSGDLDSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQT 415

Query: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480
           SCSS+N H  + RN+FLPTRSCLFDLYRSLSQGQTLK+WYE K+  +K+NNIDIRRFITF
Sbjct: 416 SCSSSNIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITF 475

Query: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540
           GLE+ IIYR YS+PVM+ VG R+TKE  P+  K+  NE NS +K+ + HS S+  SK+  
Sbjct: 476 GLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAV 535

Query: 541 Q-TNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599
              N+KS RPSKVSF+MQ+A+SL TG++ IPKLSD+E++ILE+S+RSAENFDKICVLLGK
Sbjct: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGK 595

Query: 600 SKQEVENYLSELGEFKVINS 619
            K EVENYL+ELGEFK+INS
Sbjct: 596 PKLEVENYLNELGEFKIINS 615

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/499 (54%), Positives = 342/499 (68%), Gaps = 31/499 (6%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDL-RSN 179
           QNQ+LSK+E DP++FD K  +N+                          +K  K L +S 
Sbjct: 135 QNQILSKAENDPIYFDFKLADNT-----------------TEQDGKLNAEKSFKGLTKSQ 177

Query: 180 RFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRP 239
                KYN+I+KDL   +S FS+QDL+MRIFQDLNNYSECLIPID+GNAVDIKIFPL  P
Sbjct: 178 GMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTP 237

Query: 240 PTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECI 299
           P +C+S+EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+K S SD SLV+EC+
Sbjct: 238 PNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECV 297

Query: 300 RHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLN-- 357
           +HL+YY CV L+DIFQFSNIYAP+SLIR FLTDP +A++CQS+VT    S LS +P    
Sbjct: 298 KHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERL 357

Query: 358 KNFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQ 417
           + FD  D D +                                            +  ++
Sbjct: 358 RKFDLDDMDQSK-----------NQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQR 406

Query: 418 SQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRF 477
           SQ+S SSTNT+      + LPT++CLFDLYR+LSQG T++ WY L + T+K+N+ID+RRF
Sbjct: 407 SQSSFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRF 466

Query: 478 ITFGLERSIIYRCYSFPVM 496
           ITFG+ + +IYRC+SFPVM
Sbjct: 467 ITFGVIKGLIYRCFSFPVM 485

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 67/124 (54%), Gaps = 17/124 (13%)

Query: 512 TKEPSNEDNSLKKRDYNHSLSVTGSKSTTQTNV----KSERPSKVSFEMQRAN------S 561
           T EP + D+    R Y     V+ S + +  NV    K ER SKV+F+M + +      S
Sbjct: 559 TNEPGSRDDYPLSRIYREESHVSLS-ALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLS 617

Query: 562 LATGKNK------IPKLSDEEKKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFK 615
              GKNK      + +  + +K IL +SI +A+  DKICV L K + EVE  L ELG++K
Sbjct: 618 QQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYK 677

Query: 616 VINS 619
           +INS
Sbjct: 678 IINS 681

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/505 (52%), Positives = 336/505 (66%), Gaps = 34/505 (6%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL+SH INF+ IKNYIIPKP LCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDL---- 176
           QN +LSK+E+DP+F+  K +E                            D+DAK      
Sbjct: 121 QNLILSKAEKDPIFYHFKQVE-------------------------IKDDQDAKSKPEKG 155

Query: 177 -----RSNRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDI 231
                +S  +  EKY+ I+ D+   +STFS++DL++R++QDLNNYSECLIPID+GNAVDI
Sbjct: 156 SHNLSKSQAYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDI 215

Query: 232 KIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSD 291
           KIFP++ PP + +S+EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+K S SD
Sbjct: 216 KIFPMMTPPNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSD 275

Query: 292 PSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKL 351
           P LVIECI+HLIYY CV L+DIFQFSNIYAP+S +R FLTD +++T+CQSYV   E S L
Sbjct: 276 PGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTL 335

Query: 352 SNLPLNKNFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 411
             LP  +   S  + +                                            
Sbjct: 336 PRLPFKRVNHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESL 395

Query: 412 XKDWRQSQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENN 471
            +  + SQ+S SS NT+  +   ++LPT+SCLFDLYRSLSQG +L+ WY + + T++ N 
Sbjct: 396 YRTGKHSQSSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANR 455

Query: 472 IDIRRFITFGLERSIIYRCYSFPVM 496
           ID+RRFITFG+   +IYRCYS+P+M
Sbjct: 456 IDVRRFITFGVINGLIYRCYSYPIM 480

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 52/87 (59%), Gaps = 15/87 (17%)

Query: 546 SERPSKVSFEMQR-----ANSLATGKNKIPKLSDEEKK--------ILEKSIRSAENFDK 592
           S+RPSKVSF+ Q+     +  +++  +K+    DEE K        IL +S+ +A++ D 
Sbjct: 595 SDRPSKVSFDKQQEIGHISKGMSSSNDKVKM--DEEAKLERRERDLILLESVEAADSLDT 652

Query: 593 ICVLLGKSKQEVENYLSELGEFKVINS 619
           ICV L  S+ +VE  +  LGE+K+INS
Sbjct: 653 ICVKLEMSRYDVEALIQNLGEYKIINS 679

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  525 bits (1351), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 299/666 (44%), Positives = 395/666 (59%), Gaps = 69/666 (10%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L++ GINF++IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYG YRI CYPVT+NS IYAR           P++CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           QNQ+LSKSE D + F+LK+ + +                           KD        
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNF---NIDNDSSNYILGDDISSIMTTQQKDKY------ 171

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
              E+ N+II ++    S F+I DLLMR++QDLN YSECLIPIDDGNAVDIK+FPLL PP
Sbjct: 172 ---ERLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPP 228

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           T  +S+E VP+S VNL KI+DVNWDP M+ I+PYI+G+N+I +IS+ SH++ SLVIECIR
Sbjct: 229 TPYISIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIR 288

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNL---PLN 357
           HL+YY+C+ L+DIF+FSN+YAP+S +R FL DP MAT+CQSYV  P  SK+++L   P +
Sbjct: 289 HLVYYRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHH 348

Query: 358 KNFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQ 417
               + + D+ S                                           K+ +Q
Sbjct: 349 GKHSAFNGDIGS---------RNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQ 399

Query: 418 SQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRF 477
           S++S S+ N++     ++ LPTRS LFDLYRSLSQG TLK WY      +++N ID+RRF
Sbjct: 400 SESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRF 459

Query: 478 ITFGLERSIIYRCYSFPVM-----------------------------IHVGSRDTKEMT 508
           ITFG+ R IIYRC ++ V+                              H+ S    E  
Sbjct: 460 ITFGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEAL 519

Query: 509 PVATKEPSNE---DNSLKKRDYNH---SLSVTGSKSTTQTNVKSERPSKVSFEM--QRAN 560
             A K+ S +     +LK  + +H   SL+ T  +       +++R SKVSFE   +  N
Sbjct: 520 MNAYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRN 579

Query: 561 SLATGKN-KIP-------KLSDEEKKILEKSIRSAENFDKICVLLGKSKQEVENYLSELG 612
               G N K P       KLS  +++I+ K++  AE  DKICVLL   +Q V N L ELG
Sbjct: 580 GFRWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELG 639

Query: 613 EFKVIN 618
           E K+IN
Sbjct: 640 ELKLIN 645

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 287/638 (44%), Positives = 379/638 (59%), Gaps = 65/638 (10%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+ + INF+ IKNYIIPKP LCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YRIV YPV + S  YAR           PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFF--DLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRS 178
           Q+Q+LS++ERD   F  D    +N+                                 ++
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALIS-------------------KT 161

Query: 179 NRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR 238
             F+ +K  +   D+ L     S+QDL+MRI+QDLNNYSECLIPID+GNA+DIKIFPL+ 
Sbjct: 162 KSFSPDKKTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLIN 215

Query: 239 PPTTC-VSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIE 297
           PPT+  +S+EDVP+  V LKKIID+NWDPTM+ I+P+I+G+NSI  I++ S SDP LVIE
Sbjct: 216 PPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIE 275

Query: 298 CIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLN 357
           CI+HLIYYKCV ++DIFQFSNIYAPSSLI  FLTDP MA DCQ YVT P+ S+L ++PL 
Sbjct: 276 CIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335

Query: 358 KNFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQ 417
            +      +                                               + ++
Sbjct: 336 TSVPGSRNN--------------KHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKR 381

Query: 418 SQTSCSSTNTHAISKRNQ---FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDI 474
           S++S SS  T    + +    + PTR  LFDLYRSLSQG TL+ WY   FTT++ N ID+
Sbjct: 382 SESSLSSEGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDV 441

Query: 475 RRFITFGLERSIIYRCYSFPVM-IHVGSRDTKEM--TPVATKEPSNEDNSLKKRDYNHSL 531
           R+FI FG  + IIYR  S+PV+     S   K+M  + +A K P +++      D     
Sbjct: 442 RKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSKMAEKAPHSKNAFFSTSD----- 496

Query: 532 SVTGSKSTTQTNVKSERPSKVSFEMQRANS-------LATGKNKIPK----LSDEEKKIL 580
            +         N    R SKVSFE +R N+          G N   K    L+ EEK  L
Sbjct: 497 -IKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQL 555

Query: 581 EKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618
             ++ + E+FDKICV LG+S+ E+ N ++++GE++VIN
Sbjct: 556 LGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  508 bits (1307), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 263/501 (52%), Positives = 325/501 (64%), Gaps = 16/501 (3%)

Query: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLITFK 64
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL ++ INF++I++Y+IPKP LC+KL+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQNQL 124
           YG YRI+ YP+TIN  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSERDPVFFDLKAIENSLLXXXXXXX-----XXXXXXXXXXXXXXXXXDKDAKDLRSN 179
           LSK+E+D  +FD KAI +S L                               +A D + N
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 180 R-FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR 238
             +  EKY +I + +   ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 239 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIEC 298
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+K S SD  LVIEC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 299 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK 358
           I+H IYY CV +SDIFQFSNIYAP+SL+RNFLTDPLMAT+CQ+YVT PE S L  LPL  
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 359 ----NFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKD 414
                 DS   D  +                                            +
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYL------N 417

Query: 415 WRQSQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDI 474
             +S++S SS NT+ ++   + LPTRS LFDLYRSLSQG TLK WY+  F  ++ N IDI
Sbjct: 418 RHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDI 477

Query: 475 RRFITFGLERSIIYRCYSFPV 495
           R+FI FG+   ++YRC SFPV
Sbjct: 478 RKFIIFGIINGLLYRCQSFPV 498

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 11/80 (13%)

Query: 550 SKVSFEMQRAN---SLATGK-------NKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599
           SKVSF+ Q +N   S ++G        N + KL  + ++IL +++ S EN DKICVLL K
Sbjct: 617 SKVSFQ-QNSNMQYSASSGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEK 675

Query: 600 SKQEVENYLSELGEFKVINS 619
            + EVE  L  L +FKVINS
Sbjct: 676 PRSEVEEMLKHLVDFKVINS 695

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  504 bits (1298), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 282/680 (41%), Positives = 389/680 (57%), Gaps = 81/680 (11%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L++  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YAR           PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSKSE++PV+F LK+ +++                            +  D++S  
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITI--------------SEHTDIKSTG 166

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
            +GEKY +IIK+L   + +  I+DLLM++F DLNNYSECLIPID+GN++DIK+FP+  PP
Sbjct: 167 DDGEKYLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPP 226

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           ++ +S+EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+
Sbjct: 227 SSNISVEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIK 286

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HL+YY CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V    + K S LP    F
Sbjct: 287 HLMYYNCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQGDSL-KQSLLP----F 341

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
           +    ++                                               + ++  
Sbjct: 342 EGRPNNIYPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHA 401

Query: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480
           S +++     ++  + LPTRSCLFDLY+SLSQG+T+K WY+  F  +++N ID+R+ I F
Sbjct: 402 SENTSLATGENQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMF 461

Query: 481 GLERSIIYRCYSFPVMIHVGSRD------------------------TKEMTPVATKEPS 516
           G+ R +IYR  S+P++ +VG+ D                          ++  V TKE  
Sbjct: 462 GITRRLIYRVNSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEG 521

Query: 517 NEDNSLKKRD--------------------------YNHSLSVTGSKSTTQTNVKSERPS 550
           N+ + L   D                          Y+ S S      +T     S    
Sbjct: 522 NQSDKLDAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQ 581

Query: 551 KVSFEMQRANSLATGKNKIPKLSDEEKK-----------ILEKSIRSAENFDKICVLLGK 599
           KVSF+   A    T   ++P L D EK            IL +S+ +AE FDK+C  L K
Sbjct: 582 KVSFDFGTAGQQKT-VTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKK 640

Query: 600 SKQEVENYLSELGEFKVINS 619
           S+ EVE  L +LG + ++NS
Sbjct: 641 SRHEVELLLKDLGHYNIVNS 660

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  501 bits (1289), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 281/700 (40%), Positives = 378/700 (54%), Gaps = 91/700 (13%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG +R+VCYPV + +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSK+E   V+F LKA                                +     +  
Sbjct: 121 QSQILSKAENSSVYFQLKA--------RNTQKHGNTETAKGTEQPSSLDIGEIAQPENQG 172

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
           +   KY +I+KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK+FPLL PP
Sbjct: 173 YASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPP 232

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           ++C S+EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++KFS SD +LV+ECI+
Sbjct: 233 SSCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIK 292

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360
           HLIYY CV L+DIFQFSNIYA ++ +  FLT+P +A +CQ YV + E + L NLP  +  
Sbjct: 293 HLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGP 352

Query: 361 DSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQT 420
               Q                                                      T
Sbjct: 353 SRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNT 412

Query: 421 SCSSTNTHAISKRNQFLP--TRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFI 478
           S +S        + + +P  ++SCLFDLYRSL+QGQT++ WY+  F  ++   ID+RRFI
Sbjct: 413 SDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472

Query: 479 TFGLERSIIYRCYSFPVMIHVG-------------SRDTKEMTPVATKEPSNEDNSLKKR 525
           TFG+   +IYR YS+PV+ ++G             SR  K    + T +P N  N L   
Sbjct: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLN--NVLSAA 530

Query: 526 DYNHSLSVTGSKSTTQT-----------NVKSERPSKVSFEMQRANSLATGKNKIPKL-- 572
           D    L   G K+ ++             V S+   K++   ++ + +A G N I K+  
Sbjct: 531 DIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFG 590

Query: 573 -------------------------------------------------SDEEKK----I 579
                                                            S EEK+    I
Sbjct: 591 RNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELI 650

Query: 580 LEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVINS 619
           L KS+RS  NFDKIC LLGK ++ VE+ LSELG + V++S
Sbjct: 651 LLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  493 bits (1268), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 273/623 (43%), Positives = 367/623 (58%), Gaps = 87/623 (13%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+++ INF++IKN++IPKP LCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T +Y  YR+V YPV ++S  YAR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSKS+R   FF                                   KD +D+    
Sbjct: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
                           ++ FSIQDLLMR++QDLNNYSECLIPID+GN ++IKIFP+L+PP
Sbjct: 142 -------------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPP 188

Query: 241 TTC-VSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECI 299
           T+  +S+EDVPLS VNL KI+D+NWDPTM+ I+P+IDG+NSI  IS  S SDP+LVIECI
Sbjct: 189 TSVQISIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECI 248

Query: 300 RHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKN 359
           +HLIYY CV ++DIFQFSNIYAPSSLI NFL DP++A +CQSYV  P  SK+++LPL   
Sbjct: 249 KHLIYYNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASE 308

Query: 360 FDSV--DQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQ 417
            D    + D+T                                                Q
Sbjct: 309 QDDEINNSDMTQ-----------------KALSSSRSSFSSYFSHKSAYARVSETAHHHQ 351

Query: 418 SQTSCSSTNTHAISKR-NQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRR 476
           S ++ SS+     + R  Q LP++  LFDLYRSL+ G T+++WY+  F+T+KEN+ID+R+
Sbjct: 352 STSTLSSSEGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRK 411

Query: 477 FITFGLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGS 536
           FI FG+   IIYR + +P+M H      K        +  N+   L   D    +   G 
Sbjct: 412 FIKFGVINKIIYRVHQYPIMEH------KTFKSPLLSDRQNDKIVLSTSDIKFDV---GD 462

Query: 537 KSTTQTNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVL 596
           +     N    + SKV+F+  +      G ++   L + EK IL  ++   E+FD+IC  
Sbjct: 463 RI---LNSIYNKLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSK 517

Query: 597 LGKSKQEVENYLSELGEFKVINS 619
           LGKSK EVE+ +SE+GE+  INS
Sbjct: 518 LGKSKNEVESIISEIGEYMTINS 540

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  477 bits (1228), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 295/677 (43%), Positives = 382/677 (56%), Gaps = 62/677 (9%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIV YP+ INS +YAR           PY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQLLSKSERDPVFFDLKAI-------------ENSLLXXXXXXXXXXXXXXXXXXXXXX 167
           Q Q LSK E+D  +FD K I             +N++L                      
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 168 XXDK-DAKDLRSNRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDG 226
             DK ++K++    +   KYN I   +   +   S+ D+LMR+FQDLN+YSEC IPIDDG
Sbjct: 181 TQDKANSKEVE---YLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDG 237

Query: 227 NAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISK 286
           NA+DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ 
Sbjct: 238 NAIDIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIAN 297

Query: 287 FSHSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFP 346
            S+SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I +FLTDP +AT+CQ YVT P
Sbjct: 298 LSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSP 357

Query: 347 EISKLSNLPLNKNFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 406
           E S LS LP  K    V    ++                                     
Sbjct: 358 EDSLLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYP 417

Query: 407 XXXXXXKDWRQSQTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTT 466
                 ++ R+S++S SS N   + +   +LPT+S LFDLYRSLSQG  L+ WY++ F +
Sbjct: 418 NHDSIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNS 477

Query: 467 LKENNIDIRRFITFGLERSIIYRCYSFPVMIHVGS----RDTKEMTP----VATKEPSNE 518
           +++N IDIRRFI FG+ + IIYRC+S+P+  +  +     D K +      V  K  S  
Sbjct: 478 IRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYT 537

Query: 519 DNSLKKRDYN-------------HSLSV---------------TGSKSTTQTNVKSERPS 550
            N     D               H+L V               T  + TT  N + + PS
Sbjct: 538 YNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSINGQGQHPS 597

Query: 551 KVSFEMQR--------ANSLATGKNKIPK-LSDEEKKILEKSIRSAENFDKICVLLGKSK 601
           KV+F+ Q          N+L     K  + ++  +K  L  +++SAEN D IC  L  S+
Sbjct: 598 KVAFKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNICSNLELSR 657

Query: 602 QEVENYLSELGEFKVIN 618
           +EVE  L+EL E+++IN
Sbjct: 658 EEVETLLNELTEYRIIN 674

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 231/503 (45%), Positives = 309/503 (61%), Gaps = 19/503 (3%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFK+G+YR+VCYPV I +P YAR           PYD  TSPYEPAI RL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSK ERDPV++ LK  E                            DK +   R+  
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETK--------AAEQKTEESDSKAKTHNLDKKS---RAQH 176

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
               KY++I+K +   E    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 177 NATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPP 236

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
            +C+S EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S S   LV+ECI+
Sbjct: 237 NSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIK 296

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK-- 358
           HL+YY CV L D+FQFSNIYAP++L+R+FL D ++  +CQ YV   E  ++  LP     
Sbjct: 297 HLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRP 356

Query: 359 NFDSVDQDLTSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQS 418
           N         S                                           KD+  +
Sbjct: 357 NGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYN 416

Query: 419 QTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFI 478
           +    S N  +  KR   LPTR  LFDLYRSL+QGQTLK WY+  ++ ++EN ID+RR I
Sbjct: 417 R----SRNLESNCKRT--LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470

Query: 479 TFGLERSIIYRCYSFPVMIHVGS 501
            FG+   +IYRCYS+PV   +G+
Sbjct: 471 IFGVFHRLIYRCYSYPVAKSIGT 493

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 12/116 (10%)

Query: 509 PVAT--KEPSNEDNSLKKRDYNHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANSLATGK 566
           P+A   + PS+ + ++K      S+S   +   T  ++++   SK +   ++ N      
Sbjct: 572 PIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRIT-FDIRNRHVSKDNEHREQQNE----- 625

Query: 567 NKIPKLSDEEKK---ILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVINS 619
             IP L  +++    +L +S++S ++FDKI V L  +K EVE  L   GE+ ++NS
Sbjct: 626 -DIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  433 bits (1113), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 267/360 (74%), Gaps = 5/360 (1%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+++ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YR+ CYPV +N+  YAR           PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXD-KDAKDLRSN 179
           Q+Q+LSK+E DPV+F LK+ E+S                          + +D+K+    
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 180 RFNG---EKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPL 236
              G   EKY++I+ DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 237 LRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVI 296
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+KFS SD  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 297 ECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPL 356
           EC++HLIYY CV L+DIFQFSNIYA +SLI  FLTDP +A++CQ+YVT  ++ +L  LP 
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRLPF 359

 Score =  105 bits (262), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 65/88 (73%), Gaps = 2/88 (2%)

Query: 416 RQSQTSCSSTNTHAISKRNQ--FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNID 473
           R    S  ST   A+ ++     LPT+SCLFDLYRSL QG+T+K WY++ F  +++N+ID
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477

Query: 474 IRRFITFGLERSIIYRCYSFPVMIHVGS 501
           +RRFITFG+ R +IYRCY++PVM ++G+
Sbjct: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGA 505

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 9/97 (9%)

Query: 532 SVTGSKSTTQTNVKSERPSKVSFEMQRANSLATGKNKIPKLSD---------EEKKILEK 582
           S  GS+  + + ++SE  SKV+FE  R+        K  +  +          E+ +L K
Sbjct: 614 SRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEFLLLK 673

Query: 583 SIRSAENFDKICVLLGKSKQEVENYLSELGEFKVINS 619
           S++S + FDKIC+ L K ++EVE  L E+G + +INS
Sbjct: 674 SVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  422 bits (1085), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/358 (54%), Positives = 257/358 (71%), Gaps = 8/358 (2%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L++  I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG++R+VCYPV + +P YAR           PYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSK+E   V+F LK  ++                           + +A    S+ 
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSH--------KHTNQEPVNDNELQGTLKNNEASQSESHG 172

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
           +  EKY++I+KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK+FPLL PP
Sbjct: 173 YAFEKYHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPP 232

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
           ++C+S EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++K S SD +LV+ECIR
Sbjct: 233 SSCLSFEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIR 292

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK 358
           HL+YY CV L+DIFQF NIYAP+S +  FLT+P +AT+CQ YVT  E + +S+LP  +
Sbjct: 293 HLLYYNCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

 Score =  123 bits (309), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 132/263 (50%), Gaps = 82/263 (31%)

Query: 436 FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFPV 495
           F  ++SCLFD+YRSLSQGQT+K WY+  F  ++   ID+RRFITFG+   ++YRCYSFP+
Sbjct: 428 FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPI 487

Query: 496 MIHVG---------------SRDTKEMTPVATKEPSN--------------EDNSLKKRD 526
           M +VG               S + K ++     EP+N                + L++R 
Sbjct: 488 MKNVGYLEVVKALGLSDGDSSTEGKWLS--GNSEPTNNVLSAAEIRIGLESSSSKLRERR 545

Query: 527 YNH----------------SLSVTGSK---------------------STTQTNVK---- 545
           +NH                 L++  +K                     S+ +T+VK    
Sbjct: 546 FNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVS 605

Query: 546 ---SERPSKVSFEMQRANSLATG----KNKIPKLSDEEKK---ILEKSIRSAENFDKICV 595
              S+  + V+F+++R  + AT     K ++ +L ++++K   +L KS+R  ENFDKIC 
Sbjct: 606 TAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKICT 665

Query: 596 LLGKSKQEVENYLSELGEFKVIN 618
            LG+ ++EVE  L +LG + V++
Sbjct: 666 RLGRDREEVEKMLEDLGPYNVVH 688

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  417 bits (1072), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 259/356 (72%), Gaps = 9/356 (2%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L++ GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG+YR+VCYPV IN+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRSNR 180
           Q+Q+LSK ERDP+++ LK  +                            DK  +    + 
Sbjct: 121 QSQVLSKIERDPIYYHLKTQD-------VKAVDQNSEEPESKNNPQNCNDKIRRGHHEHA 173

Query: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240
           F  EKY++I+K + + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 174 F--EKYHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP 231

Query: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300
            +C S+EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK+S SD  LV+EC++
Sbjct: 232 NSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVK 291

Query: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPL 356
           HLIYY CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S+L  LP 
Sbjct: 292 HLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 122/252 (48%), Gaps = 66/252 (26%)

Query: 434 NQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSF 493
           N+ LPTRSCLFDLYRSLSQGQT+K WY++ F  +++N ID+RRFITFG+ R +IYRCYS+
Sbjct: 423 NRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSY 482

Query: 494 PVMIHVGSRDTKE-----------MTP---------------VATKEPS---------NE 518
           PV   +G+ D  +           M+P               V   EPS         N 
Sbjct: 483 PVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKPLVPNT 542

Query: 519 D-------NSLKKRDYNHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANSLATGKNKI-- 569
           D       ++ KK   N  L     + T    +  E  +  + + ++ +S  +G  K+  
Sbjct: 543 DAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTAKVLF 602

Query: 570 ---PKLSDEEKKILEKSIRSAE-------------------NFDKICVLLGKSKQEVENY 607
               +LS+++ +  +++  S E                   +FDKI + L  +KQEVE  
Sbjct: 603 DMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQEVEEL 662

Query: 608 LSELGEFKVINS 619
           L   GE+ +INS
Sbjct: 663 LKATGEYNIINS 674

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  414 bits (1064), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 268/384 (69%), Gaps = 42/384 (10%)

Query: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60
           M  +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+++ INF+TIKNYIIPKP LCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFD-----LKAIENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKD 175
           QNQLLS++E D V+FD     L + ++S++                        DK+   
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQ----------------------DKNTSI 158

Query: 176 L--RSNRFNGEKYNDIIKDLGLPE-------STFSIQDLLMRIFQDLNNYSECLIPIDDG 226
           L     RF+  K      DL L E       S FS+QDL+MRIFQDLNNYSECLIPID+G
Sbjct: 159 LGFSRKRFSFSKRP---TDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEG 215

Query: 227 NAVDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISK 286
           N+VDIKIFP + PP+  +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ 
Sbjct: 216 NSVDIKIFPSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAA 275

Query: 287 FSHSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFP 346
            S+SD   V+ECIRHL+YY+ V LSDIFQF+NIYAP+S +R+FLTD  +ATDCQ+YV  P
Sbjct: 276 LSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLP 335

Query: 347 EISKLSNLPLNKNFDSVDQDLTSF 370
           + S    LPL K   S++ DL  +
Sbjct: 336 KNSNFGKLPLEK---SINTDLDEY 356

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 51/69 (73%)

Query: 432 KRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCY 491
           + + +LPT+SCLFDLYRSLSQG  L  WY   ++ +  N IDIRRFITFGL R ++YRCY
Sbjct: 401 RTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCY 460

Query: 492 SFPVMIHVG 500
           + P+M + G
Sbjct: 461 AIPIMKNAG 469

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 21/108 (19%)

Query: 525 RDYNHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANS------------LATGKNKIPKL 572
           RD+++  ++ G  S+   N       KVSF + R +             L + K+ I + 
Sbjct: 609 RDFSNGSNIVGYGSSNTGN-------KVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQ 661

Query: 573 SDEE--KKILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618
            ++   +++L +S+R A+N DKIC+ L K ++EVE  LSE+G++ +IN
Sbjct: 662 QEKNHIRRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  404 bits (1039), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/362 (54%), Positives = 256/362 (70%), Gaps = 21/362 (5%)

Query: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62
           ++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL +  INF+TIKNYIIPK  LC++L+T
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 122
           FKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ+
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QLLSKSERDPVFFDLKAI----ENSLLXXXXXXXXXXXXXXXXXXXXXXXXDKDAKDLRS 178
           Q+LSK+E DP++F    +      +++                        + D      
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETD------ 183

Query: 179 NRFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLR 238
             F GE+ + + K        FS+QDL+MRI+QDLNNYSECLIPID GN ++IK+FPLL+
Sbjct: 184 --FFGEEEDGVTK--------FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLK 233

Query: 239 PPTT-CVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIE 297
           PP    +SLEDVP+S +NL  +IDVNWDPTM+ IVPYI+G+N I+KI+K + +DP LVIE
Sbjct: 234 PPPNHLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIE 293

Query: 298 CIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLN 357
           CI+HL+YY CV ++DIFQFSN+YAP+SLI +FLTD  MAT CQ+YV  P  SKLS+LP  
Sbjct: 294 CIKHLVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE 353

Query: 358 KN 359
            N
Sbjct: 354 NN 355

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 118/213 (55%), Gaps = 48/213 (22%)

Query: 437 LPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFPVM 496
           LPT++CLFDLYRSLS G TL+SWY+   T + ENN+D+R+FI FG+ R +IYRC+S+P+ 
Sbjct: 414 LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI- 472

Query: 497 IHVGSRDTKEMTPVATKEPSNEDNSLKKRDYN---HSLSVTGSKSTTQT----------- 542
                           + PSNE     +R  +   H L +  S S  ++           
Sbjct: 473 ---------------PQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSAS 517

Query: 543 ----NV------------KSERPSKVSF-EMQRANSLATGKNKIPK-LSDEEKKILEKSI 584
               NV            K ER SKVSF + ++  S+ T +   P  ++ EE+ +L KSI
Sbjct: 518 PSSINVDGADELLKNVYKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSI 577

Query: 585 RSAENFDKICVLLGKSKQEVENYLSELGEFKVI 617
            S EN DKICV LGKS+Q+VE +L ELG +K+I
Sbjct: 578 ESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  318 bits (814), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 266/455 (58%), Gaps = 48/455 (10%)

Query: 198 STFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 256
           S  S+QDL+MRI+QDLNNYSECLIPIDDGN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284

Query: 257 KKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRHLIYYKCVTLSDIFQF 316
            KI DVNWDPTM+ ++P+I+G+N I+KISK S+S P LVIECI+HLIYY CV ++DIFQF
Sbjct: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344

Query: 317 SNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNFDSVDQDLTSFXXXXXX 376
           SN Y+ +SLI  FLTDP MAT CQ+YV  P  SKL+ LP +   ++  Q  +++      
Sbjct: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAY------ 398

Query: 377 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDWRQSQTSCSSTNTHAISK--RN 434
                                                D +QS+TS +S+N  + S     
Sbjct: 399 --------RHHHNRHEKTPSFGSSITSNNGRSSFSADDRKQSETSLNSSNDPSNSNLIST 450

Query: 435 QFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFP 494
             LPT+  LF+LYRSL+Q   LK+WY+L +TT+ ENNIDIR+FI FG+ + +IYRC+S+P
Sbjct: 451 AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYP 510

Query: 495 VMIH---VGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLS----------VTGSKSTTQ 541
           ++I          K  +P  +    +     K+      +S           +G + T  
Sbjct: 511 IVITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRD 570

Query: 542 TNVKS--------ERPSKVSFEMQRA------NSLATGKNKIPK----LSDEEKKILEKS 583
             +KS        +  SKVSF  + A      +  AT  +   K    L+ +++ IL  S
Sbjct: 571 KLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDS 630

Query: 584 IRSAENFDKICVLLGKSKQEVENYLSELGEFKVIN 618
           I + +N DKICV LG+ + ++E +LSE G++KVIN
Sbjct: 631 ISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

 Score =  203 bits (517), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 90/133 (67%), Positives = 109/133 (81%)

Query: 3   SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKLIT 62
           ++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL +  I+F+ IKNYIIPK  LC+KL+T
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 63  FKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQN 122
           FKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQN
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 123 QLLSKSERDPVFF 135
           Q+LSK+E DP++F
Sbjct: 131 QILSKAENDPIYF 143

>NCAS0A14290 Chr1 complement(2813830..2815239) [1410 bp, 469 aa]
           {ON} Anc_7.374
          Length = 469

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 17/80 (21%)

Query: 450 LSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFPVMIHVGSRDTKEMTP 509
           L  G+++ SW    FT ++  N    + I+F L+R +IY  + FP        D   +  
Sbjct: 294 LKDGESIDSW----FTRIRGKNY--SKPISFALKRRVIYNYFEFPA-------DDSSVFD 340

Query: 510 VATKEPSNEDNSLKKRDYNH 529
           + TK+P +  N    +D NH
Sbjct: 341 ITTKKPQDRFN----QDSNH 356

>TDEL0C06570 Chr3 (1206296..1208728) [2433 bp, 810 aa] {ON} Anc_1.45
           YCL030C
          Length = 810

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 7/50 (14%)

Query: 294 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYV 343
           +V +CI H     C +  + F  SN YAP  LI       L  T+ Q YV
Sbjct: 669 IVRKCIAHSAIITCGSYEEAFDISNQYAPEHLI-------LQITNAQDYV 711

>NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_8.520
          Length = 1838

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 15/99 (15%)

Query: 254  VNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHS-DPSLVIECIRHLIYYKCVTLSD 312
            V    ++   +DPT+  ++  + G +    ISK   + D + +  C+ ++ Y K +  SD
Sbjct: 998  VTAGTVVSAEYDPTLAKLI--VHGKDRNDAISKLIQALDETKLYGCVTNIDYLKSIVSSD 1055

Query: 313  IFQFSNI---------YAPSSLIRNFLTDPLMATDCQSY 342
            +F+ + +         YAPS++    +T P   T  Q Y
Sbjct: 1056 MFKEARVSTNVLNFYDYAPSAI---EITSPGAHTSVQDY 1091

>ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} highly
           similar to uniprot|P00815 Saccharomyces cerevisiae
           YCL030C
          Length = 810

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 294 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 326
           +V++CI H     C +  + F+ SN YAP  LI
Sbjct: 669 IVVKCIAHSAIILCGSYDEAFKISNQYAPEHLI 701

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 294 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 326
           +V +CI H    KC +  + F  SN YAP  LI
Sbjct: 639 IVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,968,305
Number of extensions: 2673663
Number of successful extensions: 10180
Number of sequences better than 10.0: 71
Number of HSP's gapped: 10613
Number of HSP's successfully gapped: 116
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)