Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.41.83ON59059029890.0
Skud_5.261.83ON59059027520.0
YEL063C (CAN1)1.83ON59058927380.0
Smik_5.241.83ON59059027050.0
NDAI0A006101.83ON56556422170.0
KNAG0C007901.83ON57951321730.0
NCAS0B085701.83ON53253221340.0
TDEL0C061801.83ON58359220810.0
CAGL0J08184g1.83ON57252120570.0
TPHA0B044801.83ON60351420360.0
Smik_14.671.83ON57355620130.0
KAFR0D007001.83ON57455520020.0
YNL270C (ALP1)1.83ON57353919840.0
Kpol_2000.651.83ON59555719650.0
Skud_14.701.83ON57352619580.0
SAKL0C02684gsingletonON58858619520.0
TBLA0A054501.83ON60652319530.0
NDAI0F042001.83ON56656519480.0
NCAS0A006001.83ON54453519430.0
SAKL0C02662g1.83ON54852319270.0
Suva_14.731.83ON49747919060.0
KNAG0C05920singletonON59959319170.0
SAKL0C02640gsingletonON54856319010.0
Kwal_33.134011.83ON55955618980.0
ZYRO0F16654g1.83ON58057018890.0
KLLA0C02343g1.83ON58159018850.0
KLTH0F02398g1.83ON55555618630.0
Kpol_2000.641.84ON61054918680.0
YNL268W (LYP1)1.84ON61159818310.0
TDEL0C061701.84ON57356818210.0
NDAI0F041901.84ON59957918190.0
TBLA0A054601.84ON60858518160.0
TPHA0B044701.84ON59958418140.0
Smik_14.681.84ON61150818120.0
CAGL0J08162g1.84ON59751218010.0
Ecym_10871.83ON57058617930.0
Skud_14.711.84ON61260317900.0
NCAS0A006101.84ON60751317890.0
KAFR0D039401.83ON59758817870.0
Suva_14.751.84ON61159917830.0
Kwal_33.134111.84ON56051717670.0
KNAG0F004801.84ON59752817670.0
KLTH0F02420g1.84ON62156217600.0
Ecym_10881.84ON56752017480.0
SAKL0C02728g1.84ON56255317470.0
KLLA0C02365g1.84ON57957517430.0
AFR667C1.84ON56356016640.0
ZYRO0F16632g1.84ON60751416270.0
AFR668W1.83ON55653016180.0
Kpol_358.3na 1ON5755299201e-116
CAGL0A01199gna 1ON6135409041e-113
SAKL0G14916gna 1ON5815598991e-113
Kwal_33.15545na 1ON5765388691e-108
TPHA0M00130singletonON6115218661e-108
Smik_6.473na 1ON6065538641e-107
KAFR0B06430singletonON5935198621e-107
YPL265W (DIP5)na 1ON6085968631e-107
Suva_16.40na 1ON6065518581e-106
KLLA0E16281gna 1ON6055708551e-106
Kwal_26.69407.44ON5705708511e-106
Skud_16.12na 1ON6075728531e-106
TPHA0H028507.44ON6015838491e-105
Ecym_2480na 1ON5865138431e-104
TBLA0A07060na 1ON6255158431e-104
KLTH0B01166gna 1ON5775028391e-104
NCAS0D02260na 1ON5975348381e-104
KNAG0L02470singletonON6385098241e-101
Ecym_80357.44ON5635628131e-100
KNAG0E003907.44ON5995988151e-100
NDAI0I02660na 1ON5945678111e-100
Kwal_27.126811.244ON5935868082e-99
CAGL0E05632g7.44ON5985438073e-99
SAKL0C01232gsingletonON6135268074e-99
NDAI0E038007.44ON6215848076e-99
SAKL0F09790gsingletonON5585528019e-99
AFR156W7.44ON5585268001e-98
KNAG0L02460singletonON5885228021e-98
TDEL0H040707.44ON5775768002e-98
NDAI0B052201.244ON6115908032e-98
KLTH0D01474g7.44ON6245237981e-97
TDEL0C00930singletonON5955817952e-97
ZYRO0D17908gna 1ON5184877882e-97
Suva_2.6881.50ON6615407983e-97
TPHA0B010901.244ON6065567944e-97
Kwal_33.154075.158ON5875527915e-97
KLTH0E15642g1.244ON5965837891e-96
ZYRO0D03762g1.244ON6005537891e-96
YOR348C (PUT4)7.44ON6275887903e-96
SAKL0B10956g7.44ON5725697844e-96
SAKL0D00836gna 2ON6015707864e-96
KLTH0B02046g5.158ON5895377847e-96
NCAS0E022607.44ON5935847848e-96
Ecym_60211.244ON6005517822e-95
Kpol_367.77.44ON5845767812e-95
Skud_11.2751.244ON6025527803e-95
SAKL0G14014g5.158ON6055547795e-95
TBLA0C01240singletonON6295527798e-95
CAGL0K05753g1.50ON6605897811e-94
Suva_8.4027.44ON6835837812e-94
Smik_15.5327.44ON6315537754e-94
KNAG0C02140singletonON5985717725e-94
YGR191W (HIP1)5.158ON6035337726e-94
Kpol_543.791.244ON6055127717e-94
Smik_16.1155.158ON6035287709e-94
TBLA0A05190na 3ON6675647741e-93
YDR508C (GNP1)1.50ON6635567722e-93
Suva_7.4855.158ON6035227673e-93
NCAS0A071105.158ON5925387655e-93
Skud_4.7841.50ON6635687705e-93
CAGL0B03773g5.158ON6055657657e-93
Skud_15.5157.44ON6265817659e-93
TDEL0A08030singletonON5145037579e-93
Smik_4.7901.50ON6635457671e-92
CAGL0B01012g1.50ON6235337642e-92
KAFR0D00520na 3ON5985767612e-92
KAFR0D005001.50ON6175917622e-92
KAFR0D00510na 4ON6176037604e-92
SAKL0C01650g1.50ON6135267597e-92
ACL135Wna 1ON5885277567e-92
YKR039W (GAP1)1.244ON6025527578e-92
SAKL0D02970g3.284ON6015707579e-92
NCAS0B085801.50ON6275647581e-91
NDAI0A006401.50ON6415147563e-91
NDAI0D021605.158ON5875097524e-91
NCAS0B079001.244ON6195407534e-91
Kwal_33.132041.50ON6075987526e-91
SAKL0D04664g1.244ON5935877516e-91
Skud_7.5255.158ON6035177509e-91
Suva_2.716singletonON6035617491e-90
KAFR0D04120na 3ON6485637521e-90
KAFR0C051607.44ON5845537472e-90
TBLA0A051801.50ON6765647532e-90
KLLA0A11770g5.158ON5815757452e-90
Suva_4.3073.284ON6095207464e-90
Skud_3.381.50ON6335967484e-90
YCL025C (AGP1)1.50ON6335697467e-90
CAGL0L03267g1.244ON5975547431e-89
Kwal_23.4026singletonON5345217381e-89
TDEL0C065101.50ON6425747461e-89
NDAI0G060301.368ON5995847421e-89
Ecym_47895.158ON5885197411e-89
YBR068C (BAP2)3.284ON6095897421e-89
TBLA0B077605.158ON6586037426e-89
TDEL0F02830na 5ON5615367356e-89
KAFR0E018505.158ON5605267347e-89
KNAG0G009005.158ON6135727387e-89
Smik_3.531.50ON6335087398e-89
Suva_3.1891.50ON6335977399e-89
KLLA0F23419g7.44ON5735737303e-88
AGR319W5.158ON6265267344e-88
Smik_11.3021.244ON5535057268e-88
Skud_2.1913.284ON6095207308e-88
Suva_11.2731.244ON6015417272e-87
AFR230C1.244ON6045947273e-87
AGR038C3.284ON5805407253e-87
KLLA0A06886gsingletonON5875687253e-87
TPHA0A047005.158ON5694937233e-87
AFR698C1.50ON6095117264e-87
Smik_4.2843.284ON6045367245e-87
NCAS0A004201.50ON6795847297e-87
KLLA0C01606g1.50ON6205567249e-87
Kpol_1010.325.158ON5995897221e-86
Ecym_10561.50ON6065677212e-86
TBLA0G031203.284ON6735287252e-86
TPHA0E036601.50ON6475067233e-86
KLTH0C05170g3.284ON5985437193e-86
NDAI0C029505.158ON6095457203e-86
KNAG0F002701.50ON6345927213e-86
Smik_2.2013.284ON6095227186e-86
ZYRO0G07172gna 5ON5675507156e-86
Kwal_33.14276na 2ON5965287168e-86
NCAS0D018705.158ON5955157159e-86
YDR046C (BAP3)3.284ON6045857151e-85
YOL020W (TAT2)1.368ON5925217132e-85
NCAS0J00140na 6ON5585037084e-85
KLTH0F01584g1.50ON5965117114e-85
Skud_6.2na 6ON5585117084e-85
Ecym_26643.285ON5755437095e-85
NDAI0A056203.284ON5715257085e-85
CAGL0D02178g1.368ON5775247096e-85
Skud_15.1381.368ON5925857096e-85
Suva_15.1481.368ON5925237097e-85
Kpol_543.78singletonON6055877107e-85
TPHA0A002405.158ON6035127108e-85
Kpol_2002.441.50ON6275887118e-85
Suva_2.2033.284ON6045367081e-84
KAFR0A011203.284ON5925317071e-84
CAGL0H08393g3.284ON6125327063e-84
ZYRO0F17446g1.50ON6335157065e-84
Kpol_2000.921.50ON6375237065e-84
SAKL0C13992gsingletonON5524896998e-84
KLLA0A06930g1.244ON5875377028e-84
NDAI0A01340singletonON5545096972e-83
KNAG0L00110na 6ON5715256972e-83
AEL030W1.368ON5825716982e-83
KAFR0D041401.50ON6375287023e-83
KLLA0F27093gsingletonON5634846963e-83
CAGL0M00154gsingletonON5505286935e-83
NCAS0A089201.368ON5995076975e-83
KLTH0B00154gna 7ON5565216929e-83
Skud_4.3003.284ON6045886951e-82
Kwal_8.590na 7ON6295246961e-82
Smik_13.1singletonON5235056881e-82
KNAG0C005901.50ON6345066961e-82
Ecym_26623.284ON5895236932e-82
TBLA0C012101.368ON6005206923e-82
NCAS0A106803.284ON5935306913e-82
Smik_15.1461.368ON5935326914e-82
SAKL0F16544gsingletonON5675706885e-82
KLTH0F01606gna 3ON6045376906e-82
AGR039Cna 8ON5865326888e-82
Ecym_8297na 9ON5695396869e-82
NCAS0I015303.284ON5955346871e-81
NDAI0F043901.50ON6674996912e-81
YFL055W (AGP3)na 6ON5585426842e-81
Kwal_27.105383.284ON6025406872e-81
KAFR0C004003.284ON5825306843e-81
KLLA0A10813g1.368ON5845216825e-81
SAKL0A09724gna 10ON5515296771e-80
Kpol_534.221.368ON5925426801e-80
Sklu_YGOB_Anc_1.3681.368ON5415176752e-80
Ecym_27161.368ON5925276764e-80
SAKL0D02926g3.285ON5835216755e-80
ZYRO0C18502g7.44ON5755546747e-80
Kwal_23.2817na 11ON5805456721e-79
KNAG0H011503.284ON6175296751e-79
ZYRO0A00308gsingletonON5645146712e-79
KLLA0B14685gna 11ON5715766712e-79
KNAG0J022003.284ON6076026732e-79
TDEL0E05750singletonON5485346682e-79
KAFR0F02250singletonON5545296683e-79
Kwal_26.9612singletonON5434686673e-79
NDAI0A074903.284ON5965636704e-79
ADL272Wna 9ON5645126659e-79
TPHA0M012003.284ON6075746671e-78
KLTH0F04048gsingletonON5835486642e-78
SAKL0D02948gna 8ON5945256643e-78
ZYRO0G12342g3.284ON6205446645e-78
SAKL0H08184gna 9ON5985616618e-78
KLTH0H13398g1.368ON5874556601e-77
Smik_6.482na 12ON5585376571e-77
AGR040C3.285ON5735316546e-77
Ecym_2663na 8ON5895246547e-77
Suva_13.517singletonON5475566518e-77
TBLA0I020003.284ON6645676544e-76
KLTH0D07128gna 10ON5435626455e-76
Kpol_1065.133.284ON5965246486e-76
Kwal_34.16254singletonOFF4814406397e-76
Kwal_YGOB_34.162541.368ON4914406399e-76
Kwal_26.8097na 10ON5445286431e-75
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.4
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...  1155   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...  1064   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...  1059   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...  1046   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   858   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              841   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            826   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   806   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   796   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   788   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   780   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   775   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   768   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   761   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   758   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   756   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   756   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            754   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   753   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   746   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   738   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            743   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   736   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   735   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   732   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   730   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   722   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   724   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   709   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   706   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   705   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   704   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   703   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   702   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   698   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   695   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   694   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              693   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   692   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   691   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   685   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                685   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   682   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   677   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   677   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   676   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   645   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   631   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   627   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   358   e-116
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   352   e-113
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   350   e-113
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   339   e-108
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     338   e-108
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   337   e-107
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   336   e-107
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   337   e-107
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   335   e-106
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   333   e-106
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   332   e-106
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   333   e-106
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   331   e-105
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   329   e-104
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   329   e-104
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   327   e-104
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              327   e-104
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             322   e-101
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   317   e-100
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   318   e-100
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   317   e-100
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   315   2e-99
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   315   3e-99
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   315   4e-99
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     315   6e-99
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   313   9e-99
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   312   1e-98
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             313   1e-98
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   312   2e-98
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   313   2e-98
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   311   1e-97
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   310   2e-97
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   308   2e-97
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   311   3e-97
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   310   4e-97
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   309   5e-97
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   308   1e-96
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   308   1e-96
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   308   3e-96
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   306   4e-96
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   307   4e-96
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   306   7e-96
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     306   8e-96
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   305   2e-95
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   305   2e-95
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   305   3e-95
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   304   5e-95
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   304   8e-95
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   305   1e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   305   2e-94
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   303   4e-94
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   301   5e-94
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   301   6e-94
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   301   7e-94
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   301   9e-94
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   302   1e-93
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   301   2e-93
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   300   3e-93
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   299   5e-93
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   301   5e-93
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   299   7e-93
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   299   9e-93
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            296   9e-93
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   300   1e-92
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   298   2e-92
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   297   2e-92
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      298   2e-92
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      297   4e-92
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   296   7e-92
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   295   7e-92
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   296   8e-92
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   296   9e-92
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   296   1e-91
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   295   3e-91
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    294   4e-91
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   294   4e-91
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   294   6e-91
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   293   6e-91
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   293   9e-91
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   293   1e-90
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   294   1e-90
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   292   2e-90
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   294   2e-90
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   291   2e-90
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   291   4e-90
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   292   4e-90
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   291   7e-90
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   290   1e-89
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   288   1e-89
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   291   1e-89
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   290   1e-89
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   290   1e-89
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   290   1e-89
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   290   6e-89
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   287   6e-89
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   287   7e-89
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   288   7e-89
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   289   8e-89
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   289   9e-89
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   285   3e-88
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   287   4e-88
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   284   8e-88
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   285   8e-88
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   284   2e-87
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   284   3e-87
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   283   3e-87
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   283   3e-87
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   283   3e-87
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   284   4e-87
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   283   5e-87
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   285   7e-87
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   283   9e-87
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   282   1e-86
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   282   2e-86
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              283   2e-86
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   283   3e-86
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   281   3e-86
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    281   3e-86
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   282   3e-86
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   281   6e-86
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   280   6e-86
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   280   8e-86
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   280   9e-86
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   280   1e-85
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   279   2e-85
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      277   4e-85
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   278   4e-85
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      277   4e-85
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   277   5e-85
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            277   5e-85
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   277   6e-85
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   277   6e-85
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   277   7e-85
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   278   7e-85
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   278   8e-85
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   278   8e-85
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   277   1e-84
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   276   1e-84
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   276   3e-84
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   276   5e-84
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   276   5e-84
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   273   8e-84
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   275   8e-84
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              273   2e-83
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   273   2e-83
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   273   2e-83
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              275   3e-83
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   272   3e-83
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   271   5e-83
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   273   5e-83
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   271   9e-83
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   272   1e-82
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   272   1e-82
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    269   1e-82
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   272   1e-82
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   271   2e-82
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   271   3e-82
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   270   3e-82
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   270   4e-82
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   269   5e-82
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   270   6e-82
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   269   8e-82
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   268   9e-82
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              269   1e-81
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   270   2e-81
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   268   2e-81
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   269   2e-81
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                268   3e-81
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   267   5e-81
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   265   1e-80
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   266   1e-80
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   264   2e-80
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   265   4e-80
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   264   5e-80
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   264   7e-80
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   263   1e-79
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              264   1e-79
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   263   2e-79
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   263   2e-79
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   263   2e-79
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            261   2e-79
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              261   3e-79
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   261   3e-79
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   262   4e-79
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   260   9e-79
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   261   1e-78
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   260   2e-78
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   260   3e-78
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   260   5e-78
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   259   8e-78
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   258   1e-77
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   257   1e-77
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   256   6e-77
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   256   7e-77
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   255   8e-77
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   256   4e-76
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   253   5e-76
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   254   6e-76
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   250   7e-76
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   250   9e-76
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   252   1e-75
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   253   1e-75
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                251   3e-75
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   252   3e-75
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   252   4e-75
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              252   1e-74
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   247   3e-74
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   250   3e-74
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   249   1e-73
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   248   2e-73
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   247   6e-73
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              246   8e-73
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   243   8e-72
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   242   3e-71
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   241   7e-71
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   240   7e-71
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   241   8e-71
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   238   2e-70
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              238   4e-70
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   238   5e-70
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   236   1e-69
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   236   3e-69
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   235   9e-69
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   233   5e-68
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    233   5e-68
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   232   7e-68
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   231   1e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   231   1e-67
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   231   2e-67
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   230   4e-67
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   229   1e-66
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   228   3e-66
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   228   3e-66
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   227   4e-66
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   227   4e-66
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   226   5e-66
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   226   1e-65
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   226   2e-65
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   225   6e-65
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   224   7e-65
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   224   7e-65
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      224   8e-65
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   223   2e-64
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   223   2e-64
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   222   3e-64
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   222   4e-64
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   226   4e-64
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   221   5e-64
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   221   1e-63
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   221   1e-63
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   218   2e-63
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   220   2e-63
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   219   5e-63
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                218   1e-62
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              218   2e-62
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   221   6e-62
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   221   8e-62
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   214   2e-61
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   215   2e-61
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   219   2e-61
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   213   7e-61
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   212   2e-60
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   216   3e-60
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   216   5e-60
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   213   3e-59
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   208   6e-59
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   207   9e-59
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   207   2e-58
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   204   7e-58
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   208   2e-57
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   207   3e-57
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   207   3e-57
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                203   4e-57
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   207   5e-57
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   199   6e-56
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   202   1e-55
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   202   3e-55
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   195   9e-55
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     188   7e-54
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     188   1e-53
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   197   2e-53
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   193   2e-53
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   196   3e-53
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   195   4e-53
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   190   4e-51
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   188   3e-50
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   187   7e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   179   1e-47
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   136   6e-36
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         137   2e-35
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          92   2e-20
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     94   3e-20
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      92   5e-20
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          89   1e-19
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    84   6e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   2e-16
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      65   6e-12
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    64   6e-11
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              40   0.004
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    37   0.12 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    37   0.12 
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    37   0.18 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    34   1.2  
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    33   1.7  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    33   2.1  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    33   2.1  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    33   2.4  
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    33   3.0  
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    32   3.6  
TPHA0B04910 Chr2 (1154661..1155797) [1137 bp, 378 aa] {ON}             32   3.7  
Skud_15.31 Chr15 complement(54845..56590) [1746 bp, 581 aa] {ON}...    32   4.0  
TDEL0G01860 Chr7 complement(374829..376436) [1608 bp, 535 aa] {O...    32   4.1  
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    32   4.4  
ZYRO0G12782g Chr7 (1015954..1017684) [1731 bp, 576 aa] {ON} weak...    32   5.1  
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    32   5.3  
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    32   5.3  
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    32   5.4  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...    32   6.6  
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    31   9.3  

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/590 (96%), Positives = 570/590 (96%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN
Sbjct: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRH                    PLTNAGPV
Sbjct: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG
Sbjct: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY
Sbjct: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI
Sbjct: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG
Sbjct: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1064 bits (2752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/590 (87%), Positives = 547/590 (92%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           MT PKQ++E+EEKHMY EP  T  HDVEASQTH RRGSLSLKDEKSKELYPLRSFP GVN
Sbjct: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           GQDTFSMEE++QDEDEGEVQNAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           GALI+YLFMGSLA+SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA+T
Sbjct: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWT+ VPLAAWISIFWV+IT MN+FPVKYYGEFEFWVASIKVIAIIG
Sbjct: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNE RFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT ATSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PFI+AI+NSGTKVLPHIFNAVILTTIISAANSNIYVGSR+LFGLSK+KLAPKF S+T+KG
Sbjct: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVPYIAVFAT++FGALAYMETSTGG KVF WLLNITGVAGFFAWLFIS+SHIRFMQALKY
Sbjct: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           RGISRDELPFKAKLMPGLAYY++FFM++II+IQGFT+F P FNG +FLAAYIS+FLF+A+
Sbjct: 481 RGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAV 540

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           WILFE IFRCRF+WKIEDVDIDSDRRDIEAIVWE+ EPKT WDKFWNVV 
Sbjct: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score = 1059 bits (2738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/589 (86%), Positives = 539/589 (91%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           MT  K+D+++EEKHMY EP  T FHDVEASQTHHRRGS+ LKDEKSKELYPLRSFP  VN
Sbjct: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           G+DTFSME+ I DEDEGEVQNAEVKRELKQRH                    PLTNAGPV
Sbjct: 61  GEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA+T
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVIQFWTY VPLAAWISIFWVIIT MN+FPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNE RFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           ELVGITAGEAANPRK+VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT +TSYVSTS
Sbjct: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSR+LFGLSK+KLAPKF S+TTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVPYIAVF T+ FGALAYMETSTGG KVF WLLNITGVAGFFAWLFIS+SHIRFMQALKY
Sbjct: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           RGISRDELPFKAKLMPGLAYYA  FM +II+IQGFT+F P FNGV+F AAYIS+FLFLA+
Sbjct: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           WILF+ IFRCRF+WKI DVDIDSDRRDIEAIVWE+ EPKT WDKFWNVV
Sbjct: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVV 589

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/590 (85%), Positives = 539/590 (91%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           MT PKQ++E+EEKHMY EP  T FHDVEASQTH RRGSL LKDEK+KELYPL SF   V+
Sbjct: 1   MTDPKQNTEIEEKHMYNEPVTTLFHDVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVD 60

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           G+DTFSM + I+DED+GEV+NAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA+T
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQVI+FWT  VPLAAWISIFWVIIT MN+FPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNE RFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT+ATSYVS S
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSR+LFGLSK+KLAPKF S+TTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVPYIAVF T++FGALAYMETSTGG KVF WLLNITGVAGFFAWL IS+SHIRFMQALKY
Sbjct: 421 GVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           RGISRDELPFKAKLMPGLAY+A  FM++IILIQGFT+F P F+G++FLAAYIS+FLFLAI
Sbjct: 481 RGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAI 540

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           WILFE+IFRCRF+WKIEDVDIDSDRRDIEAIVWE+ EPKT WDKFWNVV 
Sbjct: 541 WILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/564 (73%), Positives = 475/564 (84%), Gaps = 7/564 (1%)

Query: 34  HRRGSLSLKDEKSK------ELYPLRSFPNGVNG-QDTFSMEEDIQDEDEGEVQNAEVKR 86
            ++    LK+ K K      + YPL    N V+      ++E   ++   G+++ AEVKR
Sbjct: 2   DKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKR 61

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATF 146
           ELKQRH                    PLTNAGPVGALI+YLFMG+L YSVTQSLGEMATF
Sbjct: 62  ELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATF 121

Query: 147 IPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWIS 206
           IPVTSSFTVFSQRFLSP+FGAANGYMYWFSWA+TFALELSVVGQ+IQFWT AVP+ AWIS
Sbjct: 122 IPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWIS 181

Query: 207 IFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNP 266
           IFWV++ AMNMFPV++YGEFEFWVASIKV+AI+GFLIYC CMVCGAGVTGPVGFRYWRNP
Sbjct: 182 IFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNP 241

Query: 267 GAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVF 326
           G  GPGII+KN NEA+FLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAIKKVVF
Sbjct: 242 GPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVF 301

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTI 386
           RIL FYIGSL FIGLLVPYNDPKLTS  SYV+ SPFII+I+NSGT +LPHIFNAVIL+TI
Sbjct: 302 RILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTI 361

Query: 387 ISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGG 446
           ISAANSN+YVGSR++FGLSKSKLAP+  S+T K GVP+++V  T +FGALAYMETSTGG 
Sbjct: 362 ISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGE 421

Query: 447 KVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFM 506
             F WLLNITGVAGFF+WLFIS+SH+RFMQAL+YRGISRD+LPFKAK MPGLAYYA FFM
Sbjct: 422 AAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFM 481

Query: 507 VVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRR 566
            +II+IQGFTSF P+F+G++FLAAYIS FLF+AIWI+F+L FRCR +WKIEDVDID+DRR
Sbjct: 482 TLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRR 541

Query: 567 DIEAIVWEEPEPKTLWDKFWNVVG 590
           DIE +VWE+P P T WDKFWNVV 
Sbjct: 542 DIEEVVWEDPPPVTFWDKFWNVVA 565

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/513 (78%), Positives = 446/513 (86%)

Query: 77  GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSV 136
           G V +AEVKRELKQRH                    PL  AGPVGALISY+FMG+L YSV
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 137 TQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWT 196
           TQSLGEMATFIPVTSSFTVF+QRFLSP+ GAA GYMYWFSWAVTFALELSV+GQVIQ+WT
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 197 YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG 256
           YAVPLAAWISIFWV+ITA NMFPVKYYGE EFW+A IKVIAI+GFL+YC CMVCGAGVTG
Sbjct: 186 YAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 257 PVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
           PVGFRYWRNPG WGPGIISK+KNEARFLGWVSSLIN AFT+QGTELVGI+AGEAANPRK 
Sbjct: 246 PVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPH 376
           VPRAIKKVVFRIL FYIGSL FIGLLVPYND  L +  SYV++SPFIIAI+NSGT VLPH
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
           IFNAVI  TI+SA NSN+YVGSR+LFGLSK+KLAPK  S+TTKGGVP+IAV  TS+ GAL
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           AYMETSTGG   F WLLNIT VAGFF WLFIS+SHIRFMQALKYRGISRD+LPFKA LMP
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI 556
           GLAYYA+F M VII+IQGFT+F P F+G +F AAYIS+FLF+ IW LF++IFRCRF+ K+
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKV 545

Query: 557 EDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           EDVDID+DRRDIEA+VWE+ EPKT+WDKFWN++
Sbjct: 546 EDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNII 578

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/532 (76%), Positives = 456/532 (85%), Gaps = 3/532 (0%)

Query: 58  GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
           G + QD+  M+E+I+ E   EV+   V+RELKQRH                    PL NA
Sbjct: 3   GGHNQDS-KMKEEIR-EISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNA 60

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVGALI+YLFM +LAYSVTQSLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW
Sbjct: 61  GPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSW 120

Query: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
            +TFALELSVVGQVIQFWT+AVPLAAWISIFWV++T MNMFPVKYYGEFEFWVA +KV+A
Sbjct: 121 CITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           I+GFLIYCFCMVCGAGVTGPVGFRYWR+PGA+GPGII+K+KN+ARFLGWVSSLINAAFTF
Sbjct: 181 IMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTF 240

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357
           QGTELVGITAGEAANPRKTVPRAIKKVVFRIL FYI SL FIGLLVPY+D KLTS  SYV
Sbjct: 241 QGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYV 300

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417
           S SPFIIAIENSGT VLPHIFNAVI+ TIISA NSNIYVGSR+++GLS S+LAP   S+T
Sbjct: 301 SASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360

Query: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477
           T+ GVP++AV  TS+FGALAYMETSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQA
Sbjct: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420

Query: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLF 537
           L+ RGISRD+LPFKAK MPGLAYY  FFM +II+IQGFTSF P +NG++FL AYISVF+F
Sbjct: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMF 479

Query: 538 LAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           +AIWI F+  FRCR +W++EDVDID+DRR +E  VW E EP+  WDKFWNVV
Sbjct: 480 IAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVV 531

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/592 (68%), Positives = 466/592 (78%), Gaps = 13/592 (2%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQT---HHRRGSLSLKDEKSKELYPLRSFPN 57
           M   KQD   EE +     +G    D  + Q    +HR+ S+  K     E  P      
Sbjct: 1   MWNAKQDVS-EEGYELGNFSGMNDEDSSSGQAGAINHRKKSVVSKTTAVDESLP------ 53

Query: 58  GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
              G  +  +E       EG+V  AEVKR LKQRH                    PL+NA
Sbjct: 54  ---GLSSSDLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNA 110

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVG LI+YLFM +L YSV QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWFSW
Sbjct: 111 GPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSW 170

Query: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
           A+TFALELSVVGQ+I+FWT AVP+AAWI+IFWV++T  N+FPVKYYGEFEFW+A IKVIA
Sbjct: 171 AITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIA 230

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           ++GF+IYC CMVCGAG+TGPVGFRYWRNPGAWGPGIISK+KNE RFLGWVSSLINAAFT+
Sbjct: 231 LVGFIIYCLCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTY 290

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357
           QGTELVGITAGEAANPRK+VPRAIKKVVFRIL FY    +FIGLLVPYNDPKL S+ SYV
Sbjct: 291 QGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYV 350

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417
           S+SPFIIAIENSGTKVLPHIFNAV+LTTIISA NSN+YVGSR+++GL+K KLAP FF +T
Sbjct: 351 SSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRT 410

Query: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477
              GVPY AVF TS FGALAYME STGG   F WLLNITGVAGFF W+ IS  HIRFMQA
Sbjct: 411 NAAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQA 470

Query: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLF 537
           LKYRGISRD+LPFKAK MP LAYYA FFMVVIILIQGFT+F PTF+GV+F AAY+SVFLF
Sbjct: 471 LKYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLF 530

Query: 538 LAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           +AIW+  ++ FRCR   ++++VDID+DRRDIEA+VW++  PKTLWDKFWN+V
Sbjct: 531 IAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIV 582

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/521 (72%), Positives = 439/521 (84%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           ED+  E +  +++ +VKR LKQRH                    PL NAGPVGAL++YLF
Sbjct: 51  EDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLF 110

Query: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188
           MG++ +SVTQSLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSVV
Sbjct: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170

Query: 189 GQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
           GQ+IQFWT+ VPLAAWISIFWV++TA NMFPVK+YGEFEFW+ASIKV+A++GFLIY  C+
Sbjct: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230

Query: 249 VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAG 308
           VCGAG TGP+GFRYWRNPGA GPGIIS N  EARFLGWVSSLINAAFT+QGTELVGITAG
Sbjct: 231 VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIEN 368
           EAANPRK VPRAI+KV+ RIL FYIGSL FIGL VPYNDPKLTS  SYVS+SPFII I+N
Sbjct: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQN 350

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVF 428
           +GT+VLPHIFNAVILTTIISA NSN+YVGSR+LF ++K+ LAPKF +KTT  GVPY++V 
Sbjct: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410

Query: 429 ATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDEL 488
           A S FG+L+YME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+L
Sbjct: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470

Query: 489 PFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIF 548
           P+KA  MP LAYYA FFMVVIILIQGFTSF P F+G +F+AAYISV LFL  W  F++ F
Sbjct: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYF 530

Query: 549 RCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           RCR +WK+EDVDID+DRR+IE++VWE+  PKTLWDKFW+ V
Sbjct: 531 RCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFV 571

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/514 (75%), Positives = 444/514 (86%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           EG V+ AEVKR+LKQRH                    PL NAGPVGALI+YLFM ++ +S
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
           VTQSLGEMATFIPVTSSFTVFS RFLSPA GAANGYMYWFSWAVTFALELSVVGQ+IQFW
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           T+AVPL+AWI I+WVI+T MN+FPVK+YGEFEFWVASIKV+AIIGFLIYC CMVCGAGVT
Sbjct: 209 THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT 268

Query: 256 GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
           GPVGFRYWRNPG WGPGIISK+ NE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK
Sbjct: 269 GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 328

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLP 375
           TVPRAIKKV FRIL FYI SL FIGLLVPY+D KLTS  SY+S SPFIIAIENSGTK+LP
Sbjct: 329 TVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILP 388

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
           HIFNAVIL+TIISA NSN+YVGSR+LFGL+K+KLAPK+F  T++GGVPY +VF TS FGA
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           LA++E S+GG K F WLLNI  VAGFFAWL IS++H+RFMQALK+RGISRD+LPFKA+ M
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM 508

Query: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK 555
           P LAYY+ FFM +II+IQGFT+F PTFNG +F+AAYIS+FLF  +W+ F+L FR + +W 
Sbjct: 509 PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 556 IEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           +E+VDID+DRRD++AI+WE+  PKT WDKFW+VV
Sbjct: 569 VEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWDVV 602

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/556 (67%), Positives = 451/556 (81%), Gaps = 8/556 (1%)

Query: 40  SLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNA-----EVKRELKQRHXX 94
           S+   K +EL   R   +G + ++  + +  I ++   E + +     EVKR+LKQRH  
Sbjct: 19  SISTIKEEELICARY--DGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIG 76

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154
                             PL +AGPVGALISYLFMG++ YSVTQSLGEMATFIPVTSSF+
Sbjct: 77  MIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFS 136

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITA 214
           VF+QRFLSPA GA NGYMYW SW  TFALELSV+GQ+IQ+WT AVPL AWI IFW ++T 
Sbjct: 137 VFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTL 196

Query: 215 MNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG-PVGFRYWRNPGAWGPGI 273
           MNMFPVKYYGEFEF +ASIKVIA++GF+ + FC+VCGAG +G P+GFRYWRNPGAWGPGI
Sbjct: 197 MNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGI 256

Query: 274 ISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI 333
           ISKNKNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPR+ VPRAIKKVV RIL FYI
Sbjct: 257 ISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYI 316

Query: 334 GSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSN 393
            SL FIGLLVPYNDPKL S  ++VS+SPF+I+IENSGTKVLP IFNAV+L TI+SA NSN
Sbjct: 317 LSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSN 376

Query: 394 IYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLL 453
           +Y+GSRVL+ LSK+ LAP+F S  TKGGVPY AV +TS FG LA++ETS G GKVF WLL
Sbjct: 377 VYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLL 436

Query: 454 NITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQ 513
           NITGVAGFFAWL IS+SHIRFMQA+K RGISRD+LP++A++MP LAYYA+FF+ +I+LIQ
Sbjct: 437 NITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQ 496

Query: 514 GFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVW 573
           GFT+F PTF  ++F+AAYISVFLF+AIW+LF++ F+CRFVWK++DVDIDSDRRDIE  VW
Sbjct: 497 GFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQVW 556

Query: 574 EEPEPKTLWDKFWNVV 589
            EPE KT W   W+++
Sbjct: 557 IEPECKTRWQHVWDIL 572

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/555 (69%), Positives = 456/555 (82%), Gaps = 13/555 (2%)

Query: 42  KDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXX 101
           +D+  K++       N +   D  S  ED +  + G V +AEVKRELKQRH         
Sbjct: 27  QDDDMKKI-------NIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGT 79

Query: 102 XXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                      PL ++GPVG+LI+Y+F+G+L Y+VTQSLGEMATFIPVTSSFTVF+ RFL
Sbjct: 80  IGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFL 139

Query: 162 SPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVK 221
           SP+ GAA GYMYWFSWAVTFALELSVVGQ++ +WT+AVP+AAWISIFWVI+TA+NMFPVK
Sbjct: 140 SPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPVK 199

Query: 222 YYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGI------IS 275
           +YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGPVGFRYWRNPG WG G+      IS
Sbjct: 200 FYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEIS 259

Query: 276 KNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGS 335
           KNKN  RFLGW +SLINAAFT+QGTELVGITAGEAANPRKTVPRAIKKVVFRIL FYIGS
Sbjct: 260 KNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGS 319

Query: 336 LLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIY 395
           L FIGLLVP++DPKL+S  SYVS+SPFIIAIENSGTK+LP IFNA+IL TIISA NSNIY
Sbjct: 320 LFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGNSNIY 379

Query: 396 VGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNI 455
           VGSR+LF L+K+ LAPK  S+TTK GVP+++V AT++FG LAYMET+ GG  VF WL+NI
Sbjct: 380 VGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNI 439

Query: 456 TGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGF 515
           T +AGF+AWLFI +SHIRFMQ LK+RGISRD+LPFKA LMPGLAYYA F MV+II+ QGF
Sbjct: 440 TAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGF 499

Query: 516 TSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEE 575
           T+FTPTF+  +F AAYISV LF  IW  F+L F+CR++WK+EDVDIDS+RRD+E I+WE+
Sbjct: 500 TAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWED 559

Query: 576 PEPKTLWDKFWNVVG 590
           PEPKT WDKFWNVV 
Sbjct: 560 PEPKTFWDKFWNVVA 574

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/539 (67%), Positives = 441/539 (81%), Gaps = 6/539 (1%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNA-----EVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           +G N     + E  ++D+   E +++     EVKR+LKQRH                   
Sbjct: 34  SGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIG 93

Query: 112 XPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171
            PL +AGPVGALISYLFMG++ YSVTQSLGEM TFIPVTSSF+VF+QRFLSPA GA NGY
Sbjct: 94  PPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGY 153

Query: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           MYW SW  TFALELSV+G+VIQ+WT AVPLAAWI IFW ++T+MNMFPVKYYGEFEF +A
Sbjct: 154 MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIA 213

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
           SIKVIA++GF+I+ FC+VCGAG + GP+GFRYWRNPGAWGPGIIS +KNE RFLGWVSSL
Sbjct: 214 SIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 273

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           INAAFT+QGTELVGITAGEAANPRK +PRAIKKVV RIL FYI SL FIGLLVPYNDPKL
Sbjct: 274 INAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL 333

Query: 351 TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
            S   +VS+SPF+I+IENSGTKVLP IFNAV+L TI+SA NSN+Y+GSRVL+ LSK+ LA
Sbjct: 334 DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLA 393

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           P+F S  T+GGVPY +V +TS+FG LA++E S G GK F WLLNITGVAGFFAWL IS S
Sbjct: 394 PRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFS 453

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAA 530
           HIRFMQA++ RGISRD+LP+KA++MP LAYYA+FF+ +I+LIQGFT+F PTF  ++F+AA
Sbjct: 454 HIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAA 513

Query: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           YIS+FLFLAIW+ F++ F+CR +WK++D+DIDSDRR IE +VW EPE KT W + W+V+
Sbjct: 514 YISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEELVWIEPECKTRWQRVWDVL 572

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/557 (71%), Positives = 461/557 (82%), Gaps = 8/557 (1%)

Query: 34  HRRGSLSLK-DEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRH 92
           +  GS S+  D  S+ L+       G +G  + S +ED    D+G VQ+AEVKRELKQRH
Sbjct: 45  YETGSSSIVVDGSSRHLH-------GSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRH 97

Query: 93  XXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSS 152
                               PL NAGPVG+LI+YLFM ++ +SVTQSLGEMATFIPVTSS
Sbjct: 98  IGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSS 157

Query: 153 FTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVII 212
           FTVFS RF+SP+ GAANGYMYWFSWA+TFALELSVVGQ+IQFWT AVPL+AWI I+W I+
Sbjct: 158 FTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFIL 217

Query: 213 TAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPG 272
           T MNMFPVK+YGEFEFWVASIKVIAI+GFLIYC CMVCGAGVTGPVGFRYWRNPG WGPG
Sbjct: 218 TIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPG 277

Query: 273 IISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFY 332
           IIS    E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAIKKV FRIL FY
Sbjct: 278 IISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFY 337

Query: 333 IGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANS 392
           I SL FIGLLVP++DPKL+S  SYVS+SPFIIAI+NSGTKVLPHIFNAVIL+TIISA NS
Sbjct: 338 ILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNS 397

Query: 393 NIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWL 452
           NIYVGSRV+FGL+K+KLAP++F  TTK GVPYIAV  TS FGALA++E S+GG K F WL
Sbjct: 398 NIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWL 457

Query: 453 LNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILI 512
           LNI GVAGFFAWL IS++H+RF+Q L++RGISRD+LPFKA LMP LAYYA FFM++II+I
Sbjct: 458 LNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIII 517

Query: 513 QGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIV 572
           QGFT+F PTFNG +F+AAYISVFLF  +W+ F+L FRC+  W +++VDID+DRRDI+AI+
Sbjct: 518 QGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAII 577

Query: 573 WEEPEPKTLWDKFWNVV 589
           WE+  PKT WD+FW+VV
Sbjct: 578 WEDSAPKTFWDRFWDVV 594

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/526 (69%), Positives = 429/526 (81%), Gaps = 2/526 (0%)

Query: 66  SMEED-IQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           S+E D  +  +       EV+R+LK+RH                    PL +AGPVGALI
Sbjct: 47  SIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALI 106

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           SYLFMG++ YSVTQSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALE
Sbjct: 107 SYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           LSV+GQ+IQ+WT+AVPLAAWI IFW ++T MNMFPVKYYGEFEF +ASIKVI ++GF+I+
Sbjct: 167 LSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIF 226

Query: 245 CFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
            FC+VCGAG   GP+GFRYWRNPGAWGPGIIS NKNE RFLGWVSSLINAAFT+QGTELV
Sbjct: 227 SFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELV 286

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFI 363
           GITAGEAANPRK VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL S  ++VS SPF+
Sbjct: 287 GITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFM 346

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           I+IENSGTKVLP IFNAV+L TI SA NSN+Y+GSRVL+ LSK+ LAPK  S  T+GGVP
Sbjct: 347 ISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVP 406

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
           Y+AV  TS+FG LA++ETS G GK F WLLNITGVAGFFAWL IS SHIRFMQA+K RGI
Sbjct: 407 YLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGI 466

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWIL 543
           SRD+LP+KA++MP LAYYA+FF+ +I+LIQGFT+F PTF  V+F+AAYISVFLF  IW+ 
Sbjct: 467 SRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLS 526

Query: 544 FELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           F+L F+CR + K++D+DIDSDRR+IE  VW EPE KT W + W+++
Sbjct: 527 FQLWFKCRLICKLQDIDIDSDRREIEEQVWIEPECKTRWQRVWDIL 572

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/586 (65%), Positives = 449/586 (76%), Gaps = 2/586 (0%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           M+     +  E+  +   P G  +++     +         KD KS +        + V+
Sbjct: 1   MSQTNNHNMAEQIPLTPYPYGQEYNNAMGESSTASEEPFGCKDTKSTD--EKTRVVSQVS 58

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
              T S    I   DEG VQ+AEVKR LK RH                    PL +AGPV
Sbjct: 59  PMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPV 118

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           GALI+Y+FMG++AY VTQSLGEMATFIPVTSSFTVF+QRFLSPAFG ANGY+YWFSW +T
Sbjct: 119 GALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCIT 178

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELSVVGQ+IQFWT+AVPL AWI+IFWVI+T  N+FPVKYYGE EFW+A IKV+AI+G
Sbjct: 179 FALELSVVGQIIQFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVG 238

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           F+IY F MVCGAG TGPVGFRYWRNPG WGPGIISK+ NE RFLGWVSSLINAAFT+QGT
Sbjct: 239 FIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGT 298

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           ELVGITAGE+ NPR+TVPRAI KV FRIL FYI SLLFIGLLVP+NDPKL S  SY+S+S
Sbjct: 299 ELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSS 358

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PF+IAIENSGTKVLPHIFNAVIL+TIISA NSNIYVGSRVL+GL+K+KLAPK F++ TK 
Sbjct: 359 PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKD 418

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVPYI+V  T+ FG LAY+  S    KVF WLLNIT +AGFFAWLFIS++HIRFMQ LK 
Sbjct: 419 GVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKD 478

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           R +SR++LPFKAK MP  AYY+ FF+ +II+IQGFT+F P FN  NF AAYISVFLFLAI
Sbjct: 479 RNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAI 538

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
           W++F++ FR RF+    DVDID+DRRDI+ IVWEE  PK  WDKFW
Sbjct: 539 WVVFQIRFRTRFILTKNDVDIDTDRRDIDCIVWEEETPKNAWDKFW 584

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/523 (73%), Positives = 435/523 (83%), Gaps = 4/523 (0%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
           EEDI  +  G V+ A+VKRELK RH                    P+ NAGPVG+LI+Y+
Sbjct: 88  EEDI--DATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYI 145

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
           FMG+L +SVTQSLGEMATFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWA+TFALELSV
Sbjct: 146 FMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           VGQVI+FWT+ VPLAAWISIFWV+I  MN FPVK YGEFEFWVASIKVIAIIGF+IYC C
Sbjct: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
           MVCGAG+TGPVGFRYWR+PG WGPGIISK+KNEARFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 266 MVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367
           GEAANPRK+VPRAIKKV  RIL FYI SL FIGLLVPYNDPKL+S  SYVS SPFIIAI+
Sbjct: 326 GEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQ 385

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
           NSGTKVLPHIFNAVILTTIISAANSN+YVGSR+L+GLS +KLAPKFF K T+ GVP+IAV
Sbjct: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAV 444

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
             T+ FGALAYMETS GG   F WLLNITGVAGFFAWL IS+SHIRFMQ LK+RG+SRD+
Sbjct: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504

Query: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELI 547
           LP+KA LMPGLAYY  FF+ +IILIQGFT+F P F+   FL AYIS FLFL I+I+ +  
Sbjct: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCY 564

Query: 548 FRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           FR R    ++DVDID+DRRDI+ ++WEE  P+T WDKFW V+ 
Sbjct: 565 FRTRLWRTLDDVDIDTDRRDIDTVIWEE-GPQTFWDKFWAVIA 606

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/565 (64%), Positives = 439/565 (77%), Gaps = 3/565 (0%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVK 85
           D+   +T   +  + +K  +S E + L+   +  N   T   +E++ + ++ E    EVK
Sbjct: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDK-NTPTTTPSKENVSENEKDEYH--EVK 61

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145
           R+L +RH                    PL  +GPVG+LI+YLF+G++ YSVTQSLGEMAT
Sbjct: 62  RDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121

Query: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWI 205
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT+AVPL AWI
Sbjct: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181

Query: 206 SIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265
           SIFWVI+T  N+FPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241

Query: 266 PGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325
           PG WG GIIS N  EARFLGW SSLINAAFTFQGTELVGITAGEAANPR+TVP+AI+KVV
Sbjct: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTT 385
           FRIL FYI SL FIGLLVPY+D KL S  SYVS+SPFIIAIENSGTK+LPHIFN VIL T
Sbjct: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361

Query: 386 IISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGG 445
           IISA NSN+Y+GSR+LFGL+K+   PK F+KTTK GVP  AV  TS+FGALA+METSTGG
Sbjct: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421

Query: 446 GKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFF 505
            + F WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAYYAT  
Sbjct: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481

Query: 506 MVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           M++II  QGFT+F P F+ +NF A+YISVFLF   W  F+L F+CR+VWK+ D+DID DR
Sbjct: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDR 541

Query: 566 RDIEAIVWEEPEPKTLWDKFWNVVG 590
           R+IE  VW++  P  LW KFW+ V 
Sbjct: 542 REIEDRVWQDTTPANLWGKFWDFVA 566

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/535 (69%), Positives = 434/535 (81%), Gaps = 6/535 (1%)

Query: 59  VNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
           V+  DT +    + D+ E   +  +VKRELK+RH                    PL  AG
Sbjct: 13  VDSNDTPTTISTLDDDQE---KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAG 69

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P+GALI+YLFMG++ +SVTQSLGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSWA
Sbjct: 70  PIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWA 129

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
           +TFALELSVVGQ+IQFWT AVPLAAWISI WV++T  N+FPV+ YGE EFW+AS+KV+AI
Sbjct: 130 MTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAI 189

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           +GF+IY  C++CGAGVTGPVGFRYW+NPG WG GIIS N NEARF GWVSSLINAAFTFQ
Sbjct: 190 LGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQ 249

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVS 358
           GTELVGITAGE   PRKTVP+AIKKVVFRIL FYIGSLL IGLLVPYNDPKL S  SYVS
Sbjct: 250 GTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVS 309

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
           +SPFII I+N+GTK+LPHIFNAVIL TIISA NSN+Y+GSR+L+GL+K+K APKFF+ T+
Sbjct: 310 SSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTS 369

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           K GVPY+ V  TS+FG+LAYMET+TGG K F WLLNI GVAGFFAWL IS SHIRFM+AL
Sbjct: 370 KAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKAL 429

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFL 538
           K RGISR++LP+KA LMP LAYYA FFMV+II+IQGFTSF P F   NF AAYISVFLF+
Sbjct: 430 KQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFI 489

Query: 539 AIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWE---EPEPKTLWDKFWNVVG 590
             W+ F++ F+CR VWK++DVD+D+DRRDIE  VW    E + K  WD+FWN V 
Sbjct: 490 IFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/523 (68%), Positives = 422/523 (80%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
           E+ +  E  G V+  +VKR LK RH                    PL+NAGPVGALI+Y+
Sbjct: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
           F+G+LAYSVTQSLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWA+TFALELSV
Sbjct: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
           VGQ+IQFWT AVPL AWI+IFWVI+T  N+FPVKYYGE EFW+A IKV+AI+GF+IY F 
Sbjct: 146 VGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFI 205

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
           MVCGAG TGPVGFRYWRNPG WGPGIISK+ NE RFLGWVSSLI+AAFT+QGTELVGITA
Sbjct: 206 MVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITA 265

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367
           GEAANPRKTVPRAI KV FRIL FYI SLLFIGLLVP+NDPKL S  SY+S+SPF+IAIE
Sbjct: 266 GEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIE 325

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
           NSGTKVLPHIFNAVIL+TIISA NSN+YVGSR+ + ++ + LAPK+ + TTK G+PY AV
Sbjct: 326 NSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAV 385

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
             TS+ G LAY+E+S+G   VF WLLNIT VAGFF W+ IS+SHIRFMQALK++GISRD+
Sbjct: 386 LTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDD 445

Query: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELI 547
           LPFKAK MP  AYYA FF+ VII+IQGFT+F P F   +F  AYISV LF   WI F++ 
Sbjct: 446 LPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIW 505

Query: 548 FRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           FR     K ED+D+D+DRR+I+ +VWEE +P+ LW+KFW  + 
Sbjct: 506 FRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/479 (74%), Positives = 412/479 (86%), Gaps = 1/479 (0%)

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           PL +AGPVGALISY+FMG++ YSVTQSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 173 YWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           YW SW  TFALELSV+GQ+IQ+WT AVPL+AWI IFW ++T MNMFPVKYYGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 233 IKVIAIIGFLIYCFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKVIA++GF+IY FCMVCGAG   GP+GFRYWRNPGAWGPGIIS +KNE RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRK VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           S  S+VS SPF+I+IENSGTKVLP IFNAV+L TI+SA NSN+Y+GSRVL+ LSK+ LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           +F S  TKGGVPY AV ATS+FG LA++ETS G GK F WLLNITGVAGFFAWL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAY 531
           IRFMQA+  RGISR++LP+KA++MP LAYYA+FF+ +I+LIQGFT+F P+F  V+F+AAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 532 ISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           ISVFLF+AIW  F+L F+C  + K++DVDIDSDRR+IE  VW EP  KT W   W+V+ 
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/593 (61%), Positives = 451/593 (76%), Gaps = 8/593 (1%)

Query: 4   PKQDSEVEEKHMYTEPAGTFFHDVEASQTH----HRRGSLSLKDEKSKELYPLRSFPNGV 59
           P    E++E+++  E AG+   DV  + T+        S  LK   + E     + P G 
Sbjct: 9   PCPQKELKERNILREEAGS--SDVLPNDTNITTATSVASFELKSTNASEAASQSTSPTGS 66

Query: 60  NG-QDTFSMEEDIQD-EDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
               D      +      E  V++  VKR LK RH                    PL NA
Sbjct: 67  ELIPDCLQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNA 126

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVGALI+Y+F+G++ +SVTQSLGEM TFIPVTSSFTVFS RFLSPAFGAANGYMYWFSW
Sbjct: 127 GPVGALIAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSW 186

Query: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
           A+TFA+ELSV+G+VIQFWT AVPLAAWI IFW ++T  NMFPVKYYGE EFW+A +KV++
Sbjct: 187 AMTFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLS 246

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           ++GFLI+C C+  GAG  GP GFRYWR+PGAWGPGII+++++EARFLGWVSSLINAAFT+
Sbjct: 247 LVGFLIFCLCITSGAGPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTY 306

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357
           QGTELVGITAGEAANPRK VP+AIKKV+ RIL FY+GSL FIG+LVP+NDPKLTSATS+V
Sbjct: 307 QGTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFV 366

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417
           S+SPFIIAI+NSG  +LP IFN VIL TIISA NSN+YVGSR+LFGL+ S LAP+FF++T
Sbjct: 367 SSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRT 426

Query: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477
           TK GVP++AV  TS+FG+LA++E +T G KVF WLL+I  +AGFFAWL IS+SHIRFM+A
Sbjct: 427 TKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKA 486

Query: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLF 537
           L+YRGISR+ LPFKA  MP LAYYAT F+++IILIQGFT+F P FN  +F+A+YIS+ LF
Sbjct: 487 LEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLF 546

Query: 538 LAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           + IW +F+ + +CR  WK+ED+D+DSDR+DIE I WE+  PKT W K W  + 
Sbjct: 547 VIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/563 (65%), Positives = 434/563 (77%), Gaps = 17/563 (3%)

Query: 29  ASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQD-EDEGEVQNAEVKRE 87
           ++Q HH     S K++ S+EL               FS  +D+   E  G V+  +VKR 
Sbjct: 2   SAQQHHS----SEKEKNSEELV------------SEFSRSKDVVSLESLGSVKETQVKRA 45

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147
           LK RH                    PL+NAGPVGALI+Y+F+G+LAY V+QSLGEMATFI
Sbjct: 46  LKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFI 105

Query: 148 PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISI 207
           PVTSSF VF+QRFLSPA GAANGYMY+ SW++TFALELSVVGQVIQFWT AVPL AWI I
Sbjct: 106 PVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIII 165

Query: 208 FWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPG 267
            WV++ + N+ PVK+YGE EFW+A IKV+AI+GF+IY F MVCGAG TGPVGFRYWRNPG
Sbjct: 166 LWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPG 225

Query: 268 AWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327
            WGPGIISK+ NE RFLGWVSSLI+AAFT+QGTELVGITAGEAANPRKTVPRAI KV FR
Sbjct: 226 PWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFR 285

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTII 387
           IL FYI SLLFIGLLVP+NDPKL S  SY+S+SPF+IAIENSGTKVLPHIFNAVIL+TII
Sbjct: 286 ILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTII 345

Query: 388 SAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGK 447
           SA NS++Y+ SRVL+ +  + LAPK+ + TTK G+PY AV  TS+ G LAY+E+S G   
Sbjct: 346 SAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASV 405

Query: 448 VFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMV 507
           VF WLLNIT VAGFFAW+ ISV+HIRFMQALK++GISRD+LPFKAK MP  AYYA FF+ 
Sbjct: 406 VFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIG 465

Query: 508 VIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRD 567
           VII+IQGFT+F P FN  +F  AY+SV LF A+WI F++ FR     K ED+D+D+DRR+
Sbjct: 466 VIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRRE 525

Query: 568 IEAIVWEEPEPKTLWDKFWNVVG 590
           I+  VWEE EPK LW+KFW+ V 
Sbjct: 526 IDNDVWEEDEPKNLWEKFWSAVA 548

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/556 (65%), Positives = 432/556 (77%), Gaps = 3/556 (0%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQ 90
           +T  + G +S K E   E Y + SF      Q+  S  +D Q    G  +NA V+R+LK 
Sbjct: 3   KTSEKEG-MSQKTETRLEDYEMGSFAEEALDQEAQS-SQDSQLGSSGHGRNA-VQRQLKP 59

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVT 150
           RH                    PL NAGPVGALISYLFMGS+AY VTQSLGEMATFIPVT
Sbjct: 60  RHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVT 119

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210
           SSFTVF++RFLS   GAANGYMY FSW+VT+ALELS+VGQ+I++WT AVP AAWI+IFWV
Sbjct: 120 SSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWV 179

Query: 211 IITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWG 270
            IT  N+ PVK+YGEF+FW+A IKV+AIIGFL+YC CMVCGAG TGPVGFRYWRNPG WG
Sbjct: 180 PITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWG 239

Query: 271 PGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
            GIIS + +E RFLGWVSSL+NAAFT+QGTELVGI+AGE+ANPRKTVP+AI KV FRIL 
Sbjct: 240 DGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILL 299

Query: 331 FYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAA 390
           FY+GSL FIGLLVP+ND KLTS+ SY + SPFIIAI+NSGTK+LP IFNAVIL TIISAA
Sbjct: 300 FYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAA 359

Query: 391 NSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFA 450
           NSN+YVGSRVL+GL+K +LAP+FF++T + GVP +AV   + FG L Y+  S G  K F 
Sbjct: 360 NSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFD 419

Query: 451 WLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVII 510
           WLLNIT +AGFF+WLFIS+ H+RFMQALK +GISRD+LPFKAKLMP  AYY+ FF+ +II
Sbjct: 420 WLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLII 479

Query: 511 LIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEA 570
           +IQGFTS  PTFN  NF AAYISVF+FL IW +F+  +R R + +IE VDIDSDRR+++A
Sbjct: 480 IIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

Query: 571 IVWEEPEPKTLWDKFW 586
             W+  EP TLW KFW
Sbjct: 540 QQWDNTEPTTLWGKFW 555

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/570 (62%), Positives = 452/570 (79%), Gaps = 5/570 (0%)

Query: 25  HDVEASQTHHRRGSLS---LKD-EKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQ 80
           H++++S+ +  + SL+   +K+ ++S    P  +   G    + + +++ + D ++GEV+
Sbjct: 12  HELDSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSV-DGEKGEVR 70

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           + EVKR LK RH                    PL NAGPVG LI+YLFM ++A+SV QSL
Sbjct: 71  STEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSL 130

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVP 200
           GEMAT+IPVTS+F+VFSQRFLSPAFGAANGYMYWFSW++TFALELSV+GQ++Q+WT+ VP
Sbjct: 131 GEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVP 190

Query: 201 LAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF 260
           +AAWISIFWV+I  +N  PVK+YGEFEFW+A IKV+AI+GF+IYCF MVCGAG TGPVGF
Sbjct: 191 VAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKTGPVGF 250

Query: 261 RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320
           RYWR+  A+G GIISKNKNEARFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVP++
Sbjct: 251 RYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKS 310

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNA 380
           IK+ ++RIL FYI SLLF+GLLVP+ND  L  + SY ++SPFI+AI+NSGTK LP IFNA
Sbjct: 311 IKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKALPDIFNA 370

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VILTT+ISAANS++YVGSRV++ +++++LAP   +K +KGGVPY AV  TS  GALAY+E
Sbjct: 371 VILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLE 430

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           TS+ G  VF WL+NITGVAGFF+W  IS SH+RFM+ALK RGISR++LPFKA  MP +A 
Sbjct: 431 TSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAI 490

Query: 501 YATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVD 560
           Y+ FFM +IIL+QGFT FTP F   +F+A+YISV LF  IW +F++ FRC  +  I ++D
Sbjct: 491 YSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEID 550

Query: 561 IDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           ID+DRRD++A VWE+  PKTLWDKFWN+V 
Sbjct: 551 IDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/590 (63%), Positives = 442/590 (74%), Gaps = 13/590 (2%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           MT+  Q  E+EE            H    SQ+   R  + + + K  +  PLR   +   
Sbjct: 1   MTSIAQQIELEELEA--------LHS-NLSQSQSARSGMHVSNSKIDD--PLRFSKDNNL 49

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
             +    +     + EG +  AEVKR LK RH                    PL NAGPV
Sbjct: 50  TLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPV 109

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
           G+LI+++ +G+LAYSVTQSLGEMATFIPVTSSFTVFSQRF+SPA GAANGYMYWFSWA+T
Sbjct: 110 GSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAIT 169

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
           FALELS+VGQ+IQ+WT AVPL AWI+IFWV++ + NMFPVK+YGEFEFWVASIKVIAIIG
Sbjct: 170 FALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIG 229

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
           FLIY  CMVCGAG  GP+GFRYWR PG WG GII+KN N+ARFLGWVSSLI+AAFT+QGT
Sbjct: 230 FLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGT 289

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT--SYVS 358
           ELVGITAGE  NPRK VPRAI KV FRIL FYIGSL FIGLLVPYNDPKL  +   SY++
Sbjct: 290 ELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIA 349

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SPF+IAI N  T VLPHIFNAVILTTIISA NSN+YVGSR+LFGLSK+ LAPKFFSKTT
Sbjct: 350 QSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTT 409

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           K GVP+IAV  T++FG LAY+  S    +VF WLLNIT +AGF  WL IS+SHIRFMQ L
Sbjct: 410 KHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTL 469

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFL 538
           K+RGISRD+LP+KAK MP  AYYA FF+ VII+IQGFT+F P FN  +F AAYISVFLF 
Sbjct: 470 KHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFF 529

Query: 539 AIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNV 588
            +W +F+ I+R +    +++VDIDSDRRDI+ I+WEE EPK LW+KFW V
Sbjct: 530 IVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAV 579

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/556 (64%), Positives = 430/556 (77%), Gaps = 8/556 (1%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQ 90
           Q+  ++  L   + K  E     S  +GV       +E+  Q  D    Q   ++R LK 
Sbjct: 4   QSFEKQPQLHKNEIKVMEEGESSSLADGV-------LEQQSQI-DTASSQERGIQRALKP 55

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVT 150
           RH                    PL +AGPVG+LISYLFMGSLA+ VTQSLGEMATFIPV 
Sbjct: 56  RHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVA 115

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210
           SSFTVF++RFLSPA GAANGYMY FSW +TFALELS+VG++IQ+WT  VP AAWI IFWV
Sbjct: 116 SSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWV 175

Query: 211 IITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWG 270
            I+  N+  VK+YGEF+FW+A IKVIAI+GFLIYC CMVCGAG TGPVGFRYWRNPG WG
Sbjct: 176 PISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWG 235

Query: 271 PGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
            GIISK+K+E RFLGWVSSL+NAAFT+QGTELVG++AGE+ANPRKTVP+AI+KV  RIL 
Sbjct: 236 DGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILL 295

Query: 331 FYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAA 390
           FY+GSL FIGLLVP+NDPKL S  +Y ++SPFIIAI+NSGT+ LP IFNAVILTTIISAA
Sbjct: 296 FYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAA 355

Query: 391 NSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFA 450
           NSN+YVGSRVL+GL+K  LAPK   +  + GVPYI V   S+FG L Y+  S+G  K F 
Sbjct: 356 NSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFD 415

Query: 451 WLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVII 510
           WLLNIT +AGFFAWLFIS+ HIRFMQALKY+GISRD+LPFKAKLMP  AYYA FF+++II
Sbjct: 416 WLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLII 475

Query: 511 LIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEA 570
           +IQGFT+F P FN  NF AAY+SVFLF+A+W++F++IF+ R + K+EDVDIDSDRR+IEA
Sbjct: 476 IIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEA 535

Query: 571 IVWEEPEPKTLWDKFW 586
            VWE+ EP  LW KFW
Sbjct: 536 EVWEDDEPTNLWGKFW 551

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/549 (63%), Positives = 426/549 (77%), Gaps = 2/549 (0%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQ-DEDEGEVQNAEVKRELKQRHXXXXX 97
           ++L+  K  E+  L S  N ++   T S+ +D + D +E + Q+  VKR LKQRH     
Sbjct: 59  ITLRKSKLSEIGSLHSGSN-LHQHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIA 117

Query: 98  XXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFS 157
                          PL+NAGPVG+LI+Y+FMGS+ Y VTQSLGEMATFIPVTSS TVFS
Sbjct: 118 LGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFS 177

Query: 158 QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNM 217
           +RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQVIQ+WT AVPLAAWI IFWVI+T MN 
Sbjct: 178 KRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNF 237

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKN 277
           FPVK YGEFEFW+ASIKV+AI+G+LIY   +VCG    GP+GFRYWRNPG WGPGIIS  
Sbjct: 238 FPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDK 297

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
             EARFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI KVVFRI  FYI SL 
Sbjct: 298 TGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLF 357

Query: 338 FIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIGLLVP+ND +L + ++ +++SPF+I+I+N+GT+ LP IFNAV+L TIISAANSN+YVG
Sbjct: 358 FIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVG 417

Query: 398 SRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITG 457
           SRVL+ L+ +  APK FS  TK GVPY+ V  T+  G LA++  +      F WL+NI+ 
Sbjct: 418 SRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINIST 477

Query: 458 VAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTS 517
           +AG  AWLFIS+SHIRFMQALKYRGISRD+LPFKAKLMP  AYYA+FF+ VII IQGF +
Sbjct: 478 LAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQA 537

Query: 518 FTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE 577
           FTP F+   F  +YIS+ L   ++   +L +RCRF+WK+ED+DIDSDRR+IEAI+WEE E
Sbjct: 538 FTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIEAIIWEEDE 597

Query: 578 PKTLWDKFW 586
           PK LW+KFW
Sbjct: 598 PKNLWEKFW 606

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/598 (57%), Positives = 443/598 (74%), Gaps = 13/598 (2%)

Query: 5   KQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDE----KSKE-------LYPLR 53
           ++ + + E+ M   P     H++EA    ++    S+ ++    K K        +  + 
Sbjct: 15  EKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGAIADVN 74

Query: 54  SFPNGVNGQDTFSMEEDI-QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
           S  N +      S E DI +DE+E   ++  VKR LKQRH                    
Sbjct: 75  SITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGIST 134

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           PL+NAGPVG+LI+Y+FMG++ Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG +NGYM
Sbjct: 135 PLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYM 194

Query: 173 YWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           YWF+WA+T+A+E+SV+GQVI++WT  VPLAAWI+IFWVIIT MN FPVK YGEFEFWVAS
Sbjct: 195 YWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVAS 254

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLIN 292
           +KV+AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +K+E RFLGWVSSLIN
Sbjct: 255 VKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLIN 314

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTS 352
           AAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPYND +L++
Sbjct: 315 AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSA 374

Query: 353 ATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPK 412
           +++ +++SPF+I+I+N+GT  LP IFNAV+L T++SAANSN+YVGSRVL+ L+++  APK
Sbjct: 375 SSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPK 434

Query: 413 FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHI 472
            F   T+ GVPY+ V  T+  G LA++  +      F WL+NI+ +AG  AWLFIS++HI
Sbjct: 435 QFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHI 494

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI 532
           RFMQALK+RGISRD+LPFKAKLMP  AYYA FF+ VII IQGF +F P F    F  +YI
Sbjct: 495 RFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYI 553

Query: 533 SVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           S+ L   ++I  ++ ++CRF+WK+ED+DIDSDRR+IEAI+WE+ EPK LW+KFW  V 
Sbjct: 554 SLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/568 (61%), Positives = 436/568 (76%), Gaps = 3/568 (0%)

Query: 25  HDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEV--QNA 82
           H+ + S T    G    +D+   EL+PL      V  +   ++ + +++ED  E    + 
Sbjct: 7   HEKDDSPTISPVGKTE-QDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDT 65

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LI+YLFMGS+ Y +TQSLGE
Sbjct: 66  RVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGE 125

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQVIQFWT AVPLA
Sbjct: 126 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLA 185

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV ++ +N FPVK YGE EFWVASIKVIAI+G+LIY   +VCG    GP+GFRY
Sbjct: 186 AWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRY 245

Query: 263 WRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           WRNPG WGPGIIS +KNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI 
Sbjct: 246 WRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 305

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL F+G+LVP+NDP+L S  + +++SPF+I+I+N+GT+VLPHIFNAV+
Sbjct: 306 KVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVV 365

Query: 383 LTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETS 442
           + TIISAANSN+YVGSRVL+ LS++  APK F   T+ GVPY+ V ATS+ G LA++  +
Sbjct: 366 MLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVN 425

Query: 443 TGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
                 F WL+NI+ +AG  AWLFIS+SHIRFMQALK+RGISRD+LPFKAKLMP  AYYA
Sbjct: 426 NNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYA 485

Query: 503 TFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDID 562
            FF+ VII IQGF +F+P F+   F  AYIS+ + + + I  +L +RCRF+WK+ED+DID
Sbjct: 486 AFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDID 545

Query: 563 SDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           +DRR+IE I+WEE EP+ LW+KFW+++ 
Sbjct: 546 TDRREIECIIWEEEEPQNLWEKFWSIMA 573

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/579 (59%), Positives = 425/579 (73%), Gaps = 13/579 (2%)

Query: 25  HDVEASQTHHRRGSLSLKDEK----SKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEV- 79
           H +E     +  G  ++ DEK     K+L     F   +N          I    E +  
Sbjct: 21  HSIEEGNNVYENGIETINDEKIVFDKKKLAHTNQFNADINSITHSLTRSRIATHHEDDQE 80

Query: 80  --------QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
                    + +VKR LKQRH                    PLTN+GPVG+LI+YLFMGS
Sbjct: 81  EEAEEAQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGS 140

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQV 191
           + Y +TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+TFA+E+SVVGQV
Sbjct: 141 IIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQV 200

Query: 192 IQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I++WT  VPLAAWI+IFWV+IT +N FPVK YGE EFW+A IKV+AI+G+L+Y   +VCG
Sbjct: 201 IEYWTDKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCG 260

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFRYWRNPG WGPGIISK+ N  RFLGWVSSLINAAFT+QGTELVGITAGEAA
Sbjct: 261 GSSQGPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAA 320

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGT 371
           NPRKTVPRAI KVVFRI  FYI SL FIG+LVPYND +L S ++ +++SPF+I+I+N+GT
Sbjct: 321 NPRKTVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGT 380

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
           KVLP IFNA+++ TIISAANSN+YVGSRVL+ L+ S  APK F+  T+ GVPY+ V  TS
Sbjct: 381 KVLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTS 440

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
             G LA++  +      F WL+NI+ +AG  AWLFIS+SHIRFMQALK+RGISRD+LPFK
Sbjct: 441 ALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFK 500

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCR 551
           AKLMP  AYYATFF+ VII IQGF +F+P ++   F  +YIS+ +   ++I  ++ +RCR
Sbjct: 501 AKLMPFGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCR 560

Query: 552 FVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           F W++ED+DIDSDRR+IEA++WE+ EPKTLWDKFW  V 
Sbjct: 561 FFWRVEDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/585 (58%), Positives = 434/585 (74%), Gaps = 6/585 (1%)

Query: 9   EVEEKHMYTEP--AGTFFHDVEASQT-HHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTF 65
           E++  H   E   + T+ +D +   T  +    L  KD KS     +  + +  +     
Sbjct: 27  EMQSIHSNAEKLRSTTYAYDDKKDMTVTYDNEILEKKDSKSDIFTSVNRYASHPSEA--- 83

Query: 66  SMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
            +  D  D  E E ++ +VKR LK RH                    PL  +GPVG+LI+
Sbjct: 84  RISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIA 143

Query: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           Y+FMG++ Y VTQ+LGEMATFIPVTSS TVFS RFLSPAFG +NGY+YWF+WA+T+A+E+
Sbjct: 144 YIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEI 203

Query: 186 SVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           SVVGQVI+FWT  VPLAAWISIFWV++TA+N FPV  YGE EFWVAS+KV+AI+G+LIY 
Sbjct: 204 SVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYA 263

Query: 246 FCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
             +VCG    GP+GFRYWR+  A G G+ISK+KNEARFLGWV+SLINAAFT+QGTELVGI
Sbjct: 264 LVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGI 323

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIA 365
           TAGEAANPRK+VPRAI KVVFRI+ FYI SL FIGLLVPYNDPKL SATSY+++SPF+I+
Sbjct: 324 TAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVIS 383

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
           IEN+GT+ LPHIFNA+I+ TIISAANSN+YV SRVL+ L+ S  APK F++ T  GVP++
Sbjct: 384 IENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFL 443

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
            V  T++ G LA++  +    + F WL+NI+ +AG  AWLFIS+SH+RFM+ALKYRGISR
Sbjct: 444 GVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISR 503

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFE 545
           D+LPFKA+ MP  +YYA FF+ VII IQGFT+F+P F+  +F  AYIS+ L   ++I  +
Sbjct: 504 DDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQ 563

Query: 546 LIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           L +RCRF WK+ED+DID+DRR+I+ IVWE+ EPKT WDKFW  V 
Sbjct: 564 LYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/584 (58%), Positives = 429/584 (73%), Gaps = 7/584 (1%)

Query: 6   QDSEVEEKHMYTEPAGT---FFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQ 62
            + E    ++ T  + T   +  D +   +  ++ +++ K    +  Y +    N     
Sbjct: 16  DNPEYTSNNLSTTASNTNKKYDSDTDMEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAAN 75

Query: 63  DTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
               + +    E+ G VQ+  VKR LKQRH                    PL NAGPVGA
Sbjct: 76  GDLDLSDT---EEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGA 132

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           LI+Y+FMGS+ Y +TQSLGEMATFIPVTSS TVFS+RFLSPAFG  NGYMYWF+WA+T+A
Sbjct: 133 LIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYA 192

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           +E+SVVGQVIQ+WT AVPLAAWI+IFWV +T +N FPVK YGE EFWVASIKV+AIIG+L
Sbjct: 193 VEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYL 252

Query: 243 IYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTEL 302
           IY   +VCG    GP+GFRYWRNPG WGPGIISK+ NE RFLGWVSSLINAAFT+QGTEL
Sbjct: 253 IYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTEL 312

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPF 362
           VGITAGEAANPRK+VPRAI KVVFRI  FYI SL FIGLLVPYND  L+S  SY+++SPF
Sbjct: 313 VGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPF 372

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           +I+I+N+GT  LP IFNAV++ TIISAANSN+YVGSRVL+ L+++  APK F+  TK GV
Sbjct: 373 VISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGV 432

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P++ V  T+  G LA++  +      F WL+NI+ +AG  AW FI++SHIRFMQALKYRG
Sbjct: 433 PWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRG 492

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542
           ISRD+LPFKAKLMP  AYY+ FF+ VII IQGF +FTP ++   F  +YIS+ L + ++I
Sbjct: 493 ISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFI 551

Query: 543 LFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
             +L +RCRF+ K+ED+DID+DRR+IEAI+WE+ EPK LW+KFW
Sbjct: 552 GCQLYYRCRFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFW 595

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/508 (65%), Positives = 409/508 (80%), Gaps = 1/508 (0%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LI+Y+FMG++ Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG +NGYMYWF+WA+T+A+E+SV+GQVIQ+WT  VPLA
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV+IT MN FPVK YGEFEFWVAS+KV+AI+G+LIY   +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 263 WRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIK 322
           WRNPGAWGPGIISKNK+E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL FIGLLVPYN+P+L+ +++ +++SPF+I+I+N+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 383 LTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETS 442
           L T+ISAANSN+YVGSRVL+ L++S  APK F   TK GVPY+ V +T+  G LA++  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 443 TGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
                 F WL++I+ +AG  AWLFIS++HIRFMQALK RGISRD+LPFKAKLMP  AYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 503 TFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDID 562
           +FF+ +II IQGF +F P F+   F  +YIS+ L   ++I  +L ++CRF+WK+ED+DID
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 563 SDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           SDRR+IEAI+WE+ EPK LW+KFW  V 
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/512 (65%), Positives = 411/512 (80%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V +  VKR LKQRH                    PL+N+GPVGALI+Y+FMG++ Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
           SLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQVIQ+WT+ 
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI IFWV+IT MN FPVK YGEFEFWVASIKVIAI+G+LIY   +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 259 GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318
           GFRYWRNPGA G GIIS +  EARFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KVVFRI+ FYI SL F+GLLVPYNDP+L+++++ +++SPF+I+I+N+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 379 NAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAY 438
           NAV+L T+ISAANSN+YVGSRVL+ L++S  APK F+  T+ GVPY+ V  T++ G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 439 METSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +      F WL+NI+ +AG  AWLFIS++HIRFMQALK+RGISRD+LPFKAK MP  
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 499 AYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIED 558
           AYYA+FF+ VII IQGF +F P F+   F  AYIS+ L + ++   +L +RCRF+WK+ED
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 559 VDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           +DIDSDRR+I+AIVWE+ EP+ LW+KFW  V 
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/586 (59%), Positives = 430/586 (73%), Gaps = 28/586 (4%)

Query: 10  VEEKHMYTEPAGTFFHDVEASQT------HHRRGSLSLKDEKSKELYPLRSFPNGVNGQD 63
           VE   + T PAG   +D  A  +      HHR      K+ K++ ++        +N Q+
Sbjct: 2   VENVELETYPAGKQHNDRSAESSESSDVLHHR------KETKNEGIF--------IN-QE 46

Query: 64  TFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGAL 123
             S  E +   D+      +VKR+LK RH                    P+  AGPVG+L
Sbjct: 47  NMSEVESLYGNDD-----PDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSL 101

Query: 124 ISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183
           ++YLFMG++A+ VTQSLGEMATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW VTFAL
Sbjct: 102 LAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFAL 161

Query: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243
           ELS++GQ+IQ+WT+AVPL+ WI +FW+++TA NM PV++YGE EFW+A++KV++I GFLI
Sbjct: 162 ELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLI 221

Query: 244 YCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
           Y   MVCG    G +GFRYW+NPG WG G+IS NK EARFLGWVSSLI AAFT+QGTELV
Sbjct: 222 YALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELV 281

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSPF 362
           GITAGE+ NPRKTVP+AI KV FRIL FYI SL F+GLLVPY DP+L T++ S ++TSPF
Sbjct: 282 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPF 341

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++AI+NSGTKVLP +FN VIL TI+SA NSNIY+GSRVL+GLSKS LAP  F KT K GV
Sbjct: 342 VMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGV 401

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P+ AV  +SIFG LAY+  S    KVF WLL IT VAGFFAWL IS+SHIRFMQ LK RG
Sbjct: 402 PFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRG 461

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542
           ISR++LPFKAK MP  AYYA FF+ VIILIQGF SF P F    F+A YISVFLF+  W+
Sbjct: 462 ISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWL 521

Query: 543 LFELIFRCRFVWKIEDVDIDSDRRDIEAIVW-EEPEPKTLWDKFWN 587
            F+++F+ R + + EDVDID+DRR+I+A+VW ++ EPKTL  K W 
Sbjct: 522 GFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/603 (56%), Positives = 432/603 (71%), Gaps = 16/603 (2%)

Query: 2   TTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPN---- 57
           T  ++ S  E+  +         H++E    H +  S    DEK   +   R   +    
Sbjct: 12  TCDEKQSNFEKHSIQEVSTDQIEHEMEVIDAHDKLSSYC-TDEKQYNMKKKRLLQDDAIA 70

Query: 58  GVNGQDTFSMEEDIQDEDEG----------EVQNAEVKRELKQRHXXXXXXXXXXXXXXX 107
            VN          I   + G            ++  VKR LKQRH               
Sbjct: 71  SVNLITNSLPRSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLF 130

Query: 108 XXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGA 167
                PL+ AGPVG+LISY+FMG++ Y +TQSLGEMATFIPVTSS TVFS+RFLSPAFG 
Sbjct: 131 VGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGV 190

Query: 168 ANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFE 227
           ANGYMYWF+WA+T+A+E+SV+GQVIQ+WT  VPLA WI+IFWV+IT MN FPVK YGEFE
Sbjct: 191 ANGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAVWIAIFWVLITLMNFFPVKVYGEFE 250

Query: 228 FWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWV 287
           FWVAS+KV+AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +KNE RFLGWV
Sbjct: 251 FWVASVKVLAIMGYLIYALVIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWV 310

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
           SSLINAAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPYN+
Sbjct: 311 SSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNE 370

Query: 348 PKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
           P+L+++++ +++SPF+I+I+N+GT  LP IFNAV+L T+ISAANSN+YVGSRVL+ L+++
Sbjct: 371 PRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQT 430

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
             APK F   TK GVPY+ V +T+  G LA++  +      F WL+NI+ +AG  AWLFI
Sbjct: 431 GNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFI 490

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNF 527
           S++HIRFMQAL+ RGISRD+LPFKAKLMP  AYYA FF+ VII IQGF +F P F   +F
Sbjct: 491 SLAHIRFMQALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSDF 549

Query: 528 LAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWN 587
             +YIS+ L   ++   +L ++CRF+WK+ED+DID+DRR+IEAI+WE+ EPK LW+KFW 
Sbjct: 550 FTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDTDRREIEAIIWEDDEPKNLWEKFWA 609

Query: 588 VVG 590
            V 
Sbjct: 610 AVA 612

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/513 (63%), Positives = 407/513 (79%)

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVT 137
           +  + EVKR LKQRH                    PLTN+GPVG+LI+YLFMGS+ YS+T
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY 197
           QSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+T+A+E+SVVGQVI++WT 
Sbjct: 155 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTK 214

Query: 198 AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
            VPLAAWI+IFWV +T MN FPVK YGE EFW+A +KV+AI G+L+Y   +VCG    GP
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGP 274

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +GFRYWRNPG WG GIISK+KN +RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+V
Sbjct: 275 IGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 334

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHI 377
           PRAI KVVFRI  FYI SL FIGLLVPY+DP+L+S ++ V++SPF+I+I+N+GTK+LP I
Sbjct: 335 PRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDI 394

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437
           FNA+++ T+ISAANSN+YVGSRVL+ L+++  APK F+  T+ GVPY+ V  T+  G LA
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  +      F WL+NI+ +AG  AWLFIS+SHIRFMQALK+RGISRD+LPFKAK MP 
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 498 LAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIE 557
            AYYATFF+ VII IQGF +F+P F+   F  AYIS+ +   ++I  ++ +RCRF WK+E
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 558 DVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           D+DID+DRR+IE ++WE+ EPKT WDKFW  V 
Sbjct: 575 DIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/588 (56%), Positives = 429/588 (72%), Gaps = 12/588 (2%)

Query: 11  EEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSME-E 69
           E+     + + T + + E  +  H       KD   K+  P     +  +      +E E
Sbjct: 14  EDSTESNDDSTTSYDNFEIIEIQHNDS----KDNSIKKKIPNSELASLTHAYSRSRVEPE 69

Query: 70  DIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFM 129
             +D +E + ++ +VKRELKQRH                    PL +AGPVGALI+Y+FM
Sbjct: 70  HDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFM 129

Query: 130 GSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVG 189
           GS+ Y VTQ+LGEMATFIPVTSS TVFSQRFLSPAFG ANGYMYWF+WA+TFA+E+SVVG
Sbjct: 130 GSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVG 189

Query: 190 QVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
           QVIQ+WT AVPLAAWI+IFWV++T MN FPVK YGE EFWVA +KVIAI+G+L+Y   +V
Sbjct: 190 QVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIV 249

Query: 250 CGAGV-TGPVGFRYWRNPGAWGPGIISK------NKNEARFLGWVSSLINAAFTFQGTEL 302
           CG     GP+GFRYWRNPGAWG G+ S       +K E RFLGWV+SLINAAFT+QGTEL
Sbjct: 250 CGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTEL 309

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPF 362
           VGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVP+ D +L+  T+ +++SPF
Sbjct: 310 VGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASSPF 369

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           +I+IEN+GTK+LP IFNA+++ T++SAANSN+YVGSRVL+ L+ +K+APK F++ T+ GV
Sbjct: 370 VISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGV 429

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P++ V  TS+ G LA++         F WL++I+ +AG  AWLFIS++H+RFMQ LK RG
Sbjct: 430 PFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRG 489

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542
           ISRD+LPFKAK MP  +YYA F++ VII +QGF +F+P F+   F   YIS+ L   ++I
Sbjct: 490 ISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFI 549

Query: 543 LFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
             +L +RCRF+WK+EDVDIDSDRR+IE  +WE+ EPKT+WDKFW  + 
Sbjct: 550 GAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 438/599 (73%), Gaps = 16/599 (2%)

Query: 5   KQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYP------------L 52
           +QD+  EE+ +  +      H++E   T ++  + S+ DEK   L              +
Sbjct: 16  EQDNS-EEQSIRDDSTNQIEHEMEVIDTSNKPVAYSI-DEKQDNLKKKSGLMLDGTIGDI 73

Query: 53  RSFPNGV-NGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
            S  N +   Q     +    +E+E   ++  V+R LKQRH                   
Sbjct: 74  NSITNSLTRSQIASHEQGGDDEEEEAHYEDKHVRRALKQRHIGMIALGGTIGTGLFVGIS 133

Query: 112 XPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGY 171
            PL+NAGPVG+LI+Y+FMG++ Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG +NGY
Sbjct: 134 TPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGY 193

Query: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           MYWF+WA+T+A+E+SV+GQVI++WT  VPL  WI+IFWV+IT MN FPVK YGEFEFWVA
Sbjct: 194 MYWFNWAITYAVEVSVIGQVIEYWTTKVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVA 253

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           S+KV+AI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS +KNE RFLGWVSSLI
Sbjct: 254 SVKVLAIMGYLIYALVIVCGGSKQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 313

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIGLLVPY DP+L+
Sbjct: 314 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLS 373

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           ++++ +++SPF+I+I+N+GT  LP IFNA++L T+ISAANSN+YVGSRVL+ L+++  AP
Sbjct: 374 ASSAVIASSPFVISIQNAGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAP 433

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           K F   TK GVPY+ V +T+  G LA++  +      F WL+NI+ +AG  AWLFIS+SH
Sbjct: 434 KQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSH 493

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAY 531
           IRFMQAL  RGISRD+LPFKAK MP  AYYA+FF+ VII IQGF SF P F   +F  +Y
Sbjct: 494 IRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIFIQGFQSFCP-FRVADFFTSY 552

Query: 532 ISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           IS+ L   ++   +L ++CRF+WK+ED+DIDSDRR+IEAI+WE+ EPK LW+KFW  V 
Sbjct: 553 ISLILLAVVFTGCQLYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/517 (62%), Positives = 401/517 (77%)

Query: 73  DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSL 132
           ++DEG++Q  +VKR LK RH                    PL++AGPVGALI+Y+FMGS+
Sbjct: 43  EDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSI 102

Query: 133 AYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVI 192
            Y VTQS+GEMATFIPVTSS TVFS RFLSPAFG ANGYMYWF+WA+T+A+E+SV+GQVI
Sbjct: 103 VYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVI 162

Query: 193 QFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           Q+WT AVPLAAWI IFWV IT  N FPV++YGE EFWVASIKVIAI+G+L+Y   +VCG 
Sbjct: 163 QYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGG 222

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
              GP+GFRYWRNPG WG GIIS +K++ RFLGWV+SLINA+FT+QGTELVGITAGEAAN
Sbjct: 223 SKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAAN 282

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTK 372
           PRKTVP+AI KV FRIL FYI SL F+GLLVPYN P L   TS +++SPF+I+I+++GT+
Sbjct: 283 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTR 342

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           +LP IFNAV+L TIISAANSN+YVGSR+LF L+ + +APK FS  T  GVPY+ V  T++
Sbjct: 343 ILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTAL 402

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
            G LA++       + F WL+NI+ +AG  AWLFIS+SHIRFMQ LK RGISRD+LPFK+
Sbjct: 403 LGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKS 462

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRF 552
           KLMP  AYYA F++ VII +QGF +F P F    F   YIS+ L   ++ L +L +RCRF
Sbjct: 463 KLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRF 522

Query: 553 VWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
             ++ED+DIDSDRR+I+A++WEE EP TLW KFW  V
Sbjct: 523 FNRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAV 559

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/528 (61%), Positives = 412/528 (78%), Gaps = 1/528 (0%)

Query: 59  VNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
           +N +     E D  DE E EV   +VKR LKQRH                    PL+ AG
Sbjct: 67  LNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAG 126

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           PVG+LI+Y+FMG++ Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA
Sbjct: 127 PVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWA 186

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
           +T+A+E+SV+GQVIQ+WT AVPLAAWI+IFWV++T MN FPVK YGE EFW+A +KV+AI
Sbjct: 187 ITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAI 246

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           +G+LIY   +VCG    GP+GFRYWR+PGA+GPGIISKNKN  +FLGWV+SLINAAFT+Q
Sbjct: 247 VGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQ 306

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVS 358
           GTELVGITAGEAANPRKTVPRAI KVVFRI+ FYI SL FIG+L+PYND +L++  + ++
Sbjct: 307 GTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIA 366

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
           +SPF+I+I+N+ TKVLP IFNAV++ T++SAANSN+YVGSRVL+ L+ +  APK FS  T
Sbjct: 367 SSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVT 426

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + GVPY+ V  T+  G LA++  +      F WL+NI+ +AG  AWLFIS++HIRFMQAL
Sbjct: 427 RYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQAL 486

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFL 538
           K+RGISRD+LPFKAKLMP  AYYA FF+ VII IQG+ +F P ++   F  +YIS+ L  
Sbjct: 487 KFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLA 545

Query: 539 AIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
            + +  +L +R RF+ K+ED+DID+DRR+IE+IVWE+ EPKTLWDKFW
Sbjct: 546 VLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFW 593

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/562 (58%), Positives = 415/562 (73%), Gaps = 3/562 (0%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDED--EGEVQNAEVKREL 88
            +  RRGS +   E   + +    F   V  QD  S +    D +  EG++Q  +VKR L
Sbjct: 61  HSRARRGSGATAGEPKLKAHS-DDFEMYVYSQDEPSTDPLGSDTESGEGDMQEGKVKRAL 119

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP 148
           K RH                    PL+ +GPVGALI+Y+FMG++ Y VTQS+GEMATFIP
Sbjct: 120 KPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIP 179

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIF 208
           VTSS TVFS RFLSPAFG ANGYMYWF+WA+TFA+ELSV GQVI++WT AVP AAWI+IF
Sbjct: 180 VTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAVPRAAWIAIF 239

Query: 209 WVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGA 268
           WV++T  N FPV++YGE EFWVASIKV+AI+G+LIY   +VCG    GP+GFRYWRNPG 
Sbjct: 240 WVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRNPGP 299

Query: 269 WGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRI 328
           WG GIISK+K+E RFLGWV+SLINA+FT+QGTELVGITAGEAANPR+TVPRAI KV FRI
Sbjct: 300 WGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRI 359

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIIS 388
           L FYI SL F+GLLVPYN   L   T+ +++SPF+I+I+N+GT+ LP IFNAV+L TIIS
Sbjct: 360 LFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPDIFNAVVLVTIIS 419

Query: 389 AANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKV 448
           AANSN+YVGSRVLF L+ + +APK FS  T  GVP++ V  TS+ G LA++  +    + 
Sbjct: 420 AANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEA 479

Query: 449 FAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVV 508
           F WL+NI+ +AG  AWLFIS+SHIRFMQ LK RGISRD+LPFK+KLMP  AYYA F++ V
Sbjct: 480 FNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTV 539

Query: 509 IILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDI 568
           II +QGF +F+P F    F  +YIS+ L + ++   +L +RCRF  ++ED+DIDSDRR+ 
Sbjct: 540 IIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREA 599

Query: 569 EAIVWEEPEPKTLWDKFWNVVG 590
           +A++WE+ EP TLW KFW  V 
Sbjct: 600 DALIWEDDEPTTLWGKFWTAVA 621

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/520 (60%), Positives = 400/520 (76%), Gaps = 1/520 (0%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
           + E EG+    EVKR LK RH                    PL  AGPVG+LI+Y+FMG+
Sbjct: 48  EHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGT 107

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQV 191
           + YS+TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+TFA+ELSVVGQ+
Sbjct: 108 VVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQI 167

Query: 192 IQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I +WT  VPL AWI+IFW+I+T +N FPV++YGE EFW+AS+KVI I+G+LIY F +VCG
Sbjct: 168 INYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCG 227

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFR WRNPG WG G+IS N+ EARFLGWVSSLI AAFT+QGTELVGITAGE+ 
Sbjct: 228 GSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESK 287

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSPFIIAIENSG 370
           NPRKTVP+AI KV FRIL FYI SL F+GLLVPYNDP++  ++ + V+ SPF+I+I N+G
Sbjct: 288 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAG 347

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFAT 430
           TK+LP IFNAV+L T++SAANSN+Y+GSRV++ L++S  APK F    + GVP + V  T
Sbjct: 348 TKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVT 407

Query: 431 SIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPF 490
           ++ G +A++  +      F WL+NI+ +AG  AWLFIS++HIRFMQ LK RGISRD LPF
Sbjct: 408 ALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPF 467

Query: 491 KAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRC 550
           KAK MP  AYYA  F+ VII IQG+T+F+P F+   F  AYIS+ L L ++I  ++ ++C
Sbjct: 468 KAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKC 527

Query: 551 RFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590
           RF+WK+ED+DID++RR+I+AIVWE+ EPK LWDKFW+ + 
Sbjct: 528 RFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/553 (61%), Positives = 424/553 (76%), Gaps = 10/553 (1%)

Query: 38  SLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXX 97
           S  L+D  S E  P+ S           S +    ++ EG+ +  EVKR LK RH     
Sbjct: 20  SKKLEDYVSSETLPIYSH----------SGDNAPCEKGEGDCRETEVKRALKPRHISMIA 69

Query: 98  XXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFS 157
                          PL+ +GPVGALI+Y+F+GS+ Y VTQSLGEMATFIPVTSS TVFS
Sbjct: 70  LGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFS 129

Query: 158 QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNM 217
           +RFLSPAFG ANGYMYWF+WA+T+A+E++VVGQVIQ+WT AVPLAAWI+IFWV++T  N 
Sbjct: 130 KRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANF 189

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKN 277
           FPVK+YGE EFWVAS+KVIAI+G+LIY   +VCG    GP+GFRYWRNPG WGPGIISK+
Sbjct: 190 FPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKD 249

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
            NE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVPRAI KV FRIL FYI SL 
Sbjct: 250 VNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLF 309

Query: 338 FIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIGLLVPY+D +L++ T+ +++SPF+I+I+N+GTKVLPHIFNA+++ TIISAANSN+YVG
Sbjct: 310 FIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVG 369

Query: 398 SRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITG 457
           SRVL+ L+ S  APK F   TK GVPY+ V  T++ G LA++  +    + F WL+NI+ 
Sbjct: 370 SRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNIST 429

Query: 458 VAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTS 517
           +AG  AWLFIS+SH+RFMQ LK+RGISR++LPFKAKLMP  AYYA FF+ VII+IQGF +
Sbjct: 430 LAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKA 489

Query: 518 FTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE 577
           FTP F   +F  +YIS+ L   +++  +L +RCRF+W ++D+DIDSDRR+I+AIVWE+ E
Sbjct: 490 FTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDE 549

Query: 578 PKTLWDKFWNVVG 590
           PK LW+KFW  V 
Sbjct: 550 PKNLWEKFWVAVA 562

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/575 (59%), Positives = 426/575 (74%), Gaps = 23/575 (4%)

Query: 13  KHMYTEPAGTFFHDVEASQTHHRRGSLSLKD-EKSKELYPLRSFPNGVNGQDTFSMEEDI 71
           K M++  +GT     +A +      S+ L D + S ELY                 +   
Sbjct: 23  KGMFSTDSGTLSKRSKAGED-----SIELSDVQVSSELY-----------------DHAE 60

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
            +E EG+    EVKR LK RH                    PL+ +GPVG+LI+Y+FMGS
Sbjct: 61  SEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGS 120

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQV 191
           + Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WA+T+A+ELSV+GQ+
Sbjct: 121 VVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQI 180

Query: 192 IQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I +WT AVPLAAWI+IFWV++TA N FPVK+YGEFEF VASIKVIAI+G+L+Y   +VCG
Sbjct: 181 INYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCG 240

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFRYWRNPG WG G I+KN N+ARFLGWV SL+NA+FT+QGTELVGITAGEA+
Sbjct: 241 GSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGT 371
           NPRKTVP+AI KV FRIL FYIGSL F+GLLVPYN P+L S ++ +++SPF+I+I+N+GT
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGT 360

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
           KVLP IFNAV+L TI+SA NSN+YVGSRVL+ L+ S  APK FS  TK GVPY+ V  T+
Sbjct: 361 KVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTA 420

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
           + G LA++ T+      F WL+NI+ +AG  AW FISV+HIRFMQ LK RGISRD LPFK
Sbjct: 421 LLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFK 480

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCR 551
           AKLMP  AYYA FF+ +I+ IQGFT+F P F+   F  AYIS+ L + ++IL +L +RCR
Sbjct: 481 AKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCR 540

Query: 552 FVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
           F+ KIED+DIDSDRR+I+AI+WE+ EPK LW+KFW
Sbjct: 541 FLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFW 575

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/560 (55%), Positives = 409/560 (73%), Gaps = 4/560 (0%)

Query: 35  RRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDE--DEGEVQNAEVKRELKQRH 92
           +  ++S    +S+ +   ++  N +  Q       +  ++  +EG+ Q  EVKR LK RH
Sbjct: 4   KDTAVSETSTRSRYIKKGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARH 63

Query: 93  XXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSS 152
                               PL  AGPVG+L++Y+F+G++ YS+TQSLGEMATFIPVTSS
Sbjct: 64  ISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSS 123

Query: 153 FTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVII 212
            TVFS+RFLSPAFG ANGYMYWF+WA+TFA+ELSVVGQ+IQ+WT  VP+AAWI IFWV++
Sbjct: 124 VTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLV 183

Query: 213 TAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPG 272
           T +N FPV++YGE EFW+AS+KV+ I+G+LIY F +VCG    GP+G        A G  
Sbjct: 184 TLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGAR 243

Query: 273 IISKNKNEAR-FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTF 331
             S+   +   FLGWVSSLI AAFT+QGTELVGITAGE+ NPRK VP+AI KV FRIL F
Sbjct: 244 ASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFF 303

Query: 332 YIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAA 390
           YIGSLLF+GLLVPY+DP+L S +S  V+ SPF+I+I+N+GTK+LP IFNAV+L T+ISAA
Sbjct: 304 YIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAA 363

Query: 391 NSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFA 450
           NSN+Y+GSRV + L+ +  APK  +  TK GVPY  V  TS+ G ++++  +      F 
Sbjct: 364 NSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFD 423

Query: 451 WLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVII 510
           WL+NI+ +AG  AWLFIS++HIRFMQ LK+RGISRD+LPFKAK MP  AYYATFF+ VII
Sbjct: 424 WLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVII 483

Query: 511 LIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEA 570
            IQG+T+FTP F+   F  +YIS+FL L ++I  ++ ++CRF+W +ED+DIDSDRR+I+A
Sbjct: 484 FIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDA 543

Query: 571 IVWEEPEPKTLWDKFWNVVG 590
           IVWEE EPK +WDKFW+ V 
Sbjct: 544 IVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 389/514 (75%), Gaps = 1/514 (0%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G+  + +VKR LK RH                    PL+ +GPVG+LI+Y+FMGS+ Y 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
           VTQSLGEMATFIPVTSS TVF++RFLSPA G +NGYMYWF+WA+TFA ELSV GQ+IQ+W
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           TY VPLAAWI IFWVI+  +N FPVK YGE EFWV+S+KV+AI+G+LIY   +VCG    
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 256 GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
           GP+GFRYWR+  A+G G ISKNK+EARFLGWVSSLINAAFT+QGTELVGI+AGEAANPRK
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLP 375
           TVPRAI KV+FRI  FYI SL FIGLLVPYND +L+  ++ +++SPF+I++ N+GT  LP
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALP 393

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
            IFNAVIL T++SAANS++Y+ SRVL+ L+    APK F+   + GVPY+ VF T + G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           LA++  S      F WL+NI+ +AG  AW FI  +HIRFMQALK++GISRD+LPFKA+ M
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK 555
           P  AYYA FF+ +II IQG+ +FTP ++  +F  +YIS+ LF  +++   + +R R + K
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIK 572

Query: 556 IEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
           IED+DID+DR+++EA VWEE  P+  W+KFW  V
Sbjct: 573 IEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAV 606

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/530 (59%), Positives = 411/530 (77%), Gaps = 10/530 (1%)

Query: 66  SMEEDIQDEDEGEVQN-------AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
           +++ ++ + +  EV++       ++VKRELK RH                    P+ NAG
Sbjct: 24  AIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAG 83

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           PVG+L++Y+F+ ++AY VTQSLGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW 
Sbjct: 84  PVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWC 143

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
           +TFALE+SV+G++I +W+ AVP+ AW++IFWV++TA+N+ PVK+YGEFEFW+AS+KVIAI
Sbjct: 144 ITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAI 203

Query: 239 IGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           + FL Y   +VCG    G +GFRYW++PG WG GI+S+  + A+FLGWVSSLI AAFTFQ
Sbjct: 204 LCFLFYGLVVVCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQ 263

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTS--ATSY 356
           GTELVG+TAGE  NPR+TVP+AI  V FRIL FYIGSLL IGLLV Y+DP+L    +T+ 
Sbjct: 264 GTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTN 323

Query: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416
            + SPF++AI  +GTKVLP I N VI+ TIISA NSNIYVGSRVL+GL +S LAP F S+
Sbjct: 324 ANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISR 383

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
           TT  GVPY+AV ATS+FGAL Y+  S+  G VF WLL+IT V+GFF WL ISVSHIRFMQ
Sbjct: 384 TTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQ 443

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFL 536
            LK RGISRD+LPFKAK MP  AYYA FF++VIIL+QGFT+FTP F+ V+F+A YIS F+
Sbjct: 444 CLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFI 502

Query: 537 FLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
           F+ IW+LF+ +F+ R+   ++++DID+DRRDI+AI+W++ +P TLW K W
Sbjct: 503 FVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  358 bits (920), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/529 (36%), Positives = 305/529 (57%), Gaps = 11/529 (2%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           N  +  ++F  E+D     +G+     +K+ELK RH                     L  
Sbjct: 23  NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRT 82

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GP   LI+Y F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F 
Sbjct: 83  GGPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFK 141

Query: 177 WAVTFALELSVVGQVIQFWT--YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIK 234
           + +    +L+    VIQ+W     V    WI+IF V+I  +N   V+Y+GEFEFW++S K
Sbjct: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201

Query: 235 VIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINA 293
           ++ + G +++ F ++ G G     +GFRYW+NPGA+ P   S   ++ +F+ +V+  + A
Sbjct: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYA 261

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--- 350
            F + G EL GI A EA NPR+ +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L   
Sbjct: 262 LFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAA 321

Query: 351 TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
             A++  + SPF++AI+NSG + LPHIFN  +L  + SA NS++YVG+R L+ L+    A
Sbjct: 322 AHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKA 381

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           PK F+KT + GVPY A+F   +F  LAYM  S+G  ++F + +N+  + G  +W+ I ++
Sbjct: 382 PKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILIT 441

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAA 530
           +I F +A   + + R+   ++A   P  AY   FF V+I  I+ FT F   F+  +F+  
Sbjct: 442 YIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITG 501

Query: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPK 579
           YI + L++  +  +++I++ + V K E+ D+ S +   EAI  EE E K
Sbjct: 502 YIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFK---EAIDREEAEGK 546

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/540 (35%), Positives = 312/540 (57%), Gaps = 21/540 (3%)

Query: 59  VNGQDTFSM------EEDIQDE--DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           +N  D  S       + + QD+  D+G+ ++  ++++LK RH                  
Sbjct: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGT 112

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              L  AGP+   I+Y F+G L +    +LGEMA++IP+   FT ++ R+  PA G A G
Sbjct: 113 GNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171

Query: 171 YMYWFSWAVTFALELSVVGQVIQFW--TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEF 228
           Y Y   + +    +L+    VIQ+W     V    WI+IF VII AMN   VK++GEFEF
Sbjct: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231

Query: 229 WVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWV 287
           W+++ KVI +IG +I  F ++ G G T   +GFR++ +PGA+ P   S + ++ +F+ +V
Sbjct: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFV 291

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
           + L+ A F + G EL GI A EAANPRK++P+AIK  ++RI+ FY+ ++  +G+ V Y+D
Sbjct: 292 AVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351

Query: 348 PKLTSATSY---VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGL 404
           P L  A +     + SP+++AI NSG K LPHIFNA +L  + SA NS++YV SR L+GL
Sbjct: 352 PLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411

Query: 405 SKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAW 464
           +    APK F+ T + GVPY ++  +S F  LAYM  S+G  K+F + +N+  + G  +W
Sbjct: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471

Query: 465 LFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSF-TPTFN 523
           + I ++++ F +A+K + + R    ++A   P  +Y+   F ++I  I+ FT F    F+
Sbjct: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531

Query: 524 GVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWD 583
             NF+  YI + +F+  +  ++ + + + +WK E+VD+ + +  I+    EE E   + D
Sbjct: 532 YKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID----EEEEQGKIAD 586

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/559 (36%), Positives = 322/559 (57%), Gaps = 23/559 (4%)

Query: 41  LKDEKSKELYPLRSFPN---------GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQR 91
           ++D   K+L  + S  N          ++ QD  S +E   + D G+     +K+EL+ R
Sbjct: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNID-GKHDGIRLKKELEAR 62

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTS 151
           H                     L+ AGPV  LI+Y F+G L Y V   LGEMAT+IP+  
Sbjct: 63  HVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPL-D 121

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY--AVPLAAWISIFW 209
            FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W     V    WI+IF 
Sbjct: 122 GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFL 181

Query: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGA 268
           VII  +N+  VK++GEFEFW++S KV+ ++  ++  F ++ G G +   +GFR++++PGA
Sbjct: 182 VIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGA 241

Query: 269 WGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRI 328
           + P   + + ++ +F+ +V+  + A F + GTEL GI A E  NPR+ VPRAIK  ++RI
Sbjct: 242 FRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRI 301

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENSGTKVLPHIFNAVILTT 385
           + FY+ ++  +G+ V YNDP L  A   ++  + SPF++AI+N+G  VLPHIFNA +L  
Sbjct: 302 VVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMF 361

Query: 386 IISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGG 445
           + SA NS++YV SR L+GL+    APK F+KT K GVPY ++    +F  LAYM  S+G 
Sbjct: 362 VFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGS 421

Query: 446 GKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFF 505
            +VF + +N+  + G  +W+ I +++I F +AL+ +G+ +  L + A L    AY+A FF
Sbjct: 422 AQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFF 481

Query: 506 MVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSD 564
             +I LI+ FT F    F+  NF+  YI + +F+  +  ++ I   +FV K E+ D+ + 
Sbjct: 482 CCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-KPEEADLYTF 540

Query: 565 RRDIEAIVWEEPEPKTLWD 583
           +   E I  EE E K LWD
Sbjct: 541 K---ELIDLEEEEGK-LWD 555

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 313/538 (58%), Gaps = 9/538 (1%)

Query: 40  SLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXX 99
           S++ + +  LY   +   G+   ++      + +  +G+ +   +K+EL+ RH       
Sbjct: 6   SMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIG 65

Query: 100 XXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQR 159
                         L +AGPV  LISY F+G L Y+V   LGEMA FIP+   FT ++ R
Sbjct: 66  GSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL-DGFTSYASR 124

Query: 160 FLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNM 217
           ++ PA G A GY Y F + +    +L+    V+QFW     V    WI+IF  +I  +N 
Sbjct: 125 YVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINT 184

Query: 218 FPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISK 276
             V+++GEFEFW++S+KV+ ++G ++  F ++ G G      GFR+WR+PGA+ P   + 
Sbjct: 185 VGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAI 244

Query: 277 NKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSL 336
           + ++ +F+ + S    A F + GTEL GI A EA NPR++VPRAIK  ++RI+ FY+ ++
Sbjct: 245 SGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITI 304

Query: 337 LFIGLLVPYNDPKLTSATSYVST---SPFIIAIENSGTKVLPHIFNAVILTTIISAANSN 393
           L +G+ V YNDP+L  A    ++   SPF++AIEN+   VLPHIFN  +L  + SA NS+
Sbjct: 305 LLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSD 364

Query: 394 IYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLL 453
           +YV SR L+GL+    AP+ F+ T K GVPY ++  + +F  LAYM  S+G  +VF + +
Sbjct: 365 LYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFV 424

Query: 454 NITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQ 513
           N+  + G  +W+ I +++IRF +A++ +   +  L + A   P   Y A FF  +I LI+
Sbjct: 425 NVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIK 484

Query: 514 GFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEA 570
            +T F    F+   F++ YI + ++L  ++ +++++R + + K EDVD+ + +  I+A
Sbjct: 485 NYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI-KPEDVDLYTFKDAIDA 541

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  338 bits (866), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/521 (36%), Positives = 298/521 (57%), Gaps = 17/521 (3%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G+     +K++LK RH                     L  AGP   LI+Y F+G+L + 
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
              +LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    VIQ+W
Sbjct: 134 TMAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYW 192

Query: 196 TY--AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
                V    WI+IF V+I A+N   VKY+GEFEFW++S K++ +IG +I+ F ++ G G
Sbjct: 193 VDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGG 252

Query: 254 VTGP-VGFRYWRNPGAWGP---GIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGE 309
                +GFRYW+ PGA+ P    +++   +  +F+ +V+  + A F + G EL GI A E
Sbjct: 253 PNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAE 312

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAI 366
           A NPR+ +PRAIK  V+RIL FY+ ++  +G+ V Y+DP L    +A +  + SPF++AI
Sbjct: 313 AENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAI 372

Query: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIA 426
           +NSG  VLPHIFN  +L  + SA NS++YVG+R L+ L+    APK F+KT + GVPY A
Sbjct: 373 QNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNA 432

Query: 427 VFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRD 486
           +    +F  LAYM  S+G  ++F + +N+  + G  +W  I ++ I F +A++ +GI R 
Sbjct: 433 MGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRS 492

Query: 487 ELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-FNGVNFLAAYISVFLFLAIWILFE 545
              + A   P  +Y+A FF V++ LI+ F+ F    F+   F+  YI + ++   +I ++
Sbjct: 493 TFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYK 552

Query: 546 LIFRCRFVWKIEDVDIDS-----DRRDIEAIVWEEPEPKTL 581
           L ++ + V K  + D++S     DR + E  + E    + L
Sbjct: 553 LYYKTKTV-KPHEADLNSYKAAVDREEEEGKIKEAERKERL 592

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  337 bits (864), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/553 (35%), Positives = 317/553 (57%), Gaps = 18/553 (3%)

Query: 45  KSKELYPLRSFPNGVNGQDTFSMEEDIQDED----EGEVQNAEVKRELKQRHXXXXXXXX 100
           K +E+Y +    N V+ + + S     +D+     +G+ +N  +K+ELK RH        
Sbjct: 37  KEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAIADGKDENTRLKKELKARHISMIAIGG 96

Query: 101 XXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF 160
                        L   GPV  LI+Y F+G L +     LGEMA++IP+   FT ++ R+
Sbjct: 97  SLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRY 155

Query: 161 LSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNMF 218
           + PA G A GY Y F + +    +L+    VIQ+W     V    WI+IF V+I A+N+ 
Sbjct: 156 VDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIV 215

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            VK++GEFEFW++S KV+ ++G ++  F ++ G G     +GFRYWR+PGA+     +  
Sbjct: 216 GVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAIT 275

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
            +  +F  +V+  + + F++ G EL GI   EA NPRK+VP+AIK  V+RI+ FY+ ++ 
Sbjct: 276 GSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVF 335

Query: 338 FIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNI 394
            +G+ V YNDP+L S    +   + SPF++AI+NSG KVLPHIFNA +L  + SA NS++
Sbjct: 336 LLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDL 395

Query: 395 YVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLN 454
           YV SR L+ L+    APK F+KT+K GVPY A+  + +F  LAYM  S+G  K+F + +N
Sbjct: 396 YVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVN 455

Query: 455 ITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQG 514
           +  + G  +W+ I + +I F +A + +GI + +  + A      AY+A  F ++I LI+ 
Sbjct: 456 VVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKN 515

Query: 515 FTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDS-----DRRDI 568
           FT F    F+   F+  YI + +++  W  ++LI++ + V K  DVD+ +     DR + 
Sbjct: 516 FTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK-VIKSTDVDLYTFKEIYDREEE 574

Query: 569 EAIVWEEPEPKTL 581
           E  + ++   + L
Sbjct: 575 EGRIKDQEREERL 587

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/519 (36%), Positives = 300/519 (57%), Gaps = 16/519 (3%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAY 134
           D+G+ +   +K+ LK RH                     L  AGP    I+Y F+G L +
Sbjct: 55  DDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVF 114

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQF 194
                LGEMA FIP+   FT ++ R++ PA G A GY Y   + +  A +L+    V+Q+
Sbjct: 115 FTMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 195 WTYAVPL--AAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           W     L    +I+IF ++I  +N+F VK +GEFEFW++S KV+ ++G ++  F ++ G 
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGG 233

Query: 253 GVTGP-VGFRYWRNPGAWGP---GIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAG 308
           G     +GFRYWR+PG++ P    IIS + +  +F+ + S  + A F + G EL GI A 
Sbjct: 234 GPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAA 293

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT---SYVSTSPFIIA 365
           EA NPRK +P+AIK  ++RI+ FY+ ++L + + V YNDP L  AT   +  + SPF++A
Sbjct: 294 EAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVA 353

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
           IENSG  +LPHIFN  +L  ++SAANS++YV SR L+ L+    APKFF KT K G+PY 
Sbjct: 354 IENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYW 413

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
           ++  ++ F  LAYM  S+    VF + +N   + G  +W+ I V++I F +A K +G+ +
Sbjct: 414 SLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDK 473

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILF 544
               + A   P  AY+A FF  V+ L++ FT F    F+  NF+  YI + +F   ++ +
Sbjct: 474 SNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGY 533

Query: 545 ELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWD 583
           +++++ +   + E+VD+ +    ++A++ +E E   + D
Sbjct: 534 KIVYKTK-THRPEEVDLVT----LKALIDQEEEDGKIED 567

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/596 (33%), Positives = 334/596 (56%), Gaps = 34/596 (5%)

Query: 2   TTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNG 61
           T+P+  S ++  H             +A  +     +  +K++   E+Y +    N V+ 
Sbjct: 12  TSPRNSSSLDSDH-------------DAYYSKQNPDNFPVKEQ---EIYNIDLEENNVSS 55

Query: 62  QDTFSMEEDIQDED----EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
           + + S     +D+     +G+ +N  ++++LK RH                     L   
Sbjct: 56  RSSTSTSPSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTG 115

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPV  LI+Y F+G L +     LGEMA++IP+   FT ++ R++ PA G A GY Y F +
Sbjct: 116 GPVAMLIAYAFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKY 174

Query: 178 AVTFALELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKV 235
            +    +L+    VIQ+W     V    WI+IF V+I A+N+  VK++GEFEFW++S KV
Sbjct: 175 FILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKV 234

Query: 236 IAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAA 294
           + ++G ++  F ++ G G     +GFRYWR+PGA+     +    + +F+ +V+  + + 
Sbjct: 235 MVMLGLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSL 294

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA- 353
           F++ G EL GI   EA NPRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L S  
Sbjct: 295 FSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK 354

Query: 354 --TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
             +   + SPF++AI+NSG +VLPHIFNA +L  + SA NS++YV SR L+ L+    AP
Sbjct: 355 GKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAP 414

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           K F+KT++ GVPY A+  + +F  LAYM  S+G  K+F + +N+  + G  +W+ I + +
Sbjct: 415 KIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVY 474

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAA 530
           I F +A + +GI + +  + A      AY+A FF ++I LI+ FT F    F+   F+  
Sbjct: 475 IYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITG 534

Query: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDS-----DRRDIEAIVWEEPEPKTL 581
           YI + +++  W  ++LI++ + V K  DVD+ +     DR + E  + ++ + + L
Sbjct: 535 YIGLPVYIISWAGYKLIYKTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/551 (35%), Positives = 313/551 (56%), Gaps = 17/551 (3%)

Query: 45  KSKELYPLRSFPNGVNGQDTFSMEEDIQDED----EGEVQNAEVKRELKQRHXXXXXXXX 100
           K +E+Y +    N V+ + + S     +D+     +G+ +   ++++LK RH        
Sbjct: 37  KEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGG 96

Query: 101 XXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF 160
                        L   GPV  LI+Y F+G L +     LGEMA++IP+   FT ++ R+
Sbjct: 97  SLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEMASYIPL-DGFTSYASRY 155

Query: 161 LSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNMF 218
           + PA G A GY Y F + +    +L+    VIQ+W     V    WI+IF V+I A+N+ 
Sbjct: 156 VDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFLVVIVAINIV 215

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            V+++GEFEFW++S KV+ ++G ++  F ++ G G     +GFRYWR+PGA+     +  
Sbjct: 216 GVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAIT 275

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
            ++ +F+ + S  + + F++ G EL GI   EA NPRK+VP+AIK  V+RI+ FY+ ++ 
Sbjct: 276 GSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVF 335

Query: 338 FIGLLVPYNDPKLTSATSYV---STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNI 394
            +G+ V YNDP+L S        + SPF++AI+NSG KVLPHIFN  +L  + SA NS++
Sbjct: 336 LLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDL 395

Query: 395 YVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLN 454
           YV SR L+ L+    APK F+KT+K GVPY A+  + +F  LAYM  S G  K+F + +N
Sbjct: 396 YVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVN 455

Query: 455 ITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQG 514
           +  + G  +W+ I + +I F +A + +G+ + +  + A      AY+A FF ++I LI+ 
Sbjct: 456 VVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKN 515

Query: 515 FTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVW 573
           FT F   TF+   F+  YI + +++  W+ ++LI++ + V        D+D   ++ I  
Sbjct: 516 FTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVVKP-----ADADLYTLKEIYD 570

Query: 574 EEPEPKTLWDK 584
            E E   L D+
Sbjct: 571 REEEQGKLQDQ 581

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/570 (35%), Positives = 317/570 (55%), Gaps = 22/570 (3%)

Query: 25  HDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQD------EDEGE 78
            D+E  Q     G  ++  E+S +L+      + V+G  T     D+++      E +G+
Sbjct: 18  EDIEKQQLF---GDDNIVIERSSQLFYDGQSDSKVHGI-TSGHGSDVKNVVTHTSEFDGK 73

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
                +K+ L+ RH                     L  AGP   LI+Y F+G L + V  
Sbjct: 74  HDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMS 133

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY- 197
            LGEMA +IP+   FT +S R+  PA G A GY Y F + +    +L+    VIQ+W   
Sbjct: 134 CLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192

Query: 198 -AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG 256
             V    WI+I  V I  +N   V+++GE E++++++K+  ++G +I    + CG G   
Sbjct: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNH 252

Query: 257 PV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
            V GF+YW+NPGA+     +    + RF+ + S  + A F + GTEL GI   E  NPRK
Sbjct: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312

Query: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATS---YVSTSPFIIAIENSGTK 372
            VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L SA S     S SPF++AI N+G  
Sbjct: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIP 372

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           VLPHI NA IL  + SAANS++YV SR L+GL+    AP+ F+KT K GVPY ++    +
Sbjct: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           F  LAYM  S+G  +VF + +N   + G  +W+ I +++IRF +A + +GI +  L +++
Sbjct: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCR 551
            L P  A+++ FF ++I LI+ F +F   TF+  +F+  YI +  ++  +I ++L ++ +
Sbjct: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTK 552

Query: 552 FVWKIEDVDIDSDRRDIEAIVWEEPEPKTL 581
            +   E+VD+ S +   EA+  EE E K L
Sbjct: 553 IIPS-EEVDLVSFK---EAVDLEEEEGKML 578

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/570 (33%), Positives = 309/570 (54%), Gaps = 32/570 (5%)

Query: 37  GSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE-VKRELKQRHXXX 95
           G  S+ D+++ +++ L          DT S+        E + +    +K+ L+ RH   
Sbjct: 11  GQTSIVDKQTGQVFEL----------DTESLSALNTGGSESQKREPHTLKQGLQSRHIQL 60

Query: 96  XXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTS---- 151
                             L+  GP G L SY+ +  + Y V  +LGEM  ++P +     
Sbjct: 61  IALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSG 120

Query: 152 -SFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210
            S +    R+  P+ G A G+ Y++ + +  A E +    V+ +WT  VP AAWI+IF  
Sbjct: 121 GSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLG 180

Query: 211 IITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAW 269
           ++T +N  PVK+YGE EFW A +K++ I+G L   F +  G G +   +GFRYW+ PGA+
Sbjct: 181 VVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAF 240

Query: 270 GPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRI 328
              I + N    RFL   + +I   F F  G ELV +T+ EA + R+ + +A ++  +R+
Sbjct: 241 AYHITTGNTG--RFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRL 298

Query: 329 LTFYIGSLLFIGLLVPYNDP----KLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILT 384
           + FY+ S L IG++V  NDP     L S  +  ++SPF+IAI+N+  K+LPHI NA IL+
Sbjct: 299 IFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILS 358

Query: 385 TIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTG 444
           +  S+ NS ++  SR L  +++  +APK F K  + GVPY AV  ++ F  LAY+  S+G
Sbjct: 359 SAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSG 418

Query: 445 GGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATF 504
             K F W  NI+ ++GF  W+ I V+++RF +A+ +RG+  D +PFK+   P   Y+   
Sbjct: 419 SAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFII 477

Query: 505 FMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI--EDVDI 561
            + +I L  G+ +F P F  G +F+AAYI++ +F+ +W+  ++  R    W I   +VD+
Sbjct: 478 VVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDV 537

Query: 562 DSDRRDIEAIVWE----EPEPKTLWDKFWN 587
            +   +IE +  E       P + W+KF +
Sbjct: 538 TTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/572 (34%), Positives = 321/572 (56%), Gaps = 21/572 (3%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDED----EGEVQN 81
           D +A  +     S  +K++   E+Y +    N V+ + +       +D+     +G+ + 
Sbjct: 22  DRDAYYSKQNPDSFPVKEQ---EIYNIDLEENNVSSRSSTFTSPSARDDSFAVPDGKDET 78

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
             ++++LK RH                     L   GPV  LI+Y F+G L +     LG
Sbjct: 79  TRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLG 138

Query: 142 EMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA--V 199
           EMA++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W     V
Sbjct: 139 EMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRV 197

Query: 200 PLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-V 258
               WI+IF V+I A+N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G     +
Sbjct: 198 NPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRL 257

Query: 259 GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318
           GFRYWR+PGA+     +    + +F+ +++  + + F++ G EL GI   EA NPRK+VP
Sbjct: 258 GFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVP 317

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV---STSPFIIAIENSGTKVLP 375
           +AIK  V+RI+ FY+ ++  +G+ V YNDP+L S        + SPF++AI+NSG KVLP
Sbjct: 318 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLP 377

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
           HIFNA +L  + SA NS++YV SR L+ L+    APK FSKT K GVPY A+  + +F  
Sbjct: 378 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCC 437

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           LAYM  S G  K+F + +N+  + G  +W+ I + +I F +A + +GI + +  + A   
Sbjct: 438 LAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 497

Query: 496 PGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVW 554
              AY+A  F + I LI+ FT F    F+   F+  YI + +++  W+ ++LI++ + V 
Sbjct: 498 RYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTK-VI 556

Query: 555 KIEDVDIDS-----DRRDIEAIVWEEPEPKTL 581
           K  DVD+ +     DR + +  + ++ + + L
Sbjct: 557 KSTDVDLYTFKEIYDREEEQGKIEDQEKEERL 588

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  331 bits (849), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/583 (33%), Positives = 315/583 (54%), Gaps = 38/583 (6%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVK 85
           D+EA Q +      SL D  +K+   L       +   T S+EED  +          +K
Sbjct: 29  DMEAQQMNLDD---SLDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYTNT---------LK 76

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145
           + LK RH                     L   GP G  I+Y  + S+ Y +  ++GEM  
Sbjct: 77  QGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVC 136

Query: 146 FIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVP 200
           ++P        S T   +R++  +   A G+ Y++ + +  A E +    V+++WT AVP
Sbjct: 137 YLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVP 196

Query: 201 LAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VG 259
            AAWI+IF  II  +NM  VKY+GE EFW ASIK++ I+G +I  F +  G G +   +G
Sbjct: 197 KAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLG 256

Query: 260 FRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVP 318
           FRYW+NPGA+   +   + +   FL   S +I  AF F  G ELV +T+ E ++ R+ + 
Sbjct: 257 FRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIA 314

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVL 374
           +A K+ ++R++ FYI   L IG++V +NDP L SA S       +SPF+I I+N+G +VL
Sbjct: 315 KASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVL 374

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           PHI NA ILT+  S+ N+ ++  SR LF ++++  APK F +  K GVPY+AV  +++  
Sbjct: 375 PHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLIS 434

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LAY+  S+   +VF WL NI+ ++GF  W+   ++++RF +A+ Y  +  D +PFK   
Sbjct: 435 CLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWG 493

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFR---- 549
            P L  ++   + +I +  G+ +F P F N  +F+AAYI++ +FLA+++  ++       
Sbjct: 494 QPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKND 553

Query: 550 ---CRFVWKIEDVDIDSDRRDIEAIVWEEPE----PKTLWDKF 585
               +  + +ED+D+ +   +IE    E  E    P   W++F
Sbjct: 554 YPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/513 (35%), Positives = 302/513 (58%), Gaps = 14/513 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G+ +   +K++L+ RH                     L+ AGP+  LI+Y  MG + ++
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + V    +L+    V+Q+W
Sbjct: 110 VMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 196 TY--AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
                V    WI++F  +I  +N+  VK++GEFEFW++S KV+ ++  +     +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 254 VT-GPVGFRYWRNPGAWGP--GIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEA 310
            +   +GFRYW++PG + P  G +S    + +F+ + S  + A F + GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAIE 367
            NPR+ VPRAIK  ++RI+ FY+ ++  +GL V YNDP L     A +  + SP+++AI+
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
           N+G  VLPHIFNA +LT + SA NS++YVGSR L+GL+  K APK F+KT   GVPY ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
              ++F  LAYM  S+    +F++ +N+T + G  +W+ I +++I F +A + +GI ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFEL 546
           L ++A   P  A+ A  F +++ L++ FT F   TF+   F+  YI + +++  ++ +++
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 547 IFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPK 579
           + + +++ K  +VD+ + +  I+    EE E K
Sbjct: 529 VHKTKWI-KSANVDLFTYKTAIDL---EEEEGK 557

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/515 (35%), Positives = 304/515 (59%), Gaps = 15/515 (2%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ L+ RH                     L+ AGP    I+Y F+G L +    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY--AVPL 201
           A++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W     V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 202 AAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260
             WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 261 RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320
           RYW++PGA+ P   + + +  +F+ +VS  + A F + G EL GI A EA NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT---SYVSTSPFIIAIENSGTKVLPHI 377
           +K  V+RI+ FY+ ++  +G+ V YNDP+L +A    +  + SPF++AI+NSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437
           FNA +L  + SA NS++YVGSR L+ L+    AP  F +TT  G+P+ ++    +F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497
           YM  S+G  +VF + +N+  + G  +W+ I +++I FM+A+K +G+ R +  + A   P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 498 LAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI 556
             Y++  + V I  I+ FT F   +F+  NF+  YI + +F+  +  ++ I + + V K 
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576

Query: 557 EDVDIDS-----DRRDIEA-IVWEEPEPKTLWDKF 585
            +VD+ +     D+++IE  I+ +E + +   +KF
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/502 (36%), Positives = 298/502 (59%), Gaps = 9/502 (1%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G+ +   +K+ L+ RH                     L +AGP   LISY F+G L Y+
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + +    +L+    V+Q+W
Sbjct: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 196 TY--AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
                V    WI+IF V+I  +N   V+++GEFEFW++S+KV+ ++G ++  F ++ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
                 GFRYWR+PGA+ P   + + ++ +F+ + S    A F + GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENS 369
           PR++VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L  A   ++  + SPF++AI+N+
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+  + APK F+KT   GVPY ++  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489
           + +F  LAYM  S+G  ++F + +N+  + G  +W+ I ++++RF +A+  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIF 548
           + A   P   + + FF  +I LI+ +T F   TF+   F++ YI + ++   ++ ++L+ 
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 549 RCRFVWKIEDVDIDSDRRDIEA 570
           R + + K EDVD+ + +  I+A
Sbjct: 522 RSKLI-KPEDVDLYTFKAAIDA 542

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/534 (35%), Positives = 303/534 (56%), Gaps = 18/534 (3%)

Query: 62  QDTFSMEEDIQDEDE-----GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           ++  S+    +D+++     G+ +   +K+ L+ R                      L  
Sbjct: 44  ENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLAT 103

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           AGPV  LI+Y F+G L +    SLGEMA++IP+   FT ++ R+  PA G A GY Y F 
Sbjct: 104 AGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFK 162

Query: 177 WAVTFALELSVVGQVIQFWT--YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIK 234
           + +    +L+    VIQ+W     V    WI+IF V+I A+N   V+++GEFEFW++S K
Sbjct: 163 YFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFK 222

Query: 235 VIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINA 293
           V+ +   +I  F ++ G G     +GFR+W++PGA+     +   +  +F+ +VS  + A
Sbjct: 223 VLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYA 282

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA 353
            F + GTELVGI  GEA NPRK+VP+AIK  ++RI+ FY+ S+L +G+ V Y+DP L  A
Sbjct: 283 TFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEA 342

Query: 354 ---TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
              ++  + SPF++AI NSG KVLPHIFNA +L  + SA NS++YV SR L+ L+    A
Sbjct: 343 KTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKA 402

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           PK F++T + G+PY ++  + +F  LAYM  S+G  K+F + +N+  + G  +W+ I V+
Sbjct: 403 PKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVT 462

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLA 529
           ++ F +A++ +GI +    + A      AY+A FF  +I LI+ FT F    F+   F+ 
Sbjct: 463 YLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFIT 522

Query: 530 AYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWD 583
            YI + +F   +  ++LI++ + +  +E      D    +A + +E E   L D
Sbjct: 523 GYIGIPVFFISYFGYKLIYKTKIIDPLE-----VDLYTFKAAIDQEEEDGKLED 571

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 292/509 (57%), Gaps = 11/509 (2%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G+ +   +K++LK RH                     L  AGPV  LI+Y F+G + + 
Sbjct: 57  DGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFF 116

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGEMATFIP+   FT ++ R+  PA G A GY Y   + +    +L+    V+Q+W
Sbjct: 117 TMACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYW 175

Query: 196 T--YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC-MVCGA 252
                V    W+++ + +IT +N+F V+++GEFEFW++S+KV+ +IG +I  F  M+ GA
Sbjct: 176 VPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGA 235

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G    +GFRYW++PGA+       + +  +F+ +V+ L+   F + G EL GI A EA+N
Sbjct: 236 GSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASN 295

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSPFIIAIENSGT 371
           PR++VP+AIK   +RIL FY+ S+  +G+ VPYND KL T+  + ++ SPF IAI N+G 
Sbjct: 296 PRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGI 355

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
            VLP IFN  +L  + SAANS++YV SR L+ L+    APK F+ T + G+PY ++F + 
Sbjct: 356 TVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSC 415

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
           +F  LAYM  S+   +VF + +N+  +AG   W+ I +++I F +A++ + + +    + 
Sbjct: 416 LFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYV 475

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCR 551
           A   P  AY + FF  +I +I+ FT F   F+   F+  YI + +F+  +  +++  +  
Sbjct: 476 APFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSE 535

Query: 552 FVWKIEDVDIDS-----DRRDIEAIVWEE 575
            +     VD+ S     DR  +E  + E+
Sbjct: 536 -IRSARYVDLVSQKSLVDREQVEYELIEQ 563

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/562 (33%), Positives = 298/562 (53%), Gaps = 15/562 (2%)

Query: 38  SLSLKDEKSKELYPLRSFPNGVNGQDTF-SMEEDIQDEDEGEVQNAE--VKRELKQRHXX 94
           SL +K E S             + ++T+ +   +++ ++   V + E  +K+ L  RH  
Sbjct: 2   SLEIKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQ 61

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154
                              LT  GP    +S++ + ++ Y +  +L EM  ++P   S  
Sbjct: 62  LIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVP 121

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITA 214
               R++ P+ G A G+ Y +S+A+  A EL+    ++++WT  VP   WI+IF +++  
Sbjct: 122 ELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVV 181

Query: 215 MNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMV-CGAGVTGPVGFRYWRNPGAWGPGI 273
           +N   V++YGE EFW AS+K+I I+  L+    +   GA     VGFRYWRNPGA+G  I
Sbjct: 182 LNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHI 241

Query: 274 ISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFY 332
                N  RFL   +++I +AF F    ELVG+   EA + R+ + +A ++ ++RI+ FY
Sbjct: 242 --TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFY 299

Query: 333 IGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIIS 388
           + S L IG++V  ND  L  A        ++SPF+  I NSG  VL H+ N  ILT+  S
Sbjct: 300 LSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWS 359

Query: 389 AANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKV 448
           A NS  Y  SR +  LSK   APK FSK  + GVPY AVF  S+   LAY+  S+   KV
Sbjct: 360 AGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKV 419

Query: 449 FAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVV 508
           F WL NI  ++GF  W  I V++IRF +A+ +  +  D +P+++ L P  AY+ T  + +
Sbjct: 420 FQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAI 478

Query: 509 IILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRD 567
           I L  G+  F    ++  +FL +YIS+ +FLA ++  + I++ RF   ++ +D+ +   +
Sbjct: 479 ITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVITGLEE 538

Query: 568 IEAIVWEE--PEPKTLWDKFWN 587
            E          PK  W+KF N
Sbjct: 539 AEEEAKLSVVRVPKNAWEKFIN 560

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/598 (32%), Positives = 309/598 (51%), Gaps = 23/598 (3%)

Query: 12  EKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDI 71
           EK+      G+   D   + T    G+L  KD+ +K +  +           T S +   
Sbjct: 4   EKYPGLTVVGSSSDDAATTHTIGSAGALPAKDKYNKTIEFVDVESQQSTSSATISEKLGD 63

Query: 72  QDEDEGEVQN-AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMG 130
            D D     N   +++ LK RH                     L   GP G  ISY+ + 
Sbjct: 64  GDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIIS 123

Query: 131 SLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           S+ Y +    GEM  ++P      + S      R++  + G A  + Y++ + +  A E 
Sbjct: 124 SVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAEC 183

Query: 186 SVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           +    V+++WT AVP   WI IF  I+  +N  PVKYYGE EFW ASIK++ I+G +I  
Sbjct: 184 TAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILS 243

Query: 246 FCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELV 303
           F +  G G     +GFRYW+ PGA+   I+       RFL   S +I   F F  G ELV
Sbjct: 244 FILFWGGGPNHDRLGFRYWQRPGAFTEHIM--KGGFGRFLDIYSGVIKGGFAFILGPELV 301

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VST 359
            +T+ E  + R+ + +A ++ ++R++ FY+   L I ++V YNDP L SA +       +
Sbjct: 302 CLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGS 361

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTK 419
           SPF+I I+N+G +VLPHI NA IL++  SA N+ ++  +R L  ++++  AP+ F K  +
Sbjct: 362 SPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINR 421

Query: 420 GGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALK 479
            GVPY+A+  +     LA++  S+    VF W  NI+ ++GF  W+   V++IRF +A+ 
Sbjct: 422 FGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIF 481

Query: 480 YRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFL 538
           + G+  D LPFK    P   YY+ F + +I L  G+ +F P  + G +F+AAYI++ +F+
Sbjct: 482 FNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFV 540

Query: 539 AIWI---LFELIFRCRFVWKIEDVDIDSDRRDIE--AIVWEEP--EPKTLWDKFWNVV 589
            +W+   L+   F  R+  +++ +D+ +   DIE    + +E   EP T W KF + V
Sbjct: 541 VLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/567 (34%), Positives = 314/567 (55%), Gaps = 27/567 (4%)

Query: 37  GSLSLKDEKSKELYPLRSFPNGVNGQDTFS--MEEDI-----QDEDE-----GEVQNAEV 84
            S S + E+  E  P + F   +  ++  +  +E +I     QDE++     G+ +   +
Sbjct: 9   NSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNIDGKTEGTRL 68

Query: 85  KRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA 144
           K+ LK RH                     L  AGPV  LI+Y F+G L +     LGEMA
Sbjct: 69  KKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMA 128

Query: 145 TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWT--YAVPLA 202
           T+IP+   FT ++ R+  PA G A GY Y F + +    +L+    VIQ+W     V   
Sbjct: 129 TYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPG 187

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            W++IF V+I ++N+F V+++GEFEFW++S KV+ ++G ++  F ++ G G     +GFR
Sbjct: 188 VWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFR 247

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YWR+PG++     +   +  RF+ +VS  + A + + G EL GI A EA NPRK++P+AI
Sbjct: 248 YWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAI 307

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENSGTKVLPHIF 378
           K  ++RI+ FY+ S+  +G+ V Y+DP L  A   ++  + SPF++AI NSG   LPHI 
Sbjct: 308 KLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHII 367

Query: 379 NAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAY 438
           NA +L  + SA NS++YV SR L+ L+    APK F+KT + G+PY A+  + +F  LAY
Sbjct: 368 NACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAY 427

Query: 439 METSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL 498
           M  S+   K+F + +N+  + G  +W+ I +++I F +A++ +G+ +    + A   P  
Sbjct: 428 MCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYG 487

Query: 499 AYYATFFMVVIILIQGFTSF-TPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIE 557
           A+++ FF  +I LI+ FT F    F+  NF+  YI + +F      F   F  +F +K +
Sbjct: 488 AWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGYKFTYKTK 541

Query: 558 DVD-IDSDRRDIEAIVWEEPEPKTLWD 583
            +D +  D    +A + +E E   + D
Sbjct: 542 VIDPLKVDLYTFKAAIDQEEEDGKMAD 568

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 196/586 (33%), Positives = 310/586 (52%), Gaps = 24/586 (4%)

Query: 10  VEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEE 69
           +E+K  +           +A  + +  GS   + + SK  +  + F +G    +   ++ 
Sbjct: 3   LEDKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRW--QDFKDGFKRVELEELDP 60

Query: 70  DIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
           ++ + ++  +  A+  ++R LK RH                     L   GP G LI + 
Sbjct: 61  NLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWG 120

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
            +G + Y V  S+GE+A   PV+  FT ++ RF+  +FG A  Y Y   W V   LE+  
Sbjct: 121 LIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVA 180

Query: 188 VGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
               + FW T       ++++F+++I  +N F V+ YGE EF  + IKVI +IGF+I   
Sbjct: 181 ASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGI 240

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            +VCG G  G     +YW NPGA+     S +   +RF G  S  + AAF+F GTELVG+
Sbjct: 241 VLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGL 295

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFII 364
            + E ANPRK +PRA K+V +RIL FYI SL  IGLLVP+   +L   +S   + SPF++
Sbjct: 296 ASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVL 355

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           AI+  G K LP + N VIL +++S  NS +Y  SR +  L++    P  F+   + G P 
Sbjct: 356 AIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPL 415

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
           +A+  T +FG L+++  S   G VF WLL ++G++  F+W  I + HIRF +AL  +G S
Sbjct: 416 VAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRS 475

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFLAIW 541
            DEL F +      +Y+    ++++++ Q + +  P   + N  +F +AY+S  + LA +
Sbjct: 476 TDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFY 535

Query: 542 ILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPKTL 581
           I  ++  R    WK+    +D+DID+ RR  D EA+  E  E K L
Sbjct: 536 IFHKIWKRN---WKLFTRAKDIDIDTGRREMDTEALRQEIAEEKML 578

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  315 bits (807), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 180/543 (33%), Positives = 294/543 (54%), Gaps = 21/543 (3%)

Query: 63  DTFSMEEDIQDEDEG--EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           D FS+    +       ++   E+K+ LK RH                     L   GP 
Sbjct: 52  DVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPA 111

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSS----FTVF-SQRFLSPAFGAANGYMYWF 175
           G  ISY  + S+ Y + Q +GEM  ++P + S    F  +   +++  + G A+ + Y++
Sbjct: 112 GLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYY 171

Query: 176 SWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKV 235
            + +  A E +    V+++WT +VP AAWI+IF   +  +N   VK+YGE EFW ASIK+
Sbjct: 172 CYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKI 231

Query: 236 IAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAA 294
           + I+G +I  F +  G G     +GFRYW+NPG +   I  +  +   FL   + +I   
Sbjct: 232 LCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGG 289

Query: 295 FTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA 353
           F F  G E++ +T+ E  + R+ + +A ++ V+R++ FYI   L I ++V YNDP L +A
Sbjct: 290 FAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENA 349

Query: 354 TSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
            +       +SPF+I I+N+G KVLPHI NA IL++  SA N+ ++  SR L  ++++  
Sbjct: 350 LAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQ 409

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
           AP+ F+K  + GVPY AV  +S    LAY+  S+    VF W  NI+ ++GF  W+ + +
Sbjct: 410 APRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCI 469

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTF-NGVNFL 528
           ++IRF +A+ + G+ +  LP+ A+ MP L Y+    + +I L  G+  F P F +  NF+
Sbjct: 470 AYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFV 528

Query: 529 AAYISVFLFLAIWILFELIFRCRFV---WK-IEDVDIDSDRRDIEAIVWEEPEPKTLWDK 584
           AAYI++ +F  +WI   +  R  F    WK IE++D+ +   +IE    E    + L  K
Sbjct: 529 AAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTK 588

Query: 585 FWN 587
           +W 
Sbjct: 589 WWE 591

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  315 bits (807), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 188/526 (35%), Positives = 289/526 (54%), Gaps = 22/526 (4%)

Query: 66  SMEEDIQD-EDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           S   D +D  D G+  + ++K+ +K RH                     L N GP G +I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 125 SYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183
            Y  MGS  Y + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W     L
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243
           EL      I++WT +V    +++IF+V+I  +N+F  + Y E EF+  + KV+ I GFLI
Sbjct: 197 ELVTASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLI 256

Query: 244 YCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTEL 302
               + CG AG  G +G +YW +PG++     S +K    F G VS+L+ AAF F  TE 
Sbjct: 257 LGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEF 311

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSP 361
           + +TA E ANPRK++P A KK+++RIL  Y+GS++ IG LVP+N  +L  S  S    SP
Sbjct: 312 IALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASP 371

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
           ++IAI + G KV+PH+ NAVIL ++IS  NS  Y  SR+L  L++   AP F     + G
Sbjct: 372 YVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREG 431

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
            P +A+  +S+FG ++++  S     VF WLL I+G++  F W  I +SHIRF +A+K +
Sbjct: 432 RPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIW 541
           G S  EL FK+++    +YYAT  M++I++ Q +T+  P   G     A+     +LA+ 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFEN--YLAMP 549

Query: 542 ILFELIFRCRFVWKIE--------DVDIDSDRR--DIEAIVWEEPE 577
           IL  L F  + VWK +         +D+ S+RR  D + +  E+ E
Sbjct: 550 ILIALYFGYK-VWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  315 bits (807), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 193/584 (33%), Positives = 310/584 (53%), Gaps = 29/584 (4%)

Query: 26  DVEA--SQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE 83
           D+EA  S  ++++    + +EKS     L++    +   D+   E + +   E    N E
Sbjct: 38  DIEATASNDNNKKNPQIIYNEKSYSQDELQTTSPTI--IDSIDDEAEKEQGKERSSSNGE 95

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ LK RH                     L N GP G  ISYL + +  Y +  +LGEM
Sbjct: 96  LKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEM 155

Query: 144 ATFIPVTSSFTVFS-----QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
             F+P   S +  S      +++ P+ G A  + Y++ + +  A E+S    VI++W +A
Sbjct: 156 VCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWA 215

Query: 199 --VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG--V 254
             VP  AWI+IF  +I  +N  PV  YGE EFW ASIK++ I G +I  F +  G G   
Sbjct: 216 EHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKS 275

Query: 255 TGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFT-FQGTELVGITAGEAANP 313
            G +GFRYW+NPG++   I         FL   + +I   F+   G ELV +T+ E A+ 
Sbjct: 276 DGILGFRYWKNPGSFAHHITGGGG--GNFLDIYTGIIKGGFSVILGPELVCLTSSECADQ 333

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENS 369
           R+ + +A K+ V+R++ FYI   L IG++V YNDP L +A +       +SPF+I I+N+
Sbjct: 334 RRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNA 393

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429
           G + +PHI N  ILT+  SA N+ ++  SR L  ++++  APK F +  + GVPY AV A
Sbjct: 394 GIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGA 453

Query: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489
           + +   LAY+  S+    VF W  NI+ ++GF  W+   V++IRF +A+ Y  ++   +P
Sbjct: 454 SLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH-RIP 512

Query: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIF 548
           F+AK      +Y+ F++ +I L  G+  F P  +N  +F+AAYI++ +F+ +WI  ++  
Sbjct: 513 FRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFT 572

Query: 549 RCRF-VW--KIEDVDIDSDRRDIEAIVW----EEPEPKTLWDKF 585
           R     W   I+ +D+ +   +IE +          PK  W+KF
Sbjct: 573 RTLLKAWLRPIDKIDVYTGLEEIEELTEELNANRQAPKNKWEKF 616

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  313 bits (801), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 182/552 (32%), Positives = 300/552 (54%), Gaps = 18/552 (3%)

Query: 44  EKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEG-EVQNAEVKRELKQRHXXXXXXXXXX 102
           EK    Y ++S      G+        ++ + EG +     +++ L  RH          
Sbjct: 10  EKDTSFYDVKS-----QGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCI 64

Query: 103 XXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L N GP+   +S++ +  + Y V  +L EM  ++P   +    + R++ 
Sbjct: 65  GTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVD 124

Query: 163 PAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKY 222
           P+ G A G+ Y +S+++  A ELS    V+Q+WT  V +A WI+IF VI+  +N  PVK+
Sbjct: 125 PSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKF 184

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEA 281
           YGE EFW AS+K+I I+G LI    +  G   +   +GFRYW NPG +   I     N  
Sbjct: 185 YGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHI--TGGNTG 242

Query: 282 RFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
           RFL   +++I + F F    EL+G+   EA + R+ + +A ++ ++RI+ FYI S L IG
Sbjct: 243 RFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIG 302

Query: 341 LLVPYNDPK----LTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYV 396
            ++  +DPK    LTS     ++SPF+  I N+G  VL HI NAVIL++  S+ANS +Y 
Sbjct: 303 FILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYA 362

Query: 397 GSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNIT 456
            SR +  L+K   APK F++  + GVPY AV  ++    L Y+  S+   +VF WL NI 
Sbjct: 363 SSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNIC 422

Query: 457 GVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFT 516
            ++GF  W  I ++++RF +A+ Y  +  + +PFK+ L P   Y+   F+V++ L  G+ 
Sbjct: 423 TISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYA 481

Query: 517 SFTPTF-NGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDI--EAIVW 573
           +F P + N  +F+AAYI++ +F  +++  ++ F+ R+     ++D+ +   D   EA + 
Sbjct: 482 TFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEEAKMT 541

Query: 574 EEPEPKTLWDKF 585
           +   PK +W+KF
Sbjct: 542 QPRTPKNMWEKF 553

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  312 bits (800), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 176/526 (33%), Positives = 283/526 (53%), Gaps = 13/526 (2%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           E+++ +  G   N  + + L+ RH                     L N G    L+S++ 
Sbjct: 32  EELETQSAGSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFIL 90

Query: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188
           + ++ Y +  SL EM  ++P   S      R++ P+ G A G+ Y +++A+  A ELS  
Sbjct: 91  ISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAA 150

Query: 189 GQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
             V+ +W   VP+AAWI+IF V++  +N   VKYYGE EFW ASIK+I I+G L+    +
Sbjct: 151 ASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVI 210

Query: 249 -VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGIT 306
              GA      GFRYW+NPG +   +     +  RFL    ++I +AF F    EL+GI 
Sbjct: 211 FFGGAPNHDRTGFRYWKNPGPFAMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIA 268

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPF 362
             EA + R+   +A ++ ++RI+ FY+   L IG+++   DPKL  A        ++SPF
Sbjct: 269 CVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPF 328

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           +  I N+G  VL H+ N  IL++  SA NS +Y  +R++  L++   APKF +K  + GV
Sbjct: 329 VQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGV 388

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           PY AV   ++   LAY+   T    VF WL NI  ++GF  W  + ++ IRF + + +  
Sbjct: 389 PYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNN 448

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIW 541
           + +  +P++  L P +AYY TF  VV+ L  GF  F    +N V+F+AAY+++ ++L ++
Sbjct: 449 L-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLY 507

Query: 542 ILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE--PKTLWDKF 585
           +  +L FR R+   +E +D+ +   + E      P   PK LW+KF
Sbjct: 508 LGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/522 (36%), Positives = 297/522 (56%), Gaps = 13/522 (2%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           +D  ++ +G+  +  +K++LK RH                     L  AGPV  LISY F
Sbjct: 47  DDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSF 106

Query: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188
           +G L + V   +GEMA +IP+   FT ++ R+  PA G A GY Y   + +    +L+  
Sbjct: 107 VGVLVFFVMSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAA 165

Query: 189 GQVIQFWT--YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
             VIQ+W     V    WI+I  V+I  +N F VK++GEFEFW++S KVI ++G +I  F
Sbjct: 166 ALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMF 225

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            ++ G   T   +GFRYW++PGA+     S + +  RF+ +VS  +   F + G EL GI
Sbjct: 226 IIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGI 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPF 362
            A EA NPRK +P+AIK  ++RI+ FYI ++  +G+ V  NDP L  A   ++  + SPF
Sbjct: 286 VAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPF 345

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++AI NSG + LPHIFNA +L  + SA NS++YV SR L+ L+    APK F+KT + G+
Sbjct: 346 VVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGI 405

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           PY ++    +F  LAYM  S+G  K+F + +N+  + G   W+ I +++I F +A++ +G
Sbjct: 406 PYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQG 465

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSF-TPTFNGVNFLAAYISVFLFLAIW 541
           I +    + A L P  AY++ FF  ++ LI+ FT F    F+  NF+  YI + LF   +
Sbjct: 466 IDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICY 525

Query: 542 ILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWD 583
             ++ + + + + K E+VD+ S +  I+    +E E   + D
Sbjct: 526 FGYKFVKKTK-IRKPEEVDLFSFKAAID----QEEEDGRIKD 562

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  312 bits (800), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 190/576 (32%), Positives = 302/576 (52%), Gaps = 31/576 (5%)

Query: 42  KDEKSKELYPLRSFPNGVNGQ----DTFSMEEDIQDEDEGEVQNAEVKRE------LKQR 91
           + EK KE     +  +   GQ    D  S+  +    + G   N + K E      L  R
Sbjct: 4   RREKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEGKLQQGLSAR 63

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP--- 148
           H                     L   GP G  ISY+ + ++ Y +  + GEM  ++P   
Sbjct: 64  HIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNG 123

Query: 149 --VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWIS 206
                S +    R++ P+   A G+ Y++ + +  A E +    V+++WT AVP AAWI+
Sbjct: 124 DDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTDAVPTAAWIT 183

Query: 207 IFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRN 265
           IF  I+  +N+  VKYYGE EFW ASIKV+ I+G +I  F +  G G     +GFRYW+N
Sbjct: 184 IFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKN 243

Query: 266 PGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKV 324
           PG +   I     N   FL   S +I  AF F  G EL+ + + E  + R+ + +A K+ 
Sbjct: 244 PGGFAHHI--TGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRF 301

Query: 325 VFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNA 380
           V+R++ FYI   L I ++V  NDP LTSA +       +SPF+I I+N+G K+LPHI NA
Sbjct: 302 VWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINA 361

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
            ILT+  SA N+ ++  SR L  ++ +  APK F K  + GVP++AV  +++   LAY+ 
Sbjct: 362 CILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLN 421

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S+    VFAW  NI+ ++GF  W    V+++RF +A+KY G+  + LP+  +    + +
Sbjct: 422 VSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLPYAPRFQQYMVW 480

Query: 501 YATFFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFRCRFVW--KIE 557
           ++   + ++I   G+  F P F N  +F+AAYI++ LF+ +WI  ++  R    W   +E
Sbjct: 481 WSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVE 540

Query: 558 DVDIDSDRRDIEA----IVWEEPEPKTLWDKFWNVV 589
           ++D+ +   +IE     +  E  EPK  + KF + +
Sbjct: 541 EIDVVTGLTEIEERTRILDEERVEPKGAFPKFMDAL 576

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  313 bits (803), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 199/590 (33%), Positives = 312/590 (52%), Gaps = 20/590 (3%)

Query: 12  EKHMYTEPAGTFFHDVEASQTHHRRGSLSLKD---EKSKELYPLRSFPNGVNGQDTFSME 68
           +K  Y   + T    V++S T     S+   D   + SK +       +     +   ++
Sbjct: 18  KKETYFINSETLHEPVQSSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVD 77

Query: 69  EDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
            ++ + +   +  A+  +K  LK RH                     L  AGP G +I +
Sbjct: 78  PNLTEAERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGW 137

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
               ++ Y +  +LGE+A   PV+  FT ++ RF+  +FG A+ + Y   W  T  LE+ 
Sbjct: 138 GLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIV 197

Query: 187 VVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
                + +W T       ++++FW++I  +N+F V+ +GE EF  ++IKV+ +IGF+I  
Sbjct: 198 SASITVNYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILG 257

Query: 246 FCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
             +V G G  G     RYW NPGA+    +  N    +F G  S  + AAF+F G+ELVG
Sbjct: 258 IVLVAGGGPEGGFVGGRYWHNPGAF----VGDNAG-TQFKGVCSVFVTAAFSFAGSELVG 312

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFI 363
           ITA EAANPRK+VPRA K+VV+RI+ FY+GSL+ IGLLVPY DP+L  A+S   S SPF+
Sbjct: 313 ITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFV 372

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           IAI   G + LP + N VIL  ++S  NS I+ GSR +  LS+    P+ F    + G P
Sbjct: 373 IAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRP 432

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
            + +   S FG +A++  S   G+VFAWL+ ++G++  F W  I + HIRF  ALK +G 
Sbjct: 433 LVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGR 492

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN---FLAAYISVFLFLAI 540
           S +ELPF +      + +  F ++++ + Q + +  P  +  +   F  +Y+S  + LA 
Sbjct: 493 STNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAF 552

Query: 541 WILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWE-EPEPKTLWDKFW 586
           +   ++  +  +   K ED+DID+ RR  D+E +  E E E   L  K W
Sbjct: 553 YFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEKAILATKGW 602

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  311 bits (798), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 179/523 (34%), Positives = 289/523 (55%), Gaps = 29/523 (5%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ L+ RH                     L+  GP G L SY+ +  + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 144 ATFIPVTS-----SFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
             F+P ++     S +    R+  P+ G A G+ Y++ + +  A E +    V+ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP- 257
           VP  AWI+IF  ++T +N  PVK YGE EFW A +K++ I+G L   F +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKT 316
           +GFRYW++PGA+   I + N    RFL   + +I   F F  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNT--GRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTK 372
           + +A ++  +R++ FY+ S L IG++V   DP L +A +       +SPF+IAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           VLPHI NA IL++  S+ NS ++  SR L  +++   AP+   +  + GVPY AV  ++ 
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           F  LA++  S+G  K F W  NI+ ++GF  W+ I V++++F +A+ +RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 493 KLMPGLAYYATFFMVVII----LIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIF 548
            L P    Y T+F +V++    L  G+ SF   +N  +F+AAYI++ +F+ +W+  ++  
Sbjct: 522 PLQP----YGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYT 576

Query: 549 RCRFVW--KIEDVDIDSDRRDIEA----IVWEEPEPKTLWDKF 585
           R    W   + +VD+ +   +IE     +  +   P   W KF
Sbjct: 577 RTWSTWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/581 (31%), Positives = 298/581 (51%), Gaps = 36/581 (6%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           +   K    V  +++  EP         +++ H R G      ++++E+           
Sbjct: 10  LPASKGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEM----------- 58

Query: 61  GQDTFSMEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
                 ++ ++ + +   ++ A+  +K  LK RH                     L  AG
Sbjct: 59  -----ELDPNLTEAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAG 113

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P G LI +   G++ YS+  ++GE+A   PV   FT ++ RF+  +FG A  ++Y   W 
Sbjct: 114 PAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWL 173

Query: 179 VTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
           V   LE+      + +W T       ++++F+V+I  +NMF VK YGE EF  + IKVI 
Sbjct: 174 VVLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVIT 233

Query: 238 IIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFT 296
           +IGF+I    ++CG G     +G +YW NPGA+       +    +F G+ +  + AAF+
Sbjct: 234 VIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFS 288

Query: 297 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY 356
           F G+ELVG+   EA  PRK+VP A K+V +RI  FYI  LL IG+LVP + P+L  A+S 
Sbjct: 289 FAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSV 348

Query: 357 -VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFS 415
             + SPF+IAI N G K LP + N VIL  ++S  NS IY  SR L  L+     P    
Sbjct: 349 DAAASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICG 408

Query: 416 KTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFM 475
              +GG P + +  ++ FG +A++  S   G VF WL+ ++G++  F W  I + HIR+ 
Sbjct: 409 YIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYR 468

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTF---NGVNFLAAYI 532
            AL  +G S DELPF+A      +Y+  F  +++ + Q +    P     N  +F  AY+
Sbjct: 469 GALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYL 528

Query: 533 SVFLFLAIWILFELIFRCRFVWK----IEDVDIDSDRRDIE 569
           S  +F+A++   ++  R    WK    ++D+DID+ RR+++
Sbjct: 529 SFCIFIALYAFHKIWKRN---WKLFIPLKDLDIDTGRREVD 566

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  308 bits (788), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/487 (34%), Positives = 266/487 (54%), Gaps = 5/487 (1%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           ED  + +E + +N  + RELK R                      L   GP+   I+YLF
Sbjct: 17  EDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLF 76

Query: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188
            GSL   V  SL EMA+F P+   F+ +  R++ PAFG A G+ Y+  +A+  +  L+  
Sbjct: 77  TGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAF 136

Query: 189 GQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
           G VI +W   V +  W+++ +V +  +N   VKY+GE E  +   K++ ++   I C  +
Sbjct: 137 GLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLII 196

Query: 249 VCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
            CG        GFRYWR  GA  P ++       +FLGW + ++ + F F G+E++GI  
Sbjct: 197 TCGGAPNHTTTGFRYWRESGAL-PYLV--GGGTGKFLGWWACVVQSIFGFMGSEMIGIVY 253

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLV-PYNDPKLTSATSYVSTSPFIIAI 366
           GE ANP+KT+P++   V FRI   Y+  +  +GL + P N   + + ++  + SPF+IAI
Sbjct: 254 GETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAI 313

Query: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIA 426
            +SG KVLP+  NA +L  IIS+AN++IY+ SR L+GL+K   APK F    +  VP + 
Sbjct: 314 SSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVG 373

Query: 427 VFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRD 486
               S+ G LAYM T      VF+++ +   V G   W +I +++I + +A+K +GIS D
Sbjct: 374 CVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISID 433

Query: 487 ELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFEL 546
           ++PF+    P  AY   FF+ +I    G+ +F   F+   F+ +YI VF  + + I ++L
Sbjct: 434 DIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKL 493

Query: 547 IFRCRFV 553
            F+ +FV
Sbjct: 494 YFKTKFV 500

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  311 bits (798), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/540 (33%), Positives = 289/540 (53%), Gaps = 31/540 (5%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAE-VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
           N +N + +F  E  I+   + + QN E +K+ +K RH                     L 
Sbjct: 115 NELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLN 174

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYW 174
           NAGP G +I Y  MGS  Y + Q+ GE+A  +  +   F  +    + PA G +  ++Y 
Sbjct: 175 NAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYC 234

Query: 175 FSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIK 234
             W     LEL      I++WT  V    ++ IF+V+I  +N+F  K Y E +F+    K
Sbjct: 235 LQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCK 294

Query: 235 VIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINA 293
           ++ IIGF I    + CG AG  G +G RYW NPGA+       N    RF G V++ + A
Sbjct: 295 ILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTA 349

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA 353
           AF F  +E + +TA E +NPRK +P A KK+++RIL  ++GSL+ +G LVPY   +L  A
Sbjct: 350 AFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGA 409

Query: 354 T-SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPK 412
           + S    SP++IA+ + G +V+PH  NAVIL +++S AN   Y  SR+L  L+K   APK
Sbjct: 410 SGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPK 469

Query: 413 FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHI 472
            F    + G P +A+  +SIFG +A+  +S     VF WLL I+G++  F W+ I +SHI
Sbjct: 470 CFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHI 529

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG-----VNF 527
           RF +A+K +G S  E+ +K+++    + YA   MV+ ++ Q + + +P   G      +F
Sbjct: 530 RFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSF 589

Query: 528 LAAYISVFLFLAIWILFELIFRCRFVWK--------IEDVDIDSDRR--DIEAIVWEEPE 577
              Y+++ + +A+++ ++       VWK         + +D+ +DR+  D E +  E+ E
Sbjct: 590 FENYLAMPILIALYVFYK-------VWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEE 642

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  310 bits (794), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 189/556 (33%), Positives = 297/556 (53%), Gaps = 20/556 (3%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE-- 83
           D+E+     ++ + +      ++    R F +     +   ++ ++ +++   +  A   
Sbjct: 29  DLESESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQERIAIITAHTP 88

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K  LK RH                     L  AGP   +I +   GS+ YS+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW-TYAVPLA 202
           A   P++  FT ++ RF+  +FG AN + Y   W V   LE+      + +W T      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FW++I  +N+F VK YGE EF  ++IKVI ++GF+I    +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+           A+F G+ S  + AAF+F G+EL+GI   EA NPRK VP A 
Sbjct: 269 YWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RIL FYI SLLFIGLLVP ND +L  +++   + SPF+IAI   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL  ++S  NS IY  SR L  L++    PK  S   + G P + +  +S FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S   G VF WLL I+G++ FF W  I + HIRF  ALK +  S DELPF + L    +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 501 YATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI- 556
           +  F +V+++  Q + +  P   T +  NF +AY+S+ + L ++I  +L  +    WKI 
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN---WKIF 560

Query: 557 ---EDVDIDSDRRDIE 569
                +D+D+ R+ ++
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  309 bits (791), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 185/552 (33%), Positives = 291/552 (52%), Gaps = 25/552 (4%)

Query: 42  KDEKSKELYPLRS------FPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXX 95
           K     ++ PL S        +  +G +++++E         + +++   ++L  RH   
Sbjct: 22  KQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVRHLLT 81

Query: 96  XXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTV 155
                             LT  GP   +I ++ + +  +++  +LGE+++  PV   F V
Sbjct: 82  LAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNV 141

Query: 156 FSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAM 215
           +  RF+ P+FG A    Y   WAV   LEL      I++W   +   AW++IF+ II   
Sbjct: 142 YISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFLA 201

Query: 216 NMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGII 274
           N+  VK +GE EF ++ +K++AIIGF I    + CG G  G     +YW NPGA+     
Sbjct: 202 NLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAF----- 256

Query: 275 SKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
             N +  RF G  S  + AAF++ GTEL+ ++A E+ NPR T+P+A K+  + I   YI 
Sbjct: 257 VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIV 316

Query: 335 SLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANS 392
            L  +G LVP +DP+L   +S V  + SP +IAIEN G K LP + NA+IL  ++S ANS
Sbjct: 317 VLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANS 376

Query: 393 NIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWL 452
            +Y  SR +  +++    PK FS   + G P  A+ AT IFG L+++  S     VF WL
Sbjct: 377 AVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWL 436

Query: 453 LNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL--AYYATFFMVVII 510
             ++G++  F W  I+VSHIRF   +K RG S DELPF +  M G+  +YY    + V++
Sbjct: 437 SALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVS--MTGVWGSYYGCVIIFVVL 494

Query: 511 LIQGFTSFTPTFNGV----NFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDR 565
           ++  +T+  P+  GV    +F   Y+S  + L  +I  +L  +  R +    ++DIDS R
Sbjct: 495 VVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGR 554

Query: 566 R--DIEAIVWEE 575
           R  DIE +  E+
Sbjct: 555 RAVDIEVLKDEK 566

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 190/583 (32%), Positives = 297/583 (50%), Gaps = 17/583 (2%)

Query: 9   EVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEK-SKELYPLRSFPNGVNGQDTFSM 67
            +E+K  +           +   + +  GS  + D K +      + F +G    +   +
Sbjct: 2   SLEDKKNFVYAQEEPLEGRDVGHSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDL 61

Query: 68  EEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           + ++   ++  +  A   ++R LK RH                     L   GP   LI 
Sbjct: 62  DPNLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIG 121

Query: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           +  +G + YSV  ++GE+A   PV   FT +  RF+  +FG A  Y+Y   W V   LE+
Sbjct: 122 WGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEI 181

Query: 186 SVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
                 + +W T A     ++++F+V+I  +NMF VK YGE EF  + IKV  ++GF+I 
Sbjct: 182 VAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIIL 241

Query: 245 CFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
              ++CG G  G     +YW NPGA+     + +    RF    S  + AAF+F GTELV
Sbjct: 242 GIVLICGGGPVGGYVGGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELV 296

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPF 362
           G+ A E  NPRK +PRA K+V +RI  FYI SL  IGLLVPY    L  ++S   + SPF
Sbjct: 297 GLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPF 356

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++AI+  G   LP + N VIL +++S  NS++Y  SR L  L+     P+ FS   + G 
Sbjct: 357 VLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGR 416

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P + + AT  FG L ++  S   G VF WL+ ++G++  F W FI + H+RF +AL  +G
Sbjct: 417 PLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQG 476

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFLA 539
            S DEL F + +    +Y+    + ++ + Q + +  P   T N  +F  AY+SV + L 
Sbjct: 477 RSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLF 536

Query: 540 IWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
            ++  +L  R   F  + +D+DID+ RR  D++A+  E  E K
Sbjct: 537 FYLAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEK 579

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/553 (32%), Positives = 293/553 (52%), Gaps = 14/553 (2%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE-- 83
           DVE   ++    +   ++E+       +   +     +   ++ ++ + ++  +  A   
Sbjct: 24  DVETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEVPELDPNLTEAEKIAIATARSP 83

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           ++ +LK RH                     L  AGP G LI ++  GS+ Y +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW-TYAVPLA 202
           A   PV   FT ++ RF+  ++G AN + Y   W VT  LE+      + +W T      
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FWV+I  +NMF V+ YGE EF  +  K++ I+GF+I    ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+     + + +  +F G+ S  + AAF+F G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RI  FY+  LL IG+LVPY DP+L   +S   + SPF+IAI+N G   LP + N 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNV 378

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL  ++S  NS +Y  SR L  L+     PK FS   + G P + +  TS FG +A++ 
Sbjct: 379 VILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVA 438

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S   G+VF WL+ ++G++  F W  I + HIRF +AL  +G S +EL F +      A 
Sbjct: 439 QSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAA 498

Query: 501 YATFFMVVIILIQGFTSFTPTF---NGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKI 556
           +  F  ++++  Q + +  P     +  +F   Y+S+ + LA+W+  ++  +  +   K 
Sbjct: 499 WGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKA 558

Query: 557 EDVDIDSDRRDIE 569
           ED+DID+ RR+++
Sbjct: 559 EDMDIDTGRRELD 571

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  308 bits (790), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/588 (31%), Positives = 305/588 (51%), Gaps = 35/588 (5%)

Query: 28  EASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEED-IQDED-------EGEV 79
             S+ +HR       D +  +   +       +     ++ ED I D D       +G+ 
Sbjct: 48  SGSRNNHR------SDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDS 101

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  ++K+ L+ RH                     L   GP G  ISY+ + ++ Y +  +
Sbjct: 102 EPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCA 161

Query: 140 LGEMATFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQF 194
           LGEM  F+P   S +  S      R++ P+ G A G+ Y++ + +  A E +    V+++
Sbjct: 162 LGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEY 221

Query: 195 WTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV 254
           WT AVP   WI+IF  ++  +N   VK YGE EFW ASIK++ I+G +I  F +  G G 
Sbjct: 222 WTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGP 281

Query: 255 TGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAAN 312
               +GFRYW++PGA+   +     +   F    + +I  AF F  G ELV +T+ E A+
Sbjct: 282 NHDRLGFRYWQHPGAFAHHL--TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECAD 339

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIEN 368
            R+ + +A ++ V+R++ FY+   L I ++VPYNDP L +A +       +SPF+I I+N
Sbjct: 340 QRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQN 399

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVF 428
           +G KVLPHI N  ILT+  SAAN+ ++  +R L  ++++  APK   +  K GVPY+AV 
Sbjct: 400 AGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVG 459

Query: 429 ATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDEL 488
            + +   LAY+  S+    VF W  NI+ ++GF  W+   ++++RF +A+ Y G+  D L
Sbjct: 460 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRL 518

Query: 489 PFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGV-NFLAAYISVFLFLAIWILFELI 547
           PFK    P   +++   + +I +  G+  F P +  V +F+AAYI++ +FL +W   +L 
Sbjct: 519 PFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLY 578

Query: 548 FRCRFVW--KIEDVDIDSDRRDIEAIVWEEPE----PKTLWDKFWNVV 589
            R    W   + ++D+ +   +IE    E  E    P    DKF + +
Sbjct: 579 TRTWRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDAL 626

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  306 bits (784), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 186/569 (32%), Positives = 299/569 (52%), Gaps = 36/569 (6%)

Query: 31  QTHHRRGSLSLKDEKSKELY--PLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKREL 88
           Q     G  ++ D+++ ++Y   + S+   ++G    S      D  +G+     +K+ L
Sbjct: 5   QDLKDAGETTVTDKQTGQVYEIDIESYSQ-ISGPKVSS-----SDAPQGD---HTLKKGL 55

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP 148
           K RH                     L   GP G   SY  +  + Y V  +LGEM  ++P
Sbjct: 56  KSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLP 115

Query: 149 VTSSFTV-----FSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAA 203
              S +         R++ P+ G A G+ Y++ + +  A E +    V+Q+WT AVP  A
Sbjct: 116 GDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGA 175

Query: 204 WISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           WI+IF  ++  +N   VK+YGE EFW AS+K++ I+G L   F +  G G     +GFRY
Sbjct: 176 WITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRY 235

Query: 263 WRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAI 321
           W+ PGA+   I S N    RFL   + +I   F F  G ELV +T+ EA + R+ + +A 
Sbjct: 236 WQKPGAFAYHITSGNT--GRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKAS 293

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHI 377
           ++ V+R++ FY+ S L IG +V YND  L++A         +SPF+I I+N+G KVLPHI
Sbjct: 294 RRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHI 353

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437
            N  IL++  S+ NS ++  SR L  +S+   APK   +  + GVPY AV  TS+   +A
Sbjct: 354 INVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIA 413

Query: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497
           Y+  S+    VF W  NI+ ++GF  W+ I ++++RF +A+ ++ +  + +PFK    P 
Sbjct: 414 YLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQP- 471

Query: 498 LAYYATFFMV----VIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRCRF 552
              Y T+F +    VI L  G+  F P  +N  +F+AAY+++ +FL +WI  +L  R   
Sbjct: 472 ---YGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWK 528

Query: 553 VWKI--EDVDIDSDRRDIEAIVWEEPEPK 579
            W I   ++D+ +  ++IE    E  E +
Sbjct: 529 TWAIPVPEIDVTTGLKEIEEESKECDEKR 557

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  307 bits (786), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 190/570 (33%), Positives = 296/570 (51%), Gaps = 32/570 (5%)

Query: 26  DVEASQTH-HRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEE-----DIQDEDEGEV 79
           DVE+ Q H + +  + + D           F N V+G     ME+        +      
Sbjct: 31  DVESDQNHDYYKDKVHVNDPNKSR------FQNFVDGFRELRMEDVDPNLTAAERAAIAT 84

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++ +KR LK RH                     L   GP   +I+++  GS+ YSV Q+
Sbjct: 85  ASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQA 144

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAV 199
           LGE+A  +PV+ S+  +  RF+ P+FG A  Y Y     +T  LEL      + +W    
Sbjct: 145 LGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDS 204

Query: 200 PLA-AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT--G 256
             A A++++F+++I  +N+F VK YGE EF  + IKV AI+GF+I    +VCG G +  G
Sbjct: 205 KYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEG 264

Query: 257 PVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G RYW NPG +  G          F G+ +  + +AF+F G+E+  + A E  NPRK 
Sbjct: 265 YIGARYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKD 314

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSPFIIAIENSGTKVLP 375
           +PRA K+V +RI  FY+ SL  IG LVPY D  L  +++   S SPF+IAI  +G K LP
Sbjct: 315 LPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLP 374

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
            + N VIL  ++S  N  +Y  SR +  L+     P+ F    + G P + +   +IFG 
Sbjct: 375 SVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGL 434

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S+  G+VF W+L I+G+  FF W  I V H+RF +AL  +G S DEL +KA+  
Sbjct: 435 LSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTG 494

Query: 496 PGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFLAIWILFELIFRC-R 551
              + Y    + +++  Q + +  P   + N  +F +AY+S+ + +  +   +L  R   
Sbjct: 495 IWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWT 554

Query: 552 FVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           F+ K  D+DID+ RR  D+E +  E  E +
Sbjct: 555 FLIKSSDIDIDTGRREMDLELLKQEIQEEQ 584

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  306 bits (784), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 181/537 (33%), Positives = 288/537 (53%), Gaps = 26/537 (4%)

Query: 43  DEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           D K K+L         ++G +T ++E       E E Q+A   ++L  RH          
Sbjct: 40  DSKQKDL---------MSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAI 90

Query: 103 XXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      LT  GP   +I ++ + +  +++  +LGE+++  PV   F V+  RF+ 
Sbjct: 91  GTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVE 150

Query: 163 PAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKY 222
           P+FG A    Y   WAV   LEL      I++W + +   AW++IF+ II   N+  VK 
Sbjct: 151 PSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKS 210

Query: 223 YGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEA 281
           +GE EF ++ +K++AIIGF I    + CG G  G     +YW NPGA+    +     + 
Sbjct: 211 FGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF----VGHTAGD- 265

Query: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGL 341
           RF G  S  + AAF++ GTEL+ ++A E+ NPR T+P+A K+  + I   YI  L  +G 
Sbjct: 266 RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGC 325

Query: 342 LVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSR 399
           LV  +DP+L + +S V  + SP +IAIEN G K LP + NA+IL  ++S ANS +Y  SR
Sbjct: 326 LVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSR 385

Query: 400 VLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVA 459
            +  +++    PK F+   + G P  A+ AT IFG L+++  S    +VF WL  ++G++
Sbjct: 386 CMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLS 445

Query: 460 GFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL--AYYATFFMVVIILIQGFTS 517
             F W  I+VSHIRF + +K RG + DELPF +  M G+  +YY    + +++++  +TS
Sbjct: 446 TLFCWFAINVSHIRFRRTMKERGRTLDELPFVS--MTGVWGSYYGCIVIFIVLVVCFWTS 503

Query: 518 FTP----TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
             P      N  +F   Y+S  + LA +   +L  R  R +   +++D+DS RR ++
Sbjct: 504 LFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVD 560

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  306 bits (784), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 191/584 (32%), Positives = 312/584 (53%), Gaps = 40/584 (6%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVK 85
           D+EA+    +     L  +K KE          ++  +T S++E+ Q + E   +N ++K
Sbjct: 29  DIEANTITEQ-----LTKDKHKET---------IDYSETSSLDEEKQQQPE---ENGKLK 71

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145
           + LK RH                     L   GP G   SYL + +  Y +  + GEM  
Sbjct: 72  QGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVC 131

Query: 146 FIPVTSSFTVFS-----QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA-- 198
           ++P   S +  S     ++++  + G A+ + Y++ + +  A E +    V+++W +A  
Sbjct: 132 YLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALK 191

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP- 257
           VP  AWI+IF   + A+NM PV +YGE EFW ASIK++ I+G +I  F +  G G +   
Sbjct: 192 VPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDR 251

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKT 316
           +GFRYW+ PGA+   I   +     FL   + +I   F F  G ELV +T+ E  + R+ 
Sbjct: 252 LGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRN 309

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTK 372
           + +A ++ V+R++ FY+   L I ++V YNDP L +A +       +SPF+I I+N+G K
Sbjct: 310 IAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIK 369

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           VLPHI N  I+T+  SA N+ ++  SR L  ++    APKFFSK  + GVPY+AV  + +
Sbjct: 370 VLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFL 429

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           F  LAY+  S+    VF W  NI+ ++GF  W+   V++IRF +A+ +  +  D LP+K 
Sbjct: 430 FCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKG 488

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFRCR 551
                L +Y+ F + +I L  G+  F P F +  +F+AAYI++ +F+ +WI  +L+ R  
Sbjct: 489 FAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRSW 548

Query: 552 FVWKI--EDVDIDSDRRDIEAIVWEEPE----PKTLWDKFWNVV 589
             W I  + +D+ +   +IE +  E  E    P   WDKF + +
Sbjct: 549 RQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLDAL 592

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  305 bits (782), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 181/551 (32%), Positives = 306/551 (55%), Gaps = 25/551 (4%)

Query: 42  KDEKSKELYPL-----RSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE--VKRELKQRHXX 94
           +++ S   YP      + F +     D+  ++ ++ D  +  +  ++  ++R+LK RH  
Sbjct: 35  QEDYSNSSYPKSGSKWKDFKDSFKRMDSVDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQ 94

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154
                              L  AGP G LI +  M ++   +  SLGEMA   PV+  +T
Sbjct: 95  MIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYT 154

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIIT 213
            ++ RF+  ++G AN   Y     V   LE+      + +W   +   AA++++FW+ I 
Sbjct: 155 TYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRAAFVALFWLCIV 214

Query: 214 AMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPG 272
           ++NMF VK YGE EF  + IKV+ +IGF+I    +VCG G T   +G ++W NPGA+   
Sbjct: 215 SINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF--- 271

Query: 273 IISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFY 332
               +    +F G  S  + AAF+F  TELVG+ A E  +PRK+VP+A K+V +RI  FY
Sbjct: 272 --VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFY 329

Query: 333 IGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN 391
           I SLL +GLLVPY DP+L  S+    + SPF++A++N G K LP + N VILT ++S  N
Sbjct: 330 ILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVILTAVLSVGN 389

Query: 392 SNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAW 451
           S+++  SR L  LS+    P  F    + G P +++  +S FG L ++  S    ++F W
Sbjct: 390 SSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDW 449

Query: 452 LLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIIL 511
           +L+++G++  F WL IS+ HIRF +AL  +  S DEL F + +    +YY+ F ++V+++
Sbjct: 450 MLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLI 509

Query: 512 IQGFTSFTPTF---NGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI----EDVDIDSD 564
           +Q + +  P     +  NF  AY+S+ + +A+++  ++  +    WK+    + +DID+ 
Sbjct: 510 LQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN---WKLLIDPKYMDIDTG 566

Query: 565 RRDIEAIVWEE 575
           RR+++  ++++
Sbjct: 567 RRELDIELFKQ 577

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  305 bits (781), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 181/576 (31%), Positives = 304/576 (52%), Gaps = 29/576 (5%)

Query: 38  SLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQ---NAEVKRELKQRHXX 94
           S S ++E+ K ++  R         ++ + E+  + +   EV+   N ++K+ L  RH  
Sbjct: 9   SYSKEEEEKKTVFDNRQILINELDLESLTREKITRSDSSSEVEAEGNGKLKQGLSSRHVQ 68

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-----V 149
                              L   GP G +ISY+ + ++ Y +  +LGEM  ++P      
Sbjct: 69  FIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDS 128

Query: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFW 209
             S      R++  +   A G+ Y++ + +  A E +    V+ +WT +VP A WI+IF 
Sbjct: 129 AGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTSVPTAVWITIFL 188

Query: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG-PVGFRYWRNPGA 268
            I+T +N   VKY+GE EFW ASIK++ I+G ++  F +  G G +   +GF YW++PG 
Sbjct: 189 GIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGT 248

Query: 269 WGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFR 327
           +   I     +   FL   + +I  AF F  G ELV +T+ E  + R+ + +A K+ ++R
Sbjct: 249 FAHHI--TGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWR 306

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNAVIL 383
           ++ FYI   L I ++V YNDP L +A        ++SPF+I I+N+G KVLPHI NA IL
Sbjct: 307 LMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACIL 366

Query: 384 TTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETST 443
           ++  SA NS ++  SR L  ++ +  APK F K  + GVPY +V  +++   LA++  S+
Sbjct: 367 SSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSS 426

Query: 444 GGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYAT 503
              +VF W  NI+ ++GF  W+   ++++RF +A+ Y  +  D LPFK    P L +Y+ 
Sbjct: 427 STAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSL 485

Query: 504 FFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFR-------CRFVWK 555
             + VI L  G+ +F P F +G +F+AAYI++ LFL +W+  +   R        +  + 
Sbjct: 486 LVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYP 545

Query: 556 IEDVDIDSDRRDIEAIV----WEEPEPKTLWDKFWN 587
           ++++D+ +   + E +          P T W KF N
Sbjct: 546 VDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  305 bits (780), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 193/552 (34%), Positives = 296/552 (53%), Gaps = 34/552 (6%)

Query: 62  QDTFSMEEDIQ-DEDEGEVQ-------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           +D+F   E ++ D +  E +          +K  LK RH                     
Sbjct: 56  KDSFRRVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTA 115

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP   LI +   G++ YS+  +LGE+A   P++  FT ++ RF+  +FG AN + Y
Sbjct: 116 LRTGGPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNY 175

Query: 174 WFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
              W V   LE+      + FW T       ++++FW++I  +NMF VK YGE EF  + 
Sbjct: 176 MLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSF 235

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKVI ++GF+I    + CG G  G     +YW +PGA+     + +   A+F G  S  +
Sbjct: 236 IKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFV 290

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            +AF+F G+ELVG+ A E+ +PRK+VP+A K+V +RI  FYI SLL +GLLVPYNDP L 
Sbjct: 291 TSAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLI 350

Query: 352 SATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
            A+S   + SPF+IAI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  
Sbjct: 351 GASSVDAAASPFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFL 410

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           P+ F+   + G P + +  TS FG +A++  S   G VF WLL ++G++  F W  I + 
Sbjct: 411 PQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICIC 470

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNF 527
           HIRF +AL  +G   DEL FK+      +Y+  F +V++ + Q + +  P   + +   F
Sbjct: 471 HIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGF 530

Query: 528 LAAYISVFLFLAIWILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPKTL 581
             AY+S  L +A+++  ++  R    WK+    ED+DID+ RR  D+E +  E  E K +
Sbjct: 531 FEAYLSFPLVVAMYLGHKIYKRN---WKLFIPAEDMDIDTGRREVDLELLKQEIAEEKAI 587

Query: 582 ------WDKFWN 587
                 W + WN
Sbjct: 588 MATKPKWYRIWN 599

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  304 bits (779), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 181/554 (32%), Positives = 290/554 (52%), Gaps = 27/554 (4%)

Query: 54  SFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           SF +  N +       D ++       ++++ ++L  RH                     
Sbjct: 58  SFDSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGAS 117

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP   +++++ + +  +++  +LGE+A   PV   F V+  RF+ P+FG A    Y
Sbjct: 118 LNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINY 177

Query: 174 WFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASI 233
              WAV   LEL      I++W   +   AW++IF+  I   NM  VK +GE EF ++ I
Sbjct: 178 LAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMI 237

Query: 234 KVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAW---GPGIISKNKNEARFLGWVSS 289
           K++AIIGF I    + CG G +G  +G RYW +PGA+    PG         RF G  + 
Sbjct: 238 KILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPG--------RRFKGVCAV 289

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349
            + AAF++ GTELV ++A E+ NPR T+P+A K+  + I   YI  L  IG LVPYND +
Sbjct: 290 FVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDER 349

Query: 350 LTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
           L +  S V  + SP +IAIEN G K LP + NA+IL  I+S ANS +Y  SR +  +++ 
Sbjct: 350 LLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEI 409

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
              PK  +   K G P  A+FAT IFG L+++  S    +VF WL  ++G++  F W  I
Sbjct: 410 GNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSI 469

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FN 523
           ++SHIRF QA+K +  S +ELPF +      ++Y    + ++++   +TS  P      +
Sbjct: 470 NLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGAD 529

Query: 524 GVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVW--------E 574
             +F   Y+S+ +F+  ++  ++  +  R   K +D+D+D+ RR+I+  +         E
Sbjct: 530 AESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLERE 589

Query: 575 EPEPKTLWDKFWNV 588
           +   K  + +F NV
Sbjct: 590 QMAQKPFYIRFLNV 603

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  304 bits (779), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 181/552 (32%), Positives = 295/552 (53%), Gaps = 31/552 (5%)

Query: 58  GVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
           G NG +T   EE I ++     +  ++K+ L  RH                     L   
Sbjct: 80  GYNGNETIISEELINEDG----RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKC 135

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFLSPAFGAANGYM 172
           GP G + SYL + ++ Y +   LGEM  ++P   S +  S     +R+L  +   A G+ 
Sbjct: 136 GPAGLVASYLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWN 195

Query: 173 YWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           Y++ + +  A E +    V+++WT  VP  AWI +F +II  +NM PV+ YGE EFW A 
Sbjct: 196 YYYCFVMLVAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAI 255

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
            K++ I+G +I  F +  G G     +GFRYW  PG++   I   N +   FL     +I
Sbjct: 256 SKILCIVGLIILSFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGII 313

Query: 292 NAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
             AF+F  G ELV + + E ++PR+ + +A K+ ++R++ FYI   L I ++V YNDP L
Sbjct: 314 LGAFSFILGPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPIL 373

Query: 351 TSA----TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSK 406
           ++A         +SPF+I I+N+G  VLPHI N  IL +  S+ N+ ++  SR L  ++ 
Sbjct: 374 STALIQDKPGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAI 433

Query: 407 SKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLF 466
           +  APK   K  + GVPY+AV  + I   +AY+  S     VF W  N++ ++GF  W+ 
Sbjct: 434 NSQAPKCLGKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWII 493

Query: 467 ISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGV 525
           +SV+++RF +A++Y G+ +D LP+     P L  Y+    ++I +  GF    P  +N  
Sbjct: 494 VSVTYLRFRKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVS 552

Query: 526 NFLAAYISVFLFLAIWI-------LFELIFR-CRFVWKIEDVDIDSDRRDI----EAIVW 573
           +F+AAY+++ +FL IWI        F++  R CR+ +++ED+D+ +   +I    E    
Sbjct: 553 DFIAAYLTLPIFLMIWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFES 612

Query: 574 EEPEPKTLWDKF 585
           E  +P+T+  KF
Sbjct: 613 EYVKPETVGGKF 624

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  305 bits (781), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 189/589 (32%), Positives = 304/589 (51%), Gaps = 27/589 (4%)

Query: 9   EVEEKHMYTEPAGTFFHDVEASQTHHRR--GSLSLKDEKSKELYPL-RSFPNGVNGQDTF 65
            ++EK   T    T F   E  + + RR   S    +++  + + L     N +    + 
Sbjct: 64  NIDEKLQST----TEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISM 119

Query: 66  SMEEDIQDEDEGEVQ----NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           +  + +Q++  G  Q       +K+ +K RH                     L NAGP G
Sbjct: 120 NSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAG 179

Query: 122 ALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
            +I Y  MGS  Y + Q+ GEMA  +  +   F  +    + P FG A  ++Y   W   
Sbjct: 180 LVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCV 239

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
             LEL      I++WT  V   A++ IF+V+I  + +F  + Y E EF+    K++ IIG
Sbjct: 240 CPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIG 299

Query: 241 FLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQG 299
           F I    +   GAG  G +G +YW +PGA+            RF G +++ ++AAF F  
Sbjct: 300 FYILGIIINAGGAGNDGYLGAKYWHDPGAF-----RGTNGIQRFKGIMATFVSAAFAFGA 354

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVS 358
           TE + +TA E +NPRK +P A KKV++R++  ++G++  +G LVP++  +L  A  S   
Sbjct: 355 TEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATK 414

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SP+++AI   G +V+PH  NAVIL ++ S ANS  Y  SR+L GL++   APKFF    
Sbjct: 415 ASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVD 474

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P+ A+   ++FG +A+   S    +VF WLL I+G++  F W+ I VSHIRF +A+
Sbjct: 475 RQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAM 534

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN-----FLAAYIS 533
             +G S  E+ FKA+L    +YYAT  MV+ ++ Q + +  P  N  +     F   Y++
Sbjct: 535 TVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLA 594

Query: 534 VFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           + + +A +  ++L  R  R   + +D+D+DS R+  D E +  E+ E K
Sbjct: 595 MPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYK 643

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  305 bits (781), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 180/583 (30%), Positives = 303/583 (51%), Gaps = 30/583 (5%)

Query: 28  EASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRE 87
             S+THH       KD+  +     ++     NG     ++ +     +G+     +K+ 
Sbjct: 109 SGSRTHHYEAE---KDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQG 165

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147
           L+ RH                     L   GP G  ISY+ + ++ Y +  +LGEM  F+
Sbjct: 166 LQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFL 225

Query: 148 PVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           P   S +  S      R++  + G A G+ Y++ + +  A E +    V+++WT AVP  
Sbjct: 226 PGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKG 285

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            WI+IF  ++  +N   VK YGE EFW ASIK++ I+G +I  F +  G G     +GFR
Sbjct: 286 VWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFR 345

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRA 320
           YW++PG++   +     +   F    + +I  AF F  G ELV +T+ E A+ R+ + +A
Sbjct: 346 YWQHPGSFAHHL--AGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKA 403

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPH 376
            ++ V+R++ FY+   L I ++VPYNDP L +A +       +SP++I I+N+G KVLPH
Sbjct: 404 SRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPH 463

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
           I N  ILT+  SAAN+ ++  +R L  ++++  APK   K  + GVPY+AV  + +   L
Sbjct: 464 IINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCL 523

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           AY+  S+    VF W  NI+ ++GF  W+   ++++RF +A+ + G+  D LPFK    P
Sbjct: 524 AYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQP 582

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIWILFELIFRCRFVW- 554
              +++   + +I +  G+  F P + N  +F+AAYI++ +FL +W+  +L  R    W 
Sbjct: 583 YTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWW 642

Query: 555 -KIEDVD-------IDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
             + ++D       I+   RDIE +      P T  +KF + +
Sbjct: 643 HSVSEIDVTTGLVEIEEKSRDIEEL---RLPPATFKEKFMDAL 682

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  303 bits (775), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 178/553 (32%), Positives = 297/553 (53%), Gaps = 24/553 (4%)

Query: 57  NGVNGQDTFSMEEDIQDED--EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
           NG   +D   M+ D++     EG+ +  ++K+ L+ RH                     L
Sbjct: 82  NGTIREDLI-MDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTL 140

Query: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQ-----RFLSPAFGAAN 169
              GP G  ISY+ + ++ Y +  +LGEM  F+P   S +  S      R++  + G A 
Sbjct: 141 HTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFAT 200

Query: 170 GYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFW 229
           G+ Y++ + +  A E +    V+++WT AVP   WI+IF  ++  +N+  VK YGE EFW
Sbjct: 201 GWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFW 260

Query: 230 VASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVS 288
            ASIK++ I+G +I  F +  G G     +GFRYW++PGA+   +     +   F    +
Sbjct: 261 FASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHL--TGGSLGNFTDIYT 318

Query: 289 SLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
            +I  AF F  G ELV +T+ E A+ R+ + +A ++ V+R++ FY+   L I ++VPYND
Sbjct: 319 GIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYND 378

Query: 348 PKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFG 403
           P L +A +       +SPF+I I+N+G KVLPHI N  IL++  SAAN+ ++  +R L  
Sbjct: 379 PSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLT 438

Query: 404 LSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFA 463
           ++++  APK   +  + GVPY+AV  + +   LAY+  S+    VF W  NI+ ++GF  
Sbjct: 439 MAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLG 498

Query: 464 WLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFN 523
           W+   ++++RF +A+ Y G+  D LPFK    P   + +   + +I L  G+  F P + 
Sbjct: 499 WMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYW 557

Query: 524 GV-NFLAAYISVFLFLAIWILFELIFRCRFVW--KIEDVDIDSDRRDIEAIVWEEPE--- 577
            + +F+AAYI++ +FL +W   +L  R    W   + ++D+ +   +IE    E  E   
Sbjct: 558 KIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRL 617

Query: 578 -PKTLWDKFWNVV 589
            P +  DKF + +
Sbjct: 618 PPSSFKDKFMDAL 630

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  301 bits (772), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 195/571 (34%), Positives = 298/571 (52%), Gaps = 33/571 (5%)

Query: 9   EVEEKHMYTEPAGTFFHDVEASQTH-HRRGSLSLKDEKS-KELYPLRSFPNGVNGQDTFS 66
            VE + +  EP     HD+ ++ +  H++G +  +   S +E   L   PN         
Sbjct: 18  RVESEFISQEP---LSHDLSSTGSEEHKKGKVWTRFVDSFRERERLEVDPN--------- 65

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
           M E   D+      N+ ++  LK RH                     L  AGP G LI +
Sbjct: 66  MSE--LDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 123

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
              G++ YS+  +LGE+A   PV+  FT ++ RF+  ++G AN   Y   W V   LE+ 
Sbjct: 124 GLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIV 183

Query: 187 VVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
                + +W T       ++++FW+ I  +N+F VK YGE EF  + IKVI ++GF+I  
Sbjct: 184 AASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILG 243

Query: 246 FCMVCGAG-VTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
             + CG G V G +G RYW +P     G    +   ARF G  S  + AAF+F G+ELVG
Sbjct: 244 IILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVG 299

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFI 363
           + + E ANPRK+VP+A K+V +RI  FY+ +L  +GLLVPY + +L  A+S   + SPF+
Sbjct: 300 LASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFV 359

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           IAI   G + LP + N VIL  ++S  NS IY  SR L  L++    PKFF    + G P
Sbjct: 360 IAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRP 419

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
             ++  TS FG +A++  S   G+VF WLL ++G++  F W  I + HIRF +AL  +G 
Sbjct: 420 LYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGR 479

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTF---NGVNFLAAYISVFLFLAI 540
             DEL F +      +Y+  F ++++ + Q + +  P     N   F  AY+S  + +A 
Sbjct: 480 GTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIAC 539

Query: 541 WILFELIFRCRFVWKI----EDVDIDSDRRD 567
           ++  ++  +    WKI    ED+DID+ R+D
Sbjct: 540 YLGHKIYKKN---WKIFIKAEDMDIDTGRKD 567

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  301 bits (772), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 175/533 (32%), Positives = 282/533 (52%), Gaps = 18/533 (3%)

Query: 46  SKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXX 105
           SK+   +    N +   D F   ED + ED   + N  + ++L  RH             
Sbjct: 51  SKDSPGINQTTNDITSSDRFRRNEDTEQED---INNTNLSKDLSVRHLLTLAVGGAIGTG 107

Query: 106 XXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAF 165
                   L+  GP   +I ++ + +  ++V  SLGE++   PV   F V+S RF+ P+F
Sbjct: 108 LYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSF 167

Query: 166 GAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGE 225
             A    Y   W V   LEL      I++W   +   AW++IF+  I   NM  VK +GE
Sbjct: 168 AFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGE 227

Query: 226 FEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFL 284
            EF ++ IK+++IIGF I    + CG G  G     +YW +PGA+       + +  +F 
Sbjct: 228 TEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFK 282

Query: 285 GWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVP 344
           G  S  + AAF++ G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP
Sbjct: 283 GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVP 342

Query: 345 YNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLF 402
            NDP+L + +S V  ++SP +IAIEN G K LP + NA+IL  ++S ANS +Y  SR + 
Sbjct: 343 SNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMV 402

Query: 403 GLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFF 462
            ++     PKF ++  K G P  A+  T  FG L+++  S    +VF WL  ++G++  F
Sbjct: 403 AMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIF 462

Query: 463 AWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGF-TSFTPT 521
            W+ I++SHIRF QA+K +  S DELPF ++     ++Y  F ++ ++LI  F TS  P 
Sbjct: 463 CWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFLVLIASFWTSLFPL 521

Query: 522 ----FNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
                +  +F   Y+S  + +  ++  +L  R    + K+ED+D+D+ R+ ++
Sbjct: 522 GGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  301 bits (771), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 184/512 (35%), Positives = 285/512 (55%), Gaps = 14/512 (2%)

Query: 67  MEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           ++ ++ D ++  ++ A   ++ +LK RH                     L  AGP G LI
Sbjct: 69  VDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILI 128

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
            +   G++ +++  +LGE+A   PV+  FT ++ RF+  +FG A  + Y   W V   LE
Sbjct: 129 GWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLE 188

Query: 185 LSVVGQVIQFWTYAVPLA-AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243
           +      + +W   V     ++++FW+++  +NMF V+ YGE EF  + IKV A+IGF+I
Sbjct: 189 IVAASITVAYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFII 248

Query: 244 YCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTEL 302
               +VCG G  G     RYW NPGA+       + +  +F G+ S  + AAF+F G+EL
Sbjct: 249 LGIVLVCGGGPVGGYVGARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSEL 303

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TSATSYVSTSP 361
           +G+   EA NPRK VP A K+V +RIL FYI  LL IG LVPYNDP+L +S++   S SP
Sbjct: 304 IGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASP 363

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
           F+IAI   G   LP + N VIL +++S  NS IY  SR L  LS+    PK  S   + G
Sbjct: 364 FVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKG 423

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
            P + +  +S FG +A++  S    ++F WLL I+G++ FF W  I + HIRF  ALK +
Sbjct: 424 RPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQ 483

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFL 538
           G   DELPF +      +Y+  F  +++++ Q + +  P   + +   F +AY++  + L
Sbjct: 484 GRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVIL 543

Query: 539 AIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
           A +I  +L  +  +F+  +EDVDID+ RRD +
Sbjct: 544 AFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTD 575

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  301 bits (770), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 175/528 (33%), Positives = 279/528 (52%), Gaps = 18/528 (3%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           N V   D F   E I+ ED   + N  + ++L  RH                     L+ 
Sbjct: 62  NDVTSSDHFRGSEGIEQED---INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALST 118

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GP   +I ++ + +  ++V  SLGE++   PV   F V+S RF+ P+F  A    Y   
Sbjct: 119 GGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQ 178

Query: 177 WAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVI 236
           W V   LEL      I++W   +   AW++IF+  I   NM  VK +GE EF ++ IK++
Sbjct: 179 WLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKIL 238

Query: 237 AIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAF 295
           +IIGF I    + CG G  G     +YW +PGA+       + +  +F G  S  + AAF
Sbjct: 239 SIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAF 293

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATS 355
           ++ G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP NDP+L + +S
Sbjct: 294 SYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSS 353

Query: 356 YV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKF 413
            V  ++SP +IAIEN G K LP + NA+IL  ++S ANS +Y  SR +  ++     PKF
Sbjct: 354 SVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKF 413

Query: 414 FSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIR 473
            ++  K G P  A+  T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIR
Sbjct: 414 LNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIR 473

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGF-TSFTPT----FNGVNFL 528
           F QA+K +  S DELPF ++     ++Y  F ++ ++LI  F TS  P      N  +F 
Sbjct: 474 FRQAMKVQERSLDELPFISQTGVKGSWYG-FIVLFLVLIASFWTSLFPLGSSGANAESFF 532

Query: 529 AAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEE 575
             Y+S  + +  +   ++  R    + K+ED+D+D+ R+ ++  +  E
Sbjct: 533 EGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRRE 580

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  302 bits (774), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 189/564 (33%), Positives = 291/564 (51%), Gaps = 25/564 (4%)

Query: 36  RGSLSLKDEKSKELYPLRSFPNGV-NGQDTFSMEEDIQDED---------EGEVQNAEVK 85
             S S  DE + E Y ++ F N + N +    + +D  D           E + +NA++K
Sbjct: 92  NASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLK 151

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA- 144
           + +K RH                    PL  AGP   +I Y  MG+  Y + Q+ GE+A 
Sbjct: 152 QTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAV 211

Query: 145 TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAW 204
            +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT  V    +
Sbjct: 212 AYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVF 271

Query: 205 ISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYW 263
           + IF+V+I  +N F  K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW
Sbjct: 272 VVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYW 331

Query: 264 RNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKK 323
            +PGA+      + K E RF G + + + AAF F  TE + +TA E +NPRK +P A KK
Sbjct: 332 NDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKK 386

Query: 324 VVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           V +RIL  ++ S++ IG LVPYN D  + S++   S SP+++A    G  V+ H  NAVI
Sbjct: 387 VAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVI 446

Query: 383 LTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETS 442
           L +++S ANS  Y  SR+L GL++   APK+F    + G P  ++   +I   +A+  TS
Sbjct: 447 LLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATS 506

Query: 443 TGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
                VF WLL I+G++  F W  I VSHIRF + ++ +G S  EL F+A+     +YYA
Sbjct: 507 PKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYA 566

Query: 503 TFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIE 557
              + + ++ Q + +  P    T +  NF   Y+++ + LA+++ F+L  R  R   + +
Sbjct: 567 AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAK 626

Query: 558 DVDIDSDRR--DIEAIVWEEPEPK 579
           ++D+ S R   D E +  E+ E K
Sbjct: 627 NIDLISHRIIFDEELLRQEDEEYK 650

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  301 bits (772), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 181/556 (32%), Positives = 289/556 (51%), Gaps = 30/556 (5%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDI-QDEDEGEVQNAEVKRELKQRHXXXXX 97
           +S KD  S+         N +N + ++   + I Q   E E +   +K+ +K RH     
Sbjct: 106 ISTKDSSSQ-------LDNELNRKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMS 158

Query: 98  XXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVF 156
                           L NAGP G +I Y  MGS  Y + Q+ GE+A  +  +   F  +
Sbjct: 159 LGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTY 218

Query: 157 SQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMN 216
               + PA G +  +++   W     LEL      I++WT +V    ++ IF+V+I  +N
Sbjct: 219 PLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVIN 278

Query: 217 MFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIIS 275
           +F  K Y E +F+    K++ I+GF I    + CG AG  G +G +YWR+PGA+      
Sbjct: 279 VFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----R 333

Query: 276 KNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGS 335
            +    RF G V++ + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++ S
Sbjct: 334 GDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLAS 393

Query: 336 LLFIGLLVPY-NDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNI 394
           L  +G LVPY +D  L +A S    SP++IA+ + G +V+PH  NAVIL +++S AN   
Sbjct: 394 LTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANGAF 453

Query: 395 YVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLN 454
           Y  SR+L  L+K   APK F    + G P  A+  +++FG +A+  +S     VF WLL 
Sbjct: 454 YTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLA 513

Query: 455 ITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQG 514
           I+G++  F W+ I +SHIRF +A+K +G S  E+ +K+++    + YA   MV+ ++ Q 
Sbjct: 514 ISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQF 573

Query: 515 FTSFTPTFNGVNFLA-AYISVFLFLAIWILFELIFRCRFVWK--------IEDVDIDSDR 565
           + +  P   G    A ++   +L + IWI   + ++   VWK         + VD+ S R
Sbjct: 574 WVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYK---VWKKDWSLFIPADKVDLVSHR 630

Query: 566 R--DIEAIVWEEPEPK 579
              D E +  E+ E K
Sbjct: 631 NIFDEELLKQEDEEYK 646

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  300 bits (767), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 174/522 (33%), Positives = 277/522 (53%), Gaps = 18/522 (3%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           N +     F  ++D+Q ED   + N  + +EL  RH                     L+ 
Sbjct: 62  NDITSSGRFHSDDDVQQED---INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALST 118

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GP   +I ++ + +  ++V  SLGE++   PV   F V+S RF+ P+F  A    Y   
Sbjct: 119 GGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQ 178

Query: 177 WAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVI 236
           W V   LEL      I++W   +   AW++IF+  I   NM  VK +GE EF ++ IK++
Sbjct: 179 WLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKIL 238

Query: 237 AIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAF 295
           AIIGF I    + CG G  G     +YW +PGA+       + +  +F G  S  + AAF
Sbjct: 239 AIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTAAF 293

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATS 355
           ++ G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP NDP+L + +S
Sbjct: 294 SYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSS 353

Query: 356 YV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKF 413
            V  ++SP +IAIEN   K LP + NA+IL  ++S ANS +Y  SR +  ++     PKF
Sbjct: 354 SVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKF 413

Query: 414 FSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIR 473
             +  K G P  A+  T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIR
Sbjct: 414 LRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIR 473

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGF-TSFTPT----FNGVNFL 528
           F QA+K++  S DELPF ++     + Y  F ++ ++LI  F TS  P      N  +F 
Sbjct: 474 FRQAMKFQERSLDELPFISQTGVWGSIYG-FVVLFLVLIASFWTSMFPIGSSGANAESFF 532

Query: 529 AAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
             Y+S  + +  +   ++  R  R + K+ED+D+D+ R+ ++
Sbjct: 533 EGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  299 bits (765), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 176/538 (32%), Positives = 280/538 (52%), Gaps = 18/538 (3%)

Query: 43  DEKSKELYPLRSFPNGV---NGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXX 99
           +EK   L PL S  + V     Q T      I  ED+  + N  + + L  RH       
Sbjct: 33  EEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDD--INNVNLNKNLSIRHLLTLAVG 90

Query: 100 XXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQR 159
                         L + GP   +I ++ + +  ++V  +LGEMA   PV   F V+  R
Sbjct: 91  GSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITR 150

Query: 160 FLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFP 219
           F+ P+ G A    Y   W V   LEL      I++W   +   AW++IF+ +I   NM  
Sbjct: 151 FIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLE 210

Query: 220 VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNK 278
           VK +GE EF ++ IK++AIIGF I    + CG G  G     +YW +PG++       + 
Sbjct: 211 VKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF-----VGHN 265

Query: 279 NEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLF 338
           +  +F G  S  + AAF++ G E+  ++A E+ +PR T+P+A K+  + I   Y+  L  
Sbjct: 266 SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTL 325

Query: 339 IGLLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYV 396
           IG LVPY+DP+L S TS V  ++SP +IAIEN G K LP + NA+IL +IIS ANS +Y 
Sbjct: 326 IGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYA 385

Query: 397 GSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNIT 456
            SR +  ++     P+  ++    G P  A+  T  FG L+++  S     VF WL  ++
Sbjct: 386 CSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALS 445

Query: 457 GVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFT 516
           G++  F W+ I++SHIRF Q++  +  S DELPF ++     ++Y T  + ++++   +T
Sbjct: 446 GLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWT 505

Query: 517 SFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRCR-FVWKIEDVDIDSDRRDIE 569
           S  P    + +  +F   Y+S  + LA +   +L  R R F+  + D+D+D+ RR ++
Sbjct: 506 SLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVD 563

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  301 bits (770), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 181/568 (31%), Positives = 295/568 (51%), Gaps = 41/568 (7%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDI-QDEDEGEVQNAEVKRELKQRHXXXXX 97
           +S KD  S+         N +N + ++   + I Q   E E +   +K+ +K RH     
Sbjct: 106 ISTKDSSSR-------LDNELNPKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMMS 158

Query: 98  XXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVF 156
                           L NAGP G +I Y  MGS  Y + Q+ GE+A  +  +   F  +
Sbjct: 159 LGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTY 218

Query: 157 SQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMN 216
               + PA G +  +++   W     LEL      I++WT  V    ++ IF+V+I  +N
Sbjct: 219 PSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVIN 278

Query: 217 MFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIIS 275
           +F  K Y E +F+    K++ I GF I    + CG AG  G +G RYWR+PGA+      
Sbjct: 279 IFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF-----R 333

Query: 276 KNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGS 335
            + +  RF G V++ + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++ S
Sbjct: 334 GDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLAS 393

Query: 336 LLFIGLLVPY-NDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNI 394
           L  +G LVPY +D  L +A S    SP++IA+ + G +V+PH  NAVIL +++S ANS  
Sbjct: 394 LALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAF 453

Query: 395 YVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLN 454
           Y  SR+L  L+K   APK F    + G P +A+  +++FG +A+  +S     VF WLL 
Sbjct: 454 YTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLA 513

Query: 455 ITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQG 514
           I+G++  F W+ I +SHIRF + +K +G S  E+ +K+++    + YA   MV+ ++ Q 
Sbjct: 514 ISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQF 573

Query: 515 FTSFTP-----TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK--------IEDVDI 561
           + + +P       +  +F   Y+++ + +A++I ++       VWK         + +D+
Sbjct: 574 WVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYK-------VWKRDWSLFIPADKIDL 626

Query: 562 DSDRR--DIEAIVWEEPEPKTLWDKFWN 587
            S R   D E +  E+ E K   D+  N
Sbjct: 627 VSHRNIFDEELLKQEDEEYK---DRLRN 651

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  299 bits (765), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 183/565 (32%), Positives = 292/565 (51%), Gaps = 23/565 (4%)

Query: 24  FHDVEASQTHHRRGSLSLKDEKSKELYPLR-----SFPNGVNGQDTFSMEEDIQDEDEG- 77
           FH  + + + + R S     E S    P+R     S  + +   DT     D++   E  
Sbjct: 18  FHSPDRTDSANDRSSSPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEYPRDVKATPEAA 77

Query: 78  ----EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLA 133
               ++ N  + ++L  RH                     LT  GP   +I ++ + +  
Sbjct: 78  SYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCL 137

Query: 134 YSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQ 193
           ++V  SLGE+A   PV   F V+  RF+ P+F  A    Y   W V   LEL      I+
Sbjct: 138 FTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIR 197

Query: 194 FWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253
           +W   +   AW++IF+  I   NM  VK +GE EF ++ +K++AIIGF I    + CG G
Sbjct: 198 YWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGG 257

Query: 254 VTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
             G     +YW NPGA+       +   ++F G  S  + AAF++ G E+  ++A E+ N
Sbjct: 258 PHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRN 312

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSG 370
           P++T+P+A K+  + I   Y+G L  IG LVPYNDP+L + +S V  + SP +IAIEN G
Sbjct: 313 PKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGG 372

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFAT 430
            K LP + NA+IL  I+S ANS +Y  SR +  ++     PKF SK  K G P  A+  T
Sbjct: 373 IKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLT 432

Query: 431 SIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPF 490
             FG L+++  S    +VF WL  ++G++  F W+ I++S IRF  A+K +G S DE+PF
Sbjct: 433 LFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPF 492

Query: 491 KAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFEL 546
            ++     A+Y    + ++++   +TS  P    T +  +F   Y+S+ + +A ++  +L
Sbjct: 493 LSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKL 552

Query: 547 IFRC-RFVWKIEDVDIDSDRRDIEA 570
             R  R +  + ++D+DS RR ++A
Sbjct: 553 WKRDWRLLVPLMEMDLDSGRRVLDA 577

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  299 bits (765), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 179/581 (30%), Positives = 309/581 (53%), Gaps = 23/581 (3%)

Query: 29  ASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDED--EGEVQNAEVKR 86
           +   H R  +    D + +++   +S  +     +   M+ D++     +G+ +  ++K+
Sbjct: 48  SRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSPSADGDNEPRKLKQ 107

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATF 146
            L+ RH                     L   GP G  ISY+ + ++ Y +  +LGEM  F
Sbjct: 108 GLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCF 167

Query: 147 IPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPL 201
           +P   S +  S      R++  + G A G+ Y++ + +  A E +    V+++WT AVP 
Sbjct: 168 LPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPK 227

Query: 202 AAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260
             WI++F +++  +N   VK YGE EFW ASIK++ I+G +I  F +  G G     +GF
Sbjct: 228 GVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGF 287

Query: 261 RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPR 319
           RYW++PGA+   +     +   F    + +I  AF F  G ELV +T+ E A+ R+ + +
Sbjct: 288 RYWQHPGAFAHHL--TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAK 345

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLP 375
           A ++ V+R++ FY+   L I ++VPYNDP L +A +       +SPF+I I+N+G KVLP
Sbjct: 346 ASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLP 405

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
           HI N  ILT+  SAAN+ ++  +R L  ++++  APK   K  + GVPY+AV A+ +   
Sbjct: 406 HIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSC 465

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           LAY+  S+    VF W  NI+ ++GF  W+   ++++RF +A+ Y G+  D LPFK    
Sbjct: 466 LAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQ 524

Query: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGV-NFLAAYISVFLFLAIWILFELIFRCRFVW 554
           P   +++   + +I +  G+  F P +  V +F+AAY+++ +FL +W+  +L  R    W
Sbjct: 525 PYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQW 584

Query: 555 --KIEDVDIDSDRRDIEAIVWEEPE----PKTLWDKFWNVV 589
              + ++D+     +IE    E  E    P ++ DKF + +
Sbjct: 585 WLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTL 625

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  296 bits (757), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 167/503 (33%), Positives = 268/503 (53%), Gaps = 7/503 (1%)

Query: 66  SMEEDIQDEDEGEVQN-AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           ++ +     DEG   N A + REL                         L   GP+   +
Sbjct: 14  TLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFL 73

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           +YLF GS+   V  SL EMA F P+   F+ +  +++ PAFG A G+ Y+  +A+  +  
Sbjct: 74  AYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSAN 133

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L+  G VI +W   + +A W+++ +     +N   V+Y+G+ E ++   K+  ++   I 
Sbjct: 134 LTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIV 193

Query: 245 CFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
           C  + CG G     +GFRYWR  G + P ++    N  +FLGW + +I + F F G+E++
Sbjct: 194 CLVITCGGGPDHTTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACVIQSIFGFMGSEMI 250

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPF 362
           GI  GE ANPRKT+P+A + V+ RI  FYI  +  +GL V  ++ KL  A S   + SPF
Sbjct: 251 GIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPF 310

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           +IAI  SG KVLP   NA +L  I S+A ++IY+ SR L+GL+K   APK F +  K  +
Sbjct: 311 VIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKI 370

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P +     S+ G LAYM T      VF ++ +   V G   W +I V++I + + +K  G
Sbjct: 371 PMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHG 430

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542
           +  DE+PF+    P  AY A FF+ VI    G+++F   FN   F+ +YI +F  + + +
Sbjct: 431 VRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVL 490

Query: 543 LFELIFRCRFVWKIEDVDIDSDR 565
            ++L ++ ++V K E++  +  +
Sbjct: 491 GYKLYYKTKWV-KPEEITFEKKQ 512

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  300 bits (767), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 178/545 (32%), Positives = 286/545 (52%), Gaps = 31/545 (5%)

Query: 54  SFPNGVNGQDTFSMEEDI-QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
              N +N + ++   + I Q   E E +   +K+ +K RH                    
Sbjct: 114 QLDNELNRKSSYITVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSK 173

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGY 171
            L NAGP G +I Y  MGS  Y + Q+ GE+A  +  +   F  +    + PA G +  +
Sbjct: 174 VLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAW 233

Query: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           ++   W     LEL      I++WT  V    ++ IF+V+I  +N+F  K Y E +F+  
Sbjct: 234 LFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFN 293

Query: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
             K++ IIGF I    + CG AG  G +G +YWR+PGA+       +    RF G V++ 
Sbjct: 294 CCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQRFKGIVATF 348

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPK 349
           + AAF F  +E + +TA E +NPRK +P A KK+++RIL  ++ SL  +G LVPY +D  
Sbjct: 349 VTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQL 408

Query: 350 LTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
           L +A S    SP++IA+ + G +V+PH  NAVIL +++S ANS  Y  SR+L  L+K   
Sbjct: 409 LGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGN 468

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
           APK F    + G P +A+  +++FG +A+  +S     VF WLL I+G++  F W+ I +
Sbjct: 469 APKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICL 528

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG----- 524
           SHIRF +A+K +G S  E+ +K+++    + YA   M++ ++ Q + +  P   G     
Sbjct: 529 SHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSA 588

Query: 525 VNFLAAYISVFLFLAIWILFELIFRCRFVWKIE--------DVDIDSDRR--DIEAIVWE 574
            +F   Y+++ + +A++I F+       VWK +         VD+ S R   D E +  E
Sbjct: 589 QSFFENYLAMPILIALYIFFK-------VWKNDWSLFIPANKVDLVSHRNIFDEELLKQE 641

Query: 575 EPEPK 579
           + E K
Sbjct: 642 DEEYK 646

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  298 bits (764), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 282/533 (52%), Gaps = 23/533 (4%)

Query: 60  NGQDTFSME--EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
           +G++   +E  E+    ++   +N E+K+ +K RH                     L NA
Sbjct: 80  DGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNA 139

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
           GP G LI Y  MG+  Y + Q+ GE+A ++  ++  F V+    + PAFG +  ++Y   
Sbjct: 140 GPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQ 199

Query: 177 WAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVI 236
           W     LEL      I++WT  V    ++ IF+V+I  +N F  + Y E EF+    K++
Sbjct: 200 WLCVCPLELVTASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKIL 259

Query: 237 AIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAF 295
            +IGF I    +   GAG  G +G RYW  PGA+     + ++    F G +++++ AAF
Sbjct: 260 MMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAF 314

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SAT 354
            F  TE + +TA E +NPRK +P A KKV++RIL  ++GS+  +G LVPY+  +L  S  
Sbjct: 315 AFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGG 374

Query: 355 SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFF 414
           S    SP+++A+   G KV+PH  NAVIL +++S  NS  Y  SR+L+ L++   APKFF
Sbjct: 375 SATKASPYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFF 434

Query: 415 SKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRF 474
               + G P+ A+    +F  +++   S    +VF WLL I+G++  F W  I +SHIRF
Sbjct: 435 DYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRF 494

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISV 534
            +A+  +  S  E+ FKA+     +YY  F +V+I++ Q + +  P   G      +   
Sbjct: 495 RKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFEN 554

Query: 535 FLFLAIWILFELIFRCRFVWKIE--------DVDIDSDRR--DIEAIVWEEPE 577
           +L + I ILF + ++   +WK +        ++D+D  R+  D E +  E+ E
Sbjct: 555 YLAMPILILFYVGYK---IWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  297 bits (761), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 184/576 (31%), Positives = 303/576 (52%), Gaps = 38/576 (6%)

Query: 40  SLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQ--------NAEVKRELKQR 91
            + +  SK +  L+ F +     D  + + +I+  +   ++        N ++++ ++ R
Sbjct: 28  QINESHSKLIENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDKLNNQLQKTIQPR 87

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVT 150
           H                     L NAGP G LI Y+ M S  Y + Q+ GEMA  ++ + 
Sbjct: 88  HVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLI 147

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210
             F  +    +  A+  A  ++Y   W     LEL      I++W   V    +++IF++
Sbjct: 148 GGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYL 207

Query: 211 IITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGA 268
           +I A+N+F   + Y E EF+    K++ I GF I    ++CG AG +G +G  YW NPGA
Sbjct: 208 LIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGA 267

Query: 269 W---GPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325
           +    PG         RF G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV+
Sbjct: 268 FRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVI 319

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILT 384
           +R L  Y+GS++ +G LVPYN P+L  S +S    SP++IA+ + G ++ PH  NAVIL 
Sbjct: 320 YRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFINAVILI 379

Query: 385 TIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTG 444
           +++S ANS+ Y  SR+L  L+K   APK F+   + G P   + A S+   +A+  +S  
Sbjct: 380 SVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPK 439

Query: 445 GGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATF 504
             +VF+WLL I+G++  F W  I +SHIRF +A+K +G S +EL +K+++    + YA  
Sbjct: 440 ETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAAT 499

Query: 505 FMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKI----ED 558
            M +I++ Q + +  P   NG N +  +   +L + I +LF   ++  +  W +    +D
Sbjct: 500 VMFLILIGQFWVALWPLNSNGAN-ITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKD 558

Query: 559 VDIDSDRR--DIEAIVWEEPEPK------TLWDKFW 586
           +D+ S R   D + +  E+ + K      +LW K +
Sbjct: 559 IDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIY 594

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  298 bits (762), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/591 (31%), Positives = 305/591 (51%), Gaps = 56/591 (9%)

Query: 41  LKDEKSKELYPLRSFPNGVNGQ-----DTFSMEEDIQ----------------DEDEGEV 79
           L +EKS+       F NG+ G+     D+F   ED++                D    E+
Sbjct: 36  LDEEKSE-------FSNGLRGRFDEFIDSFRRAEDVRILPNEMNPILSHESVFDTAVVEI 88

Query: 80  Q------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLA 133
                  N ++K+ ++ RH                     L++AGP G +I Y  M +  
Sbjct: 89  SAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCI 148

Query: 134 YSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVI 192
           Y V Q++GEMA  ++ +   F+ +    + P    A  ++Y   W     LEL      I
Sbjct: 149 YCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTI 208

Query: 193 QFWTYAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           Q+WT  V    ++ IF++++  +N+F   + Y E EF+    K++ + GF I    ++CG
Sbjct: 209 QYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICG 268

Query: 252 -AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEA 310
            AG +G +G RYW +PGA+       +    RF G VS+L+ AAF F GTE + ITA E 
Sbjct: 269 GAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQ 323

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENS 369
           ANPRK +P A KKV++R L  Y+GS++ +G LVPYN  +L  S+      SP++IA+ + 
Sbjct: 324 ANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASH 383

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429
           G +V+PH  NAVIL ++ S A+S  Y  SR+L  L++   APK F+   K G P +    
Sbjct: 384 GIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVV 443

Query: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489
            +I   +++   S+    VF WLL+I+G++  F W  IS+SHIRF +A+K +G S DE+ 
Sbjct: 444 GAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIG 503

Query: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFE 545
           FK++     + YA   M+++++ Q +    P    + + V+F  AY+++ +F+ ++  ++
Sbjct: 504 FKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYK 563

Query: 546 LIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPKT------LWDKFWN 587
           +  R  R   + +++D+ + R   D E +  E  E +       LW K +N
Sbjct: 564 IWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYN 614

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  297 bits (760), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 180/603 (29%), Positives = 307/603 (50%), Gaps = 32/603 (5%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVE---------------ASQTHHRRGSLSLKDEK 45
           + TP    E  EK+  T+ +  F +DV+               +S TH R  +     + 
Sbjct: 2   IDTPGSSKESYEKNDITKSSAKF-NDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKP 60

Query: 46  SKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXX 105
            +  + + +  N +    +   +  ++     +  N ++K+ ++ RH             
Sbjct: 61  PETTHHIETDMNPILSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTG 120

Query: 106 XXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPA 164
                   L +AGP G +I Y  M S  Y + Q++GEMA  ++ +   F  +    + PA
Sbjct: 121 LLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPA 180

Query: 165 FGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYY 223
              +  ++Y   W     LEL      IQ+WT  V    ++ IF++++ A+N+F   + Y
Sbjct: 181 LNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGY 240

Query: 224 GEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEAR 282
            E EF   S K++ +IGF I    ++CG AG  G +G +YWR+PGA+       +    R
Sbjct: 241 AETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNR 295

Query: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLL 342
           F G VS+L+ AAF+F  TE + ITA E +NPRK +P A KKV++R L  Y+ S++ +GLL
Sbjct: 296 FKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLL 355

Query: 343 VPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVL 401
           VPY+  +L  S+++    SP+++A+   G +V+PH  NAVIL ++ S A+S  Y  SR+L
Sbjct: 356 VPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415

Query: 402 FGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGF 461
             L++   APK F+   + G P +     ++   +A+   S+   +VF WLL I+G++  
Sbjct: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475

Query: 462 FAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT 521
           F W  I +SHIRF +A+K +G S DE+ +K+++    + YA   M++I++ Q +    P 
Sbjct: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535

Query: 522 FNGVNFLAAYISVFLFLAIWILFELIFRC-----RFVWKIEDVDIDSDR--RDIEAIVWE 574
             G   + A+   +L + ++I+  L ++      R   + +D+D+ S R   D E +  E
Sbjct: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQE 595

Query: 575 EPE 577
             E
Sbjct: 596 REE 598

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  296 bits (759), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 183/526 (34%), Positives = 286/526 (54%), Gaps = 22/526 (4%)

Query: 66  SMEEDIQD-EDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           S   D +D  D G+  + ++K+ +K RH                     L N GP G +I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 125 SYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183
            Y  MGS  Y + Q+ GE+A  +  ++  F  +    + PA G +  ++Y   W     L
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243
           EL      I++WT +V    +++IF+V+  A+N+F  + Y E EF+  + KV+ I GF I
Sbjct: 197 ELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFI 256

Query: 244 YCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTEL 302
               + CG AG  G +G +YW +PG++     S +K    F G VS+L+ AAF F  TE 
Sbjct: 257 LGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEF 311

Query: 303 VGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSP 361
           + +TA E ANPRK++P A KKV++RI+  ++GS+  +G LVP+N  +L  S  S    SP
Sbjct: 312 IALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASP 371

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
           ++IAI + G KV+PH  NAVIL +++S  NS  Y  SR+L  L++   AP F     + G
Sbjct: 372 YVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREG 431

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
            P +A+  +++FG ++++  S     VF WLL I+G++  F W  I +SHIRF +A+K +
Sbjct: 432 RPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQ 491

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIW 541
           G S  EL FK+++    +YYAT  M++I++ Q +T+  P   G     A+     +LA+ 
Sbjct: 492 GRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFEN--YLAMP 549

Query: 542 ILFELIFRCRFVWKIE--------DVDIDSDRR--DIEAIVWEEPE 577
           IL  L F  + VWK +         +D+ S+RR  D + +  E+ E
Sbjct: 550 ILIALYFGYK-VWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  295 bits (756), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 180/527 (34%), Positives = 294/527 (55%), Gaps = 22/527 (4%)

Query: 66  SMEEDIQDED---EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
           S +++ Q  D   +G+ +   +K++L+ RH                     L  AGP   
Sbjct: 38  STDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSI 97

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           LI+Y  MG + ++V   LGEMA +IP+   FT ++ R+  PA G A G+ Y F + V   
Sbjct: 98  LIAYSIMGWVVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTP 156

Query: 183 LELSVVGQVIQFWTYA--VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
            +L+    VIQFW  A  V    WI++   +I  +N   V+++GEFEFW++S KV+ ++ 
Sbjct: 157 NQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLC 216

Query: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNE-----ARFLGWVSSLINAA 294
            +I    +  G G T   +GFRYW +PGA+     SK          +F+ ++S  + A 
Sbjct: 217 VMILLLVLALGGGPTHDRLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYAL 274

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT 354
           F + GTEL GI A E  +PR+ VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L  A+
Sbjct: 275 FAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQAS 334

Query: 355 SYVSTS---PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           S   ++   P+++AIEN+   VLP++FNA +LT + SA NS++YVGSR L+GL+    AP
Sbjct: 335 SAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAP 394

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           K F++T K GVPY A+   ++F  LAYM  S      F + +N+T + G  +W+ I +++
Sbjct: 395 KLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITY 454

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGV-NFLAA 530
           I F +A + +GI +  L + A   P   + A  F + + LI+ F +F      V  F+  
Sbjct: 455 ICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITG 514

Query: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE 577
           YI + +++  +I ++++ + +++   ++VD+ + +   EAI  EE E
Sbjct: 515 YIGLPIYIFCFIGYKIVHKTKWI-PSKEVDLFTFK---EAIDLEEEE 557

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  296 bits (757), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 192/552 (34%), Positives = 293/552 (53%), Gaps = 34/552 (6%)

Query: 62  QDTFSMEEDIQ-DEDEGEVQNAEV-------KRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           +D+F   + I+ D +  E +   +       K  LK RH                     
Sbjct: 56  KDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTA 115

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP   LI +   G++ Y++  +LGE+A   P++  FT ++ RF+  +FG AN + Y
Sbjct: 116 LRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNY 175

Query: 174 WFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
              W V   LE+      + FW T       ++++FW+ I  +NMF VK YGE EF  + 
Sbjct: 176 MLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSF 235

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKVI ++GF+I    + CG G TG     +YW +PGA+     + +   A+F G  S  +
Sbjct: 236 IKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFV 290

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+ELVG+ A E+  PRK+VP+A K+V +RI  FYI SLL IGLLVPYND  L 
Sbjct: 291 TAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLI 350

Query: 352 SATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
            A+S   + SPF+IAI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  
Sbjct: 351 GASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFL 410

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           P+ FS   + G P + +  TS FG +A++  S   G+VF WLL ++G++  F W  I + 
Sbjct: 411 PEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICIC 470

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN---F 527
           HIRF +AL  +G   DEL FK+      +Y+  F ++++ + Q + +  P  +  +   F
Sbjct: 471 HIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGF 530

Query: 528 LAAYISVFLFLAIWILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPKTL 581
             AY+S  L + ++I  ++  R    WK+    E +DID+ RR  D++ +  E  E K +
Sbjct: 531 FEAYLSFPLVMVMYIGHKIYKRN---WKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAI 587

Query: 582 ------WDKFWN 587
                 W + WN
Sbjct: 588 MATKPRWYRIWN 599

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  296 bits (757), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 190/570 (33%), Positives = 289/570 (50%), Gaps = 24/570 (4%)

Query: 29  ASQTHHRRGSLSLKDEKSKEL----YPLRSFPNGVN--GQDTFSMEEDIQDEDEGEVQ-N 81
            S   + R S+S  D    +       L +F N       DTF   +D++      V+ N
Sbjct: 20  GSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEGASINSVRSN 79

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
           ++ K+ +K RH                     L   GP G LI Y  +  +AY + Q+ G
Sbjct: 80  SKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAG 139

Query: 142 EMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVP 200
           EMA   P +  +F V+S  F+S +FG A  ++Y   W     LEL      I++W  ++ 
Sbjct: 140 EMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSIN 199

Query: 201 LAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF 260
             A+I+IF+ +I  ++ F    YGE EF  ++ KV  I GF+I    + CG   TG    
Sbjct: 200 PDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIG 259

Query: 261 -RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 319
             YWRNPGA+  G          F G    L+ A F++ G EL  +T  E ANPRK VP 
Sbjct: 260 GEYWRNPGAFAGG-----SPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPS 314

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TSATSYVSTSPFIIAIENSGTKVLPHI 377
           A KK ++RIL  Y+ +++ IG LVPYN  +L  +S  S    SP++IA+ + G KV+PHI
Sbjct: 315 ATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHI 374

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437
            NAVIL +++S  NS +Y   R+L  L++   APK FS   + G P +A+   SIFG L+
Sbjct: 375 INAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLS 434

Query: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF WL  I G++  F W  I +SH+RF  A+KY+G S  EL +K+K    
Sbjct: 435 FVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYW 494

Query: 498 LAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIWILFELIFRC-----R 551
            + YA FF +++ + Q + +  P  NG    A A+   +L   IWI   + ++      +
Sbjct: 495 GSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWK 554

Query: 552 FVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
            +  ++++D++S R   D   +  E+ E K
Sbjct: 555 LLVPLDEIDLNSHRHIFDKHILQQEDDEHK 584

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  296 bits (758), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 186/564 (32%), Positives = 292/564 (51%), Gaps = 28/564 (4%)

Query: 29  ASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKREL 88
           AS T  RR   S K  +  +       P  ++  D  + + DI+ +   E +  +  REL
Sbjct: 58  ASNTRFRRFIDSFKKAEGPQ-------PGSLD-HDVLAGDSDIEGKPRTEPEKDDDAREL 109

Query: 89  KQ----RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA 144
           K+    RH                     L N+GP G +I Y  MGS  Y + Q+ GE+A
Sbjct: 110 KKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELA 169

Query: 145 T-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAA 203
             +  +T  F  +    + PAFG A  ++Y   W     LEL      I++WT  V    
Sbjct: 170 VLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDV 229

Query: 204 WISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFR 261
           ++ IF+ +I  +N+      Y E EF+  S K++ + GF I    ++CG AG  G +G R
Sbjct: 230 FVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTR 289

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
            W NPG++       +K   RF G VS+L+NAAF F  +E +G+TA E +NPRK +P A 
Sbjct: 290 LWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAA 344

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNA 380
           KK+++RI+  Y+GS+  +G LVPY+ D  L S+ +    SP+++AI   G +V+PH  NA
Sbjct: 345 KKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINA 404

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL +++S  NS  Y  SR L  LS+   AP F +   + G P  A   +++ G +A+  
Sbjct: 405 VILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCA 464

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           TS    +VF WLL I+G++  F W  I +SH+RF +A++ +G S  E+ FK+++    + 
Sbjct: 465 TSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSL 524

Query: 501 YATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRC-----RFVWK 555
           Y+   MV+I++ Q +T+  P   G   + A+   +L + I+I+    F+      R   +
Sbjct: 525 YSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIR 584

Query: 556 IEDVDIDSDRR--DIEAIVWEEPE 577
            ED+D+ S R   D E +  E+ E
Sbjct: 585 AEDIDLVSHREIFDEELLKQEDEE 608

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  295 bits (756), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 276/514 (53%), Gaps = 16/514 (3%)

Query: 62  QDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           + T    ED     E   ++ E+K  +K RH                     L N+GP G
Sbjct: 101 EGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAG 160

Query: 122 ALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
            +I Y  MGS  Y + Q+ GEMA  +  +   F  +    + PA G +  ++Y   W   
Sbjct: 161 LVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCV 220

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAII 239
             LEL      I++WT  V    ++ IF+V+I  +N+      Y E EF+  S K++ ++
Sbjct: 221 CPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLL 280

Query: 240 GFLIYCFCMVCG-AGVTGPVGFRYWRNPGAW-GPGIISKNKNEARFLGWVSSLINAAFTF 297
           GF I    ++CG AG  G +G RYW +PGA+ G   I       RF G VS+L+NAAF F
Sbjct: 281 GFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEHAID------RFKGVVSTLVNAAFAF 334

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSY 356
             +E++G+TA E +NPRK +P A KK+++RI+  Y+GS++ +G LVP+N D  L S+   
Sbjct: 335 GLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGG 394

Query: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416
           V  SP+++A+   G +V+PH  NAVIL +++S ANS  Y  SR+L GL++   APK F  
Sbjct: 395 VKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKY 454

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
             + G P + +   ++   +++  TS    +VF WLL I+G++  F W  I +SHIRF +
Sbjct: 455 VDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRR 514

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG----VNFLAAYI 532
           A+  +G S  E+ FK++     ++YA   M++I++ Q + +  P   G      F   Y+
Sbjct: 515 AMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYL 574

Query: 533 SVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDR 565
           +  + +A++  +++  +  R   + +D+D+D +R
Sbjct: 575 AAPILIALYFGYKIYTKDWRLFIRAKDIDLDINR 608

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  294 bits (752), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 165/509 (32%), Positives = 271/509 (53%), Gaps = 13/509 (2%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAY 134
               V N  + + L  RH                     L + GP   +I ++ + +  +
Sbjct: 61  SNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLF 120

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQF 194
           +V  +LGEMA   PV   F V+  RF+ P+ G A    Y   W V   LEL      I++
Sbjct: 121 TVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKY 180

Query: 195 WTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV 254
           W   +   AW++IF+ +I   NM  VK +GE EF ++ +K++AIIGF I    + CG G 
Sbjct: 181 WNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGP 240

Query: 255 TGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            G     +YW NPG++       + +  +F G  S  + AAF++ G E+  ++A E+ +P
Sbjct: 241 QGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDP 295

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSGT 371
           R+T+P+A K+  + I   YI  L  IG LVPY++P+L S +S V  ++SP +IAIEN G 
Sbjct: 296 RRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGI 355

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
           K LP + NA+IL +IIS ANS +Y  SR +  ++     P+      K G P  A+  T 
Sbjct: 356 KGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTL 415

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
            FG L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+K +  S DELP+ 
Sbjct: 416 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYL 475

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELI 547
           ++     ++Y    + +++++  +TS  P      +  +F   Y+S  + +A ++  +L+
Sbjct: 476 SQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLV 535

Query: 548 FRCR-FVWKIEDVDIDSDRRDIEAIVWEE 575
           +R +  V  +ED+DID+ RR ++  +  +
Sbjct: 536 YRKKQIVVALEDMDIDTGRRQVDLTIRRQ 564

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  294 bits (753), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 191/540 (35%), Positives = 288/540 (53%), Gaps = 28/540 (5%)

Query: 62  QDTFSMEEDIQ-DEDEGEVQ-------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           +D+F   ED++ D +  E +        A ++  LK R                      
Sbjct: 73  KDSFKKAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTA 132

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP G +I +    ++ YS+  +LGE+A   PV   FT ++ RF+  +FG AN + Y
Sbjct: 133 LRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNY 192

Query: 174 WFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
              W V   LE+      + +W T       ++++FW++I  +NMF VK +GE EF  + 
Sbjct: 193 ALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSI 252

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKV  +IGF+I    +VCG G  G     +YW +PGA+       + + A+F G  S  +
Sbjct: 253 IKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAF-----VGHGSGAQFKGVCSVFV 307

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+EL+GITA EAANPRK++P A K+VV+RI+ FY+G+L  IGLLVPYND +L 
Sbjct: 308 TAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLI 367

Query: 352 SATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
            A+S   + SPF+IAI   G K LP + N VIL  ++S  NS I+  SR +  LS     
Sbjct: 368 GASSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFL 427

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           PK F    + G P + +  TS FG LA++  S   G+VF WLL ++G++  F W  I + 
Sbjct: 428 PKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLC 487

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN---F 527
           HIRF  ALK +G   +EL F +      +Y+  F +V++ + Q + +  P     +   F
Sbjct: 488 HIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVF 547

Query: 528 LAAYISVFLFLAIWILFELIFRCRFVWK----IEDVDIDSDRR--DIEAIVWEEPEPKTL 581
             +Y+S  + +A +   ++  R    WK    +ED+DID+ RR  D+E +  E  E K +
Sbjct: 548 FQSYLSFPIVVATYFGHKIYKRN---WKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAI 604

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  294 bits (752), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 190/598 (31%), Positives = 304/598 (50%), Gaps = 32/598 (5%)

Query: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60
           M   K ++  E     + P   +    + S++  RR         ++  +      +G +
Sbjct: 21  MQELKSNTGSESVERISLPGDDYKFHEDDSKSRFRR--------FARTFHRADGLGDGAS 72

Query: 61  GQDT-FSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
           G D  F  E   Q E        ++K+ +  RH                     L N GP
Sbjct: 73  GNDVEFGAEVARQTE-------TKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGP 125

Query: 120 VGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
            G +I Y  MGS  Y + Q+ GE+A ++  ++ +F  +    +  AFG +  ++Y   W 
Sbjct: 126 AGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWL 185

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++WT +V    +++IF+V+I  +NMF  + Y E EF+    KV+ I
Sbjct: 186 CVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMI 245

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           IGF I    + CG AG  G +G RYW NPGA+        K    F G +S+++ AAF F
Sbjct: 246 IGFFILGIIVNCGGAGNDGYIGGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAF 300

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSY 356
             TE + +TA E ANPR+ +P A KKVV+RIL  ++  ++ IG LVP+N P+L  S +S 
Sbjct: 301 GATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSA 360

Query: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416
              SP++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L+    AP +   
Sbjct: 361 THASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKF 420

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
             + G P  A+  + +FG ++++  S     VF WLL I+G++  F W+ I VSHIRF +
Sbjct: 421 IDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRK 480

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYI 532
           AL  +G    EL +K++     +YYATF M  I++ Q + +  P      +  +F   Y+
Sbjct: 481 ALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYL 540

Query: 533 SVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPE-PKTLWDKFW 586
           ++ LF+ ++  F++  R  R    +E +D+DS R+  D E +  E+ E  + + +K W
Sbjct: 541 ALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  293 bits (751), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 199/587 (33%), Positives = 311/587 (52%), Gaps = 24/587 (4%)

Query: 6   QDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTF 65
            +  V+EK  Y+     +   VE+ +  +   S    +E S   +  + F N     +  
Sbjct: 5   SNHSVDEKKNYSYAQEQY---VESGEFTNHEAS---NEESSGSKW--QDFKNSFKRMEVV 56

Query: 66  SMEEDIQDEDEGEVQ--NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGAL 123
            ++ ++ + ++  +   N+ +KR LK RH                     L  AGP G L
Sbjct: 57  ELDPNLTEAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGIL 116

Query: 124 ISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183
           I +   G++ Y +  ++GE+A   PV+  FT ++ RF+  +FG AN + Y   W V   L
Sbjct: 117 IGWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPL 176

Query: 184 ELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           E+      + +W T       ++++F+V+I ++NMF VK YGE EF  + IKVI +IGF+
Sbjct: 177 EIVAASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFI 236

Query: 243 IYCFCMVCGAGVTGPVGFR-YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I    +VCG G  G       W NPGA+       N    RF G  S  + AAF+F G+E
Sbjct: 237 ILGIILVCGGGPVGGYIGGANWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSE 291

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTS 360
           LVG+ + E ANPRK++PRA K+V +RI  FYI SL  IGLLVPYND +L  A+S   + S
Sbjct: 292 LVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS 351

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           PF++AI+N G K LP + N VIL  ++S  NS ++  SR L  L++    PK F    + 
Sbjct: 352 PFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRK 411

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           G P + +  TS FG L+++  S   G+VF WLL ++G++  F W+ I + H+RF +AL  
Sbjct: 412 GRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSA 471

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTF---NGVNFLAAYISVFLF 537
           +G S DEL F +      + Y T  +++I+  Q + +  P     +  +F  +Y+S+ + 
Sbjct: 472 QGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVV 531

Query: 538 LAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPKTL 581
           L ++I  +   R  +   + E++DID+ RR  DIEA+  E  E K +
Sbjct: 532 LVMYIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEKAV 578

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  293 bits (750), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 275/517 (53%), Gaps = 15/517 (2%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
             D  D ++ ++ N  + ++L  RH                     L+  GP   +I ++
Sbjct: 70  SRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWV 129

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
            +G+  ++V  SLGE++   PV   F V+  RF+ P+F  A    Y   W V   LEL  
Sbjct: 130 IIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVA 189

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               I++W   +   AW++IF+  I   NM  VK +GE EF ++ IK+++IIGF I    
Sbjct: 190 ASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIV 249

Query: 248 MVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGIT 306
           + CG G  G     +YWRNPGA+    +  N    +F G  S  + AAF++ G E+  ++
Sbjct: 250 LSCGGGPHGGYIGGKYWRNPGAF----VGHNSG-TKFKGLCSVFVTAAFSYSGIEMTAVS 304

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFII 364
           A E+ NPR+T+P+A K+  + I   Y+  L  IG LVP NDP+L + +S V  ++SP +I
Sbjct: 305 AAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVI 364

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           AIEN   K LP + NA+IL  ++S ANS +Y  SR +  ++     PKF ++  K G P 
Sbjct: 365 AIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPM 424

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
            A+  T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIRF +A+K +  S
Sbjct: 425 NAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERS 484

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGF-TSFTPT----FNGVNFLAAYISVFLFLA 539
            DELPF ++     ++Y  F ++ ++LI  F TS  P      +  +F   Y+S  + + 
Sbjct: 485 LDELPFISQTGVLGSWYG-FVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIV 543

Query: 540 IWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEE 575
            +   ++  R    + KIED+D+D+ R+ ++  +  E
Sbjct: 544 CYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRRE 580

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  293 bits (749), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 187/561 (33%), Positives = 301/561 (53%), Gaps = 26/561 (4%)

Query: 18  EPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEG 77
           EP  T   +   +  +  RGS+  K  +         F +     +   ++ ++ D ++ 
Sbjct: 31  EPCSTLSSN---NNDNESRGSIRCKWTR---------FVDSFKRIELEELDPNLTDAEKI 78

Query: 78  EVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
            +  A   +K  LK RH                     L  AGP G LI +   G++ YS
Sbjct: 79  AIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYS 138

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
           +  ++GE+A   PV+  FT ++ RF+  +FG A  + Y   W +T  LE+      + +W
Sbjct: 139 MVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYW 198

Query: 196 -TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGV 254
              A     ++++FWV    +N+F VK YGE EF  A IKV+ IIGF+I    ++CG G 
Sbjct: 199 GVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGP 258

Query: 255 TGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            G     +YW +PGA+       +    +F G+ +  I A+F+F G+E+VG+   E+ NP
Sbjct: 259 VGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENP 313

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTK 372
           RK+VP A K+V +RI  FY+  LL IG+LVPYND +L  A+S   + SPF+IA+ N G +
Sbjct: 314 RKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIR 373

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
            LP + N VIL +++S  NS+IY+ SR L  L++    PK  +   + G P +A+   S 
Sbjct: 374 GLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASA 433

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           FG +A++  S+  G+VF WLL ++G++  F+W  I + HIRF +AL  +G S DELPF +
Sbjct: 434 FGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVS 493

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVFLFLAIWILFELIFR 549
            +    +Y+  F  V++++ Q +    P   + N  +F  AY+S  + LA +I  ++  +
Sbjct: 494 TVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKK 553

Query: 550 C-RFVWKIEDVDIDSDRRDIE 569
             +   K ED+DID+ RR+++
Sbjct: 554 NWKLYIKAEDMDIDTGRREVD 574

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  294 bits (752), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 178/563 (31%), Positives = 290/563 (51%), Gaps = 22/563 (3%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQ-DTFSMEEDIQDEDEGEVQNAEVKRELK 89
           Q H R+   S +  +  +    R   N +       S  +D Q     E ++  +++ +K
Sbjct: 77  QPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIK 136

Query: 90  QRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIP 148
            RH                     L  AGP G +I Y  MGS  Y + Q+ GEMA  +  
Sbjct: 137 PRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSG 196

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIF 208
           +  +F  +    +  AFG +  ++Y   W     LEL      IQ+WT  V    ++ IF
Sbjct: 197 LPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIF 256

Query: 209 WVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPG 267
           +V+I  +N+F  K Y E EF+  S KV+ + GF I    +   GAG  G +G +YW NPG
Sbjct: 257 YVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPG 316

Query: 268 AWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327
           A+       +K+  RF   +S+   AAF F  +E + I A E +NPR+ +P A K +++R
Sbjct: 317 AF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYR 371

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTI 386
           IL  ++ S+  +G LVPYN  +L  S ++    SP++IA+ + G +V+PH  NAVIL ++
Sbjct: 372 ILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFINAVILLSV 431

Query: 387 ISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGG 446
           +S ANS  Y   R+L+ LS+   AP +F+   + G P  A+  +++F  +A+   S+   
Sbjct: 432 LSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEE 491

Query: 447 KVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFM 506
            VF WLL I+G++  F W+ I VSHIRF +A+K +G S DE+ FK+++    + YA   M
Sbjct: 492 DVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMM 551

Query: 507 VVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI----ED 558
            + ++ + + S  P      +  NF   Y+++ + + ++  +++   C+  WK+    +D
Sbjct: 552 TLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CKRDWKLFIRAKD 608

Query: 559 VDIDSDRR--DIEAIVWEEPEPK 579
           +D+ S R+  D E I  EE E K
Sbjct: 609 IDLVSHRKIYDGELIKQEEEEFK 631

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  292 bits (747), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 169/553 (30%), Positives = 287/553 (51%), Gaps = 29/553 (5%)

Query: 38  SLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXX 97
           ++S+ D+  K      +  +GV+ +      E   +    E  +  +K  L+ RH     
Sbjct: 15  NISVYDKNDKN-----NIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQSRHIQLIA 69

Query: 98  XXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSS----- 152
                           L N GP   +ISY+ + ++ Y +    GEM  ++P         
Sbjct: 70  LGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESV 129

Query: 153 --FTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWV 210
                   +++  + G A  + Y++ + V  A E +    ++++WT  +P A  I +F  
Sbjct: 130 GYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLG 189

Query: 211 IITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP----VGFRYWRNP 266
           +I  +N  PVK+YGE EFW A IK+  I G +I  F + CG          VGF YW+NP
Sbjct: 190 VIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNP 249

Query: 267 GAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAIKKVV 325
            ++   +   N +   FL   ++LI  AF F  G ELV +T+ E  + R+ + +A ++ V
Sbjct: 250 SSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFV 307

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNAV 381
           +R++ FYI   L I ++VPYNDP L +A +       +SPF+I I+N+G  +LPHI N  
Sbjct: 308 YRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFC 367

Query: 382 ILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMET 441
           ILT+ +SA N+ ++  +R L  + K+  AP+ FS+  + GVPY+A+  + +   LA++  
Sbjct: 368 ILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNC 427

Query: 442 STGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S    KVF W  NI+ ++GF  W    ++++RF + + Y G+  D LPFK K    L +Y
Sbjct: 428 SASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWY 486

Query: 502 ATFFMVVIILIQGFTSFTPTF-NGVNFLAAYISVFLFLAIW---ILFELIFRCRFVWK-I 556
           +  F+ ++IL  G+    P F N  +F+AAYI++ +FL ++   I++   +R R  WK +
Sbjct: 487 SFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPV 546

Query: 557 EDVDIDSDRRDIE 569
           +++D+ +   +IE
Sbjct: 547 DEIDVVTGLEEIE 559

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  294 bits (753), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 180/564 (31%), Positives = 282/564 (50%), Gaps = 20/564 (3%)

Query: 29  ASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDED-----EGEVQNAE 83
            +  + R    S   E  +++ P     +  N Q    +   IQDE+     + E  NAE
Sbjct: 99  GNNQYQRSSPFSNGLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAE 158

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +++ +K RH                    PL  AGP   +I Y  MG+  Y + Q+ GEM
Sbjct: 159 LRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEM 218

Query: 144 A-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           A  +  +T SF  F    + P F  A  ++Y   W     LEL      IQ+WT  V   
Sbjct: 219 AVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPD 278

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFR 261
            ++ IF+V+I  +N F  K Y E EF   + KV+ I GF I   C+  GA G  G +G +
Sbjct: 279 VFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAK 338

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+      + K E RF G + + + AAF F  TE + +TA E +NPRK +P A 
Sbjct: 339 YWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAA 393

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNA 380
           KK+++R+L  ++ +++ IG LVPY+ D  L S  S    SP+++AI   G +V  H  NA
Sbjct: 394 KKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVNA 453

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL ++IS  NS  Y  SR+L  L++   APK F    + G P IA+  +++   +A+  
Sbjct: 454 VILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCA 513

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           TS    +VF WL+ I G++  F W  I +SH+RF +A+K +G S  E+ + ++     + 
Sbjct: 514 TSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSL 573

Query: 501 YATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRC-----RFVWK 555
           YA   M++ ++ Q + +  P         ++ S +L + I I+F   ++      R   +
Sbjct: 574 YAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIR 633

Query: 556 IEDVDIDSDRR--DIEAIVWEEPE 577
            +D+D+ S R   D E +  E+ E
Sbjct: 634 AKDIDLISHRTIYDEELLRQEDEE 657

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  291 bits (745), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/575 (30%), Positives = 300/575 (52%), Gaps = 35/575 (6%)

Query: 43  DEKSKELYPLRSFPNGVNGQDTFSMEEDI----QDEDEGEVQNAE----------VKREL 88
           D K ++L  L         ++T+S+E+ +    +++D  ++ + E          + ++L
Sbjct: 9   DTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKDL 68

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP 148
             RH                     L+  GP   +I++  + +  +++  SLGE++   P
Sbjct: 69  SIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFP 128

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIF 208
           V   F V+  RF+ P+FG A  + Y   WA+   LEL      I++W  ++   AW+SIF
Sbjct: 129 VVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSINPDAWVSIF 188

Query: 209 WVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC-GAGVTGPVGFRYWRNPG 267
           +V I   NM  VK +GE EF ++ +K++AIIGF I    ++C G    G +G +YW +PG
Sbjct: 189 YVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPG 248

Query: 268 AWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327
           A+       +    RF G  +  I AAF++ G ELVG++A E+ NPR T+P+A K+  + 
Sbjct: 249 AF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWL 303

Query: 328 ILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTT 385
           I   Y+  L  IG LVP NDP L + TS V  + SP +IAI+N G K LP + NA+IL  
Sbjct: 304 ITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIA 363

Query: 386 IISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGG 445
           ++S ANS +Y  SR +  +++    P+  +   K G P  A+  T + G L+++  S   
Sbjct: 364 LLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKR 423

Query: 446 GKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFF 505
            +VF WL  ++G++  F W  I+++H+RF  A+K++  S +ELP+ +      ++Y    
Sbjct: 424 DEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIV 483

Query: 506 MVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELIFR-CRFVWKIEDVD 560
           + ++++   +TS  P      +  +F  +Y+S+ +F+A ++  ++  R  R   K+ +VD
Sbjct: 484 IGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVD 543

Query: 561 IDSDRRDIEAIVWEEPEP--------KTLWDKFWN 587
           +DS R D +A   ++ +         K  + + WN
Sbjct: 544 VDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 176/520 (33%), Positives = 270/520 (51%), Gaps = 16/520 (3%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
            D++ +      ++++K+ +K RH                     L   GP   +I Y  
Sbjct: 76  SDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFL 135

Query: 129 MGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
           +  + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELIT 195

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               I+FW   +    +I IF+V +  ++ F VK YGE EF     K++ I GF+I    
Sbjct: 196 AAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVV 255

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG  G +G +YWRNPGA+     + + +  RF      L+ A F+F G EL  ++
Sbjct: 256 INCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALS 310

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIA 365
             E ANPRKT P A K+ ++RIL  Y+ +++ IG  VPYND +L  A  S    SP+++A
Sbjct: 311 VQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
               G KV+PHI NAVIL ++IS ANS++Y G R++  L++    PKF     + G P I
Sbjct: 371 ASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLI 430

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
           A+   S+FG + ++  S+    VFAWL  I G++  F W  I +SH+RF QA+K +G S 
Sbjct: 431 ALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIWILF 544
           DEL +KA      + Y  FF +++ + Q + +  P  NG    A ++   +L   IWI F
Sbjct: 491 DELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAF 550

Query: 545 ELIFRC-----RFVWKIEDVDIDSDRR--DIEAIVWEEPE 577
            L +        F+  ++ +D+D  R   D E +  E+ E
Sbjct: 551 YLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLE 590

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  292 bits (748), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 181/596 (30%), Positives = 307/596 (51%), Gaps = 28/596 (4%)

Query: 5   KQDSEVE--EKHMYTEPAGTFFHDVEASQTHH--------RRGSLSLKDE-KSKELYPLR 53
           +QD+E+E  E      P+     D E   T          +R     +DE ++ ++  L 
Sbjct: 24  EQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDSFKRADQGGQDESEAVQMNDLT 83

Query: 54  SF--PNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           S   P+  N Q     +   +       ++  +K+ ++ RH                   
Sbjct: 84  SAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNG 143

Query: 112 XPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANG 170
             L +AGP G LI Y  MGS+ Y + Q+ GE+A  +  +T  +  +    +   FG A  
Sbjct: 144 TALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVA 203

Query: 171 YMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWV 230
           ++Y   W     LEL      I++WT +V    ++ IF+V++  +N+F  + Y E EF+ 
Sbjct: 204 WVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFF 263

Query: 231 ASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSS 289
              K++ + GF I    + V GAG  G +G +YW +PGA+     +   +  RF G V++
Sbjct: 264 NCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHSIDRFKGVVAT 318

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DP 348
           L+ AAF F G+E + IT  E +NPRK +P A K++++RIL  ++ +++ +G LVPYN D 
Sbjct: 319 LVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQ 378

Query: 349 KLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSK 408
            L S       SP++IAI + G +V+PH  NAVIL +++S ANS+ Y  +R+   LS+  
Sbjct: 379 LLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQG 438

Query: 409 LAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFIS 468
            APKFFS   + G P IA+  +++F  +A+   S    +VF WLL I+G++  F W  I 
Sbjct: 439 YAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAIC 498

Query: 469 VSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNG 524
            SHIRF +A+K +G S  EL FK++     + YA   M++I++ Q + +  P      + 
Sbjct: 499 FSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDA 558

Query: 525 VNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPE 577
             F   Y+++ + +A+++ +++  +  +   + + +D++S R+  D E I  E+ E
Sbjct: 559 QAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEE 614

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  291 bits (746), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 179/569 (31%), Positives = 298/569 (52%), Gaps = 44/569 (7%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPN-GVN-GQDTFSMEEDIQDEDEGEVQNAE 83
           +VEA+Q +    ++S    +++EL    S  N G N G  + S+++ IQ           
Sbjct: 73  EVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQ----------- 121

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
                  RH                     L +AGP G LI Y  MGS+ Y + Q+ GEM
Sbjct: 122 ------PRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEM 175

Query: 144 A-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           A  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT +V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFR 261
            ++ IF+V++  +N+F  + Y E EF+    K++ + GF I    + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295

Query: 262 YWRNPGAWGPGIISKNKNEA--RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 319
           YW +PGA+       N   A  RF G  ++L+ AAF F G+E + IT  E +NPRK +P 
Sbjct: 296 YWHDPGAF-------NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIF 378
           A K++++RIL  ++ +++ +G LVPYN  +L  +T      SP++IA+ + G +V+PH  
Sbjct: 349 AAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFI 408

Query: 379 NAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAY 438
           NAVIL +++S ANS+ Y  +R+   LS+   APK FS   + G P IA+  +++F  +A+
Sbjct: 409 NAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAF 468

Query: 439 METSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGL 498
              S    +VF WLL I+G++  F W  I +SH+RF +A+K +G S  EL FK++     
Sbjct: 469 CAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWG 528

Query: 499 AYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVW 554
           + YA   M++I++ Q + +  P      +   F   Y+++ + +A+++ +++  +    W
Sbjct: 529 SAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHK---DW 585

Query: 555 KI----EDVDIDSDRR--DIEAIVWEEPE 577
           K+    + +D+DS R+  D E I  E+ E
Sbjct: 586 KLFIRADKIDLDSHRQIFDEELIKQEDEE 614

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  290 bits (743), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 188/554 (33%), Positives = 288/554 (51%), Gaps = 25/554 (4%)

Query: 53  RSFPNGVNGQDTFSMEEDIQDEDE--GEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           R F +     D   + +D+ D ++      +A +K  LK RH                  
Sbjct: 48  RKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              L  AGP G LI +   G++ Y +  ++GE++   P++  FT ++ RF+  +FG AN 
Sbjct: 108 GTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANN 167

Query: 171 YMYWFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFW 229
           + Y   W     LE+      + +W T       ++++FWV+I  +N+F VK YGE EF 
Sbjct: 168 FNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFV 227

Query: 230 VASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVS 288
            + IKV+ +IGF+I    + CG G  G     +Y+ +PGA+       +   ARF G  S
Sbjct: 228 FSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCS 282

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP 348
             + AAF+F G+EL+GI A E+A PRK+VP+A K+V +RI  FY+ SLL +GLLVPY D 
Sbjct: 283 VFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDE 342

Query: 349 KLTSATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
           +L  A+S   + SPF+IAI + G + LP + N VIL  ++S  NS +Y  SR L  L++ 
Sbjct: 343 RLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQ 402

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
              PK F    + G P   +  TS FG +A++  S   G+VFAWLL ++G++  F W  I
Sbjct: 403 NFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGI 462

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN- 526
              HIRF  AL  +G S DELPFKA      + +  F +V++ + Q + +  P     + 
Sbjct: 463 CFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSA 522

Query: 527 --FLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPKTL 581
             F  +Y+S  + LA +   +L  R  + +  +  +DID+ RR  D++ +  E  E K +
Sbjct: 523 EVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQM 582

Query: 582 ---------WDKFW 586
                    W  FW
Sbjct: 583 MSTRPWWYRWYSFW 596

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  288 bits (738), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/521 (33%), Positives = 278/521 (53%), Gaps = 17/521 (3%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           N    Q+    E D Q E  GE  +  ++R  KQRH                     L  
Sbjct: 21  NSDTQQNGEVYELDFQ-EAIGE-SSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKR 78

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GP   LI+++F GSL   V  SL EMA+F P+  SF+ ++ R++ PA G A G+ Y+  
Sbjct: 79  GGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLK 138

Query: 177 WAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVI 236
           +A+  A ELS +G ++Q+W   + +A +I +F V++ ++N   +K+YGE EFW A +K +
Sbjct: 139 YAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFL 198

Query: 237 AIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAF 295
            +I   +    + CG G +   +GFRYWR   A+ P ++       RFLGW + +I + +
Sbjct: 199 VLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPYLV--KGTTGRFLGWWACVIQSCY 255

Query: 296 TFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA-T 354
            + G+E +G+  GEA NP+KT+P A + V+FRI  FYI  +L +GL++  +D  L +A T
Sbjct: 256 AYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKT 315

Query: 355 SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFF 414
           S  S SPF+IA  N+G K LP   NA+++  I SAAN+ +YV SR  +GL+K  +APK F
Sbjct: 316 SDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIF 375

Query: 415 SKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRF 474
               + GVP+       +   L++M  S     +F +L +   V G   WL + +S+I +
Sbjct: 376 LAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGY 435

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISV 534
            +A  +  + RD +PF+    P  AY   FF+ +II   G+++F   F   +F+ +YI +
Sbjct: 436 ERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGI 495

Query: 535 FLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDI---EAIV 572
            +F+   + ++        WK        D R I   EAIV
Sbjct: 496 AVFIGNTLFWKF-------WKKSAATRPEDLRSIMVEEAIV 529

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  291 bits (746), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 186/574 (32%), Positives = 303/574 (52%), Gaps = 29/574 (5%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQ 90
           QT+H   +  L++E +  + P  +  +     D+ S+     DE EG+ +   +K+ +K 
Sbjct: 78  QTNHNSAAEDLENELTTCVSP-ATLSDYKKSGDSGSV-----DELEGKTKEEHLKKSIKP 131

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPV 149
           RH                     L +AGP G  I Y  MGS  Y + Q+ GEMA T+  +
Sbjct: 132 RHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNL 191

Query: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFW 209
              F  +    +SP  G A  ++YW  WA    LEL      I++WT  V    ++ IF+
Sbjct: 192 VGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFY 251

Query: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGA 268
            +I  +N+F  + Y E EF+    KV+ I GF I    + CG AG  G +G +YW +PGA
Sbjct: 252 FLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGA 311

Query: 269 WGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRI 328
           +       +K   RF G  ++L+ AAF F G+E + +TA E +NPRK +P A KK+++RI
Sbjct: 312 F-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRI 366

Query: 329 LTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTII 387
           +  ++GS++ +G LVP+N D  + S +S    SP++IAI + G +V+PH  NAVIL +++
Sbjct: 367 IIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSVL 426

Query: 388 SAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGK 447
           S  NS  Y  SR+L  LS+   APKFF+   + G P  A+   ++F  +A+   S+    
Sbjct: 427 SVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEED 486

Query: 448 VFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMV 507
           VF WLL I+G++  F W  I +SHIRF +A+  +G S  E+ FK++L    +YYA   M 
Sbjct: 487 VFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMF 546

Query: 508 VIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFR--CRFVWKIEDVDI 561
           ++++ Q +    P      +  +F  +Y+++ + +A ++ +    +    F+ + +D+D+
Sbjct: 547 LVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFI-RAKDIDL 605

Query: 562 DSDRR--DIEAIVWEEPEPKT------LWDKFWN 587
           D  R+  D + +  E+ E K       LW +  N
Sbjct: 606 DHHRQIFDEDVLRQEDEETKEKLRNGPLWKRILN 639

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 181/584 (30%), Positives = 294/584 (50%), Gaps = 34/584 (5%)

Query: 5   KQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDT 64
           KQ+SE+ E   + EP     +   + +T  ++   S  D+   E +     P  +  +  
Sbjct: 14  KQNSEIYEFTTF-EPKALDSYKSSSFRTFTKQ---SKDDDDIAEGHSSYQPPRNIFQRCI 69

Query: 65  FSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
            S +  +    +G      +KR LK RH                     L + GP+  +I
Sbjct: 70  DSFKPPL----DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALII 125

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
            +   G+        LGE+    PV  +F  +S RFL P+       +Y   W     LE
Sbjct: 126 GWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLE 185

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           +      IQ+W  ++    W++IF+ +I ++N+F  + +GE EF  +SIKVI IIGF+I 
Sbjct: 186 IIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIIL 245

Query: 245 CFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
           C  ++CG G     VG RYW +PG    G          F G +S L+ A+++  GTE+V
Sbjct: 246 CIVLICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMV 295

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFI 363
            + +GE  NPR+ +P AIK+  +RIL F++ SL  IG LVPY +P L   +S V+ SPF+
Sbjct: 296 CLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFV 352

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           IAI+    K LP I NAVIL +I+S  NS I+  SR L  ++   L PKFF    + G P
Sbjct: 353 IAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRP 412

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
              +   S+FG LA++  S+  G+VF WL+ I G+A    WL I++SHIRF  A+K +G 
Sbjct: 413 LTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGK 472

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-------TFNGVNFLAAYISVFL 536
           S DEL F + +    + Y+     +I++ Q + +  P       +     F  +Y+   +
Sbjct: 473 SLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALI 532

Query: 537 FLAIWILFELIFRCRF-----VWKIEDVDIDSDRRDIEAIVWEE 575
              +++  ++ +R +      +  ++ +D+++DR++I+  V ++
Sbjct: 533 MAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQ 576

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/519 (32%), Positives = 285/519 (54%), Gaps = 29/519 (5%)

Query: 69  EDIQDEDEG----EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           ED+ D ++       ++  + R+L  RH                     L   GP   +I
Sbjct: 52  EDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVI 111

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           ++  + +  +++  +LGE+A   PV   F V+  R + P+ G A    Y   WAV   LE
Sbjct: 112 AWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLE 171

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I++W  +V   AW+++F+V I   ++  VK +GE EF ++ +K++AI GF I 
Sbjct: 172 LVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTIL 231

Query: 245 CFCMVCGAG-VTGPVGFRYWRNPGAW---GPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
              ++CG G   G +G +YW +PG++    PG        ++F G  S  + AAF++ GT
Sbjct: 232 GIVLICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFSYSGT 283

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--S 358
           ELVG++A E+ANPR T+P+A K+  + I   Y+  L  IG LV ++DPKL SA+S V  +
Sbjct: 284 ELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVA 343

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SP +IAIEN G + LP + NA+IL  IIS ANS++Y  SR +  +++    P+ F+   
Sbjct: 344 ASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYID 403

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
             G P +A+  T +FG L+++  S    ++F WL  ++G++  F WL I++SHIRF +AL
Sbjct: 404 NRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRAL 463

Query: 479 KYRGISRDELPFKAKLMPGL--AYYATFFMVVIILIQGFTSFTPTFNG----VNFLAAYI 532
             +G S DELP+ +  M G+  ++Y    ++++++   +TS  P  +      +F   Y+
Sbjct: 464 NTQGYSLDELPYLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYL 521

Query: 533 SVFLFLAIWILFELIFRCRFVWKIED--VDIDSDRRDIE 569
           S+ +FL  ++  +L ++  + W I    +D+++ RR I+
Sbjct: 522 SLPIFLFCFVGHKL-YKRNWSWMIRSNKIDVNTGRRMID 559

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  290 bits (742), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 181/589 (30%), Positives = 297/589 (50%), Gaps = 16/589 (2%)

Query: 2   TTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNG 61
           ++ K+++  +   + +  AG  F    + +T+ ++ S S K          R+  +    
Sbjct: 9   SSGKKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRT 68

Query: 62  QDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           +       D++D  E    ++++K+ +K RH                     L   GP  
Sbjct: 69  KQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAA 128

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
            +I Y+ +  + Y + Q+ GEMA   P + ++F  +S  F+S +FG A  ++Y F W   
Sbjct: 129 LIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTV 188

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
             LEL      IQFW   +    +I IF+V +  ++ F VK YGE EF     K++ I G
Sbjct: 189 LPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAG 248

Query: 241 FLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQG 299
           F+I    + CG AG  G +G  YW NPGA+     + + +  RF      L+ A F+F G
Sbjct: 249 FIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGG 303

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVS 358
            EL  ++  E +NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S   
Sbjct: 304 MELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATH 363

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SP+++A    G K++PHI NAVIL +++S ANS++Y G R++  L++   APKF     
Sbjct: 364 ASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVD 423

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P  A+    +FG +A++  S+    VF WL  I G++  F W  I +SH+RF QA+
Sbjct: 424 REGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAM 483

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLF 537
           K +G S DEL +KA      + Y  FF +++ + Q + +  P  NG    A ++   +L 
Sbjct: 484 KVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLA 543

Query: 538 LAIWILF---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
             IW+ F    +++   F     ++ +D+D  RR  D E +  E+ E K
Sbjct: 544 FPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  290 bits (742), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 184/603 (30%), Positives = 300/603 (49%), Gaps = 56/603 (9%)

Query: 24  FHDVEASQTHHRRGSLSLKDEKSKELYPLRS---FPNGVN-------------------- 60
             D  +S+      + S ++ K+ E+Y L+S   F +G N                    
Sbjct: 39  LDDQPSSKDRKNLSTTSQQELKNGEIYSLQSNLDFQDGTNHFDNETQIDIVSPDYKNENI 98

Query: 61  --GQDTFSMEEDIQD-----------------EDEGEVQNAEVKRELKQRHXXXXXXXXX 101
              +D     +DI+D                 +DE  +   ++ ++L  RH         
Sbjct: 99  NVDEDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLATDMNKDLSVRHLLTLAVGGA 158

Query: 102 XXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L   GP   +I ++ + +  ++V  SLGE+A   PV   F+V+  +F+
Sbjct: 159 IGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAFPVVGGFSVYMDKFV 218

Query: 162 SPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVK 221
            P+F  A    Y   W V   LEL      I++W  ++   AW+SIF+V I   NM  VK
Sbjct: 219 DPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVSIFYVAIGLANMLDVK 278

Query: 222 YYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNE 280
            +GE EF ++ +K++AIIGF I    + CG G +   +G +YW +PGA+  G  S +K  
Sbjct: 279 SFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAF-VGTTSGSK-- 335

Query: 281 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
             F G  S  + AAF+F G E+  ++A E+ NPR+T+P+A K+  + I   Y+  L  +G
Sbjct: 336 --FKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVG 393

Query: 341 LLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGS 398
            LVPYNDP+L + +S V  ++SP +IAIEN     LP + NA+IL  I+S ANS++Y  S
Sbjct: 394 CLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACS 453

Query: 399 RVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGV 458
           R +  +SK +  PK F+K  + G P  A+     FG L+++  S    +VF WL  ++G+
Sbjct: 454 RCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGL 513

Query: 459 AGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSF 518
           +  F W+ I++ HIRF Q +  + IS DELPF ++     + Y    + ++++   +TS 
Sbjct: 514 STIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSL 573

Query: 519 TPT----FNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE-AIV 572
            P      N  +F   Y+S  + L  +I  ++ F+  R+      +D+ S R+ ++  +V
Sbjct: 574 FPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVV 633

Query: 573 WEE 575
            EE
Sbjct: 634 REE 636

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  287 bits (735), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 185/536 (34%), Positives = 285/536 (53%), Gaps = 37/536 (6%)

Query: 41  LKDEKSK------ELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXX 94
           +KD KS       E+ PL S  + V          D++D D+       + R L  RH  
Sbjct: 20  VKDPKSAPVVQNYEVTPLDSISDAVT---------DLEDHDK---IRESLNRSLSPRHIN 67

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154
                              L   GP    I+Y  MG + Y     LGEM+TF+P++ SF 
Sbjct: 68  MISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGSFC 127

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW---TYAVPLAAWISIFWVI 211
            ++++F   +F  A    YWF+ AV+ A +L+ +  V+ +W    +  P  A   +FWV 
Sbjct: 128 SYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFPYWAASLLFWVF 187

Query: 212 ITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWG 270
           +  +N+  V+ YGE E+W+A +KVIAI+ F I    +  G       +GF+YW    A  
Sbjct: 188 LLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWSYKEA-- 245

Query: 271 PGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330
           P +         F G+V+  +++AF++ GTE + +TAGEA NP +  PR +K V +RIL 
Sbjct: 246 PFV-------NGFKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFWRILI 298

Query: 331 FYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAA 390
           FY+ ++ FI + +PY+ P L+  T  V TSPF I  + +GTK      NAVILT+I+SA 
Sbjct: 299 FYVATMFFISMNIPYDYPNLS--TKSVMTSPFTIIFQMAGTKAAGSFMNAVILTSIVSAG 356

Query: 391 NSNIYVGSRVLFGLSKSKLA-PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVF 449
           N  ++ GSRVL+ +       PK  +KT +   PY+AV  T   G L +  +  G G ++
Sbjct: 357 NHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFIGAGTLW 416

Query: 450 AWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVI 509
            WL NI GV+   AWL I+V+ IRF + L  +G ++ EL FK    P   Y+   F+ +I
Sbjct: 417 TWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLI 475

Query: 510 ILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           IL+QG+++F P ++  +F + Y+ +F+F   W+++ +  R RFV K ED+D  +DR
Sbjct: 476 ILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV-KPEDMDFITDR 529

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  287 bits (734), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 173/526 (32%), Positives = 278/526 (52%), Gaps = 21/526 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + + L  RH                     L++ GP   ++ ++ + +  ++V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
           SLGE+A   P+   F V+  RF+ P+ G A    Y   W V   LEL      I++W   
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+V I   NM  VK +GE EF ++ +K++AIIGF I    +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 259 G-FRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
             F+YW NPGA+  G      N ++F G  S  + AAF+F G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + + + Y+  L  +G LVPYND +L +A + V  + SP +IAIEN G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 376 HIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGA 435
            + NA+IL  I+S ANS +Y  SR +  ++     PK  SK  K G P  A+  T IFG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S    +VF WL  ++G++  F W+ I+ S IRF +A++ +  S DELP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 496 PGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILFELIFRCR 551
              A+Y    + ++I+   +TS  P      +  +F  +++S+ + L  +   +L F   
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN 512

Query: 552 FVWKI--EDVDIDSDRR--DIEAIVWEEPEPKTLWD-----KFWNV 588
           +  +I  E++DIDS R+  D E +  E  E +   +     KFW+V
Sbjct: 513 WRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  288 bits (738), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 184/572 (32%), Positives = 299/572 (52%), Gaps = 32/572 (5%)

Query: 28  EASQTHHRRGSLSLKDEK---------SKELYPLRSFPNGVNGQ-DTFSMEED------I 71
           EA  T    G  SL DEK         S E+Y   +   G  G+ D+ S+  D      +
Sbjct: 27  EAPVTTGSTGGDSLGDEKNGFMGAGTTSYEMYNYSNSSTGAGGKGDSHSLTRDEAGSGVM 86

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
           +++ +G  Q   + ++L  RH                     L++ GP   +I ++ + +
Sbjct: 87  KEDVDGHPQ---MNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIIST 143

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQV 191
             ++V  SLGE+A   PV   F V+  RF+ P+FG A    Y   W V   LEL      
Sbjct: 144 CLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASIT 203

Query: 192 IQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251
           I++W   +   AW++IF+  I   NM  VK +GE EF ++ IK++AI+GF I    + CG
Sbjct: 204 IRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCG 263

Query: 252 AGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEA 310
            G  G     +YW +PGA+         +  +F G  S  + AAF++ G EL  ++A E+
Sbjct: 264 GGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAES 318

Query: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIEN 368
            NPR+T+P+A K+  + I   Y+  L  IG LVPYN+PKL + +S V  ++SP +IAIEN
Sbjct: 319 LNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIEN 378

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVF 428
            G + LP + NA+IL  I+S ANS +Y  SR +  +++ +  P+F  +  + G P  A  
Sbjct: 379 GGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATL 438

Query: 429 ATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDEL 488
            T  FG L+++  S    +VF WL  ++G++  FAW+ I++SHIRF QA+ ++GIS DEL
Sbjct: 439 LTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDEL 498

Query: 489 PFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILF 544
           P+ +      ++Y    + ++++   +TS  P      +  +F   Y+S  + +  ++  
Sbjct: 499 PYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGH 558

Query: 545 EL-IFRCRFVWKIEDVDIDSDRRDIEAIVWEE 575
           +L I + R +  + D+D+ SDR+ ++  V  E
Sbjct: 559 KLYIRKKRLLIDVADMDLVSDRKVVDVEVCRE 590

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  289 bits (739), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 168/508 (33%), Positives = 276/508 (54%), Gaps = 15/508 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L +AGP G LI Y  MGS+ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT +
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V++  +N+F  + Y E EF+    K++ + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G +YW +PGA+     +   +  RF G V++L+ AAF F G+E + IT  E ANPRK V
Sbjct: 292 IGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAV 346

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPH 376
           P A K++++RIL  ++ +++ +G LVPYN  +L  S+      SP++IA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
             NAVIL +++S ANS+ Y  +R+L  LS+   AP+ F+   K G P IA+  +++FG +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S    +VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL F+++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWK 555
             + YA   M++I++ Q + +  P   G     A+   +L + I I   + ++  +  WK
Sbjct: 527 WGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWK 586

Query: 556 I----EDVDIDSDRR--DIEAIVWEEPE 577
           +    + +D+ S R+  D E I  E+ E
Sbjct: 587 LFIRADKIDLISHRQIFDEELIKQEDEE 614

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  289 bits (739), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 183/597 (30%), Positives = 305/597 (51%), Gaps = 30/597 (5%)

Query: 5   KQDSEVE--EKHMYTEPAGTFFHDVEASQTHHRRGSLS------LKDEKSKELYPLRSFP 56
           +Q++E+E  E      P+     D E   T   R  L          E+  E+  +    
Sbjct: 24  EQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDSFKRADQDQEQEAEVAQMNDLT 83

Query: 57  NGVNGQDTFSMEEDIQDEDEGEV------QNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           + ++     + E + +DE   ++      ++  +K+ ++ RH                  
Sbjct: 84  SAISPSSRQAHELE-KDETTDKIAPHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGN 142

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAAN 169
              L +AGP G LI Y  MGS+ Y + Q+ GEMA  +  +T  +  +    +   FG A 
Sbjct: 143 GTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAV 202

Query: 170 GYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFW 229
            ++Y   W     LEL      I++WT +V    ++ IF+V++  +N+F  + Y E EF+
Sbjct: 203 AWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFF 262

Query: 230 VASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVS 288
               K++ + GF I    + V GAG  G +G +YW  PGA+  G+ + +    RF G V+
Sbjct: 263 FNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFN-GVHAID----RFKGVVA 317

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-D 347
           +L+ AAF F G+E + IT  E +NPRK +P A K++++RIL  ++ +++ +G LVPYN D
Sbjct: 318 TLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSD 377

Query: 348 PKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
             L S+      SP++IAI + G +V PH  NAVIL +++S ANS+ Y  +R+   LS+ 
Sbjct: 378 QLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQ 437

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
             APK FS   + G P IA+  +++F  +A+   S    +VF WLL I+G++  F W  I
Sbjct: 438 GYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAI 497

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNF 527
            +SHIRF +A+K +G S  EL FK++     + Y+   M++I++ Q + +  P   G   
Sbjct: 498 CLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLD 557

Query: 528 LAAYISVFLFLAIWILFELIFRC-RFVWKI----EDVDIDSDRR--DIEAIVWEEPE 577
             A+   +L + I I+  + ++     WK+    + +D+ S R+  D E I  E+ E
Sbjct: 558 AQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDE 614

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  285 bits (730), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 182/573 (31%), Positives = 287/573 (50%), Gaps = 29/573 (5%)

Query: 31  QTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQ 90
           Q     G  S+ D+++ ++Y L       + +   S+    Q  D        +K+ LK 
Sbjct: 5   QDLKDAGETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDH------NLKKGLKS 58

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-- 148
            H                     L   GP G  ISY  M ++ Y V  +L EM  F+P  
Sbjct: 59  AHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGL 118

Query: 149 -----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAA 203
                   S +    R++  + G A G+ Y + + +  A E +    V+ +WT AVP AA
Sbjct: 119 PDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAA 178

Query: 204 WISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           WI+IF  II  +N   V++YG  E    S+K+  I+G +I    +  G G     +GFR+
Sbjct: 179 WITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRF 238

Query: 263 WRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKTVPRAI 321
           W++PGAW   +   +    R    ++ +I A F F  G ELV +T+ EA + R+ + +A 
Sbjct: 239 WKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAA 296

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHI 377
           ++ V+R++ FY  S L  G++V  NDP L +A S       +SPF+I I+N+G KVLPHI
Sbjct: 297 RRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHI 356

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437
            N  IL++  S+ NS +Y  +R L  LS+   APK F++  + GVPY  V   + F  LA
Sbjct: 357 INVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLA 416

Query: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497
           Y+  S+    VF W  NI+ ++GF  W+   V+++RF +A+ +  +  D LPFK    P 
Sbjct: 417 YLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPY 475

Query: 498 LAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI- 556
             ++    + +I LI G+ SF   +N  +F+AAYI++ LFL +W+  +   R    W I 
Sbjct: 476 FTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMIS 534

Query: 557 -EDVDIDSDRRDIEAIVWE----EPEPKTLWDK 584
             ++D+ +  R+IE    E       P+ LW+K
Sbjct: 535 VSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  287 bits (734), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 177/526 (33%), Positives = 281/526 (53%), Gaps = 21/526 (3%)

Query: 59  VNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
           V+G+    M +  +   +    ++++ + L  RH                     L   G
Sbjct: 84  VDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGG 143

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
           P   LI++  + +  +++  SLGE+A+  PV   F V+  RF+ P+FG A    Y   WA
Sbjct: 144 PGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWA 203

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
           V   LEL+     I++W   +   AW++IF+V I   NM  VK +GE EF ++ +K++AI
Sbjct: 204 VLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAI 263

Query: 239 IGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAW---GPGIISKNKNEARFLGWVSSLINAA 294
            GF I    ++CG G  G     +YW +PGA+    PG        A+F G  S  + AA
Sbjct: 264 FGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPG--------AQFKGLCSVFVTAA 315

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT 354
           F++ GTELVG++A E+ NPR T+PRA K+  + I + Y+  L   G LVP NDP+L +  
Sbjct: 316 FSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGM 375

Query: 355 SY--VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPK 412
           S   V+ SP +IAIEN G + +P + NA+IL  IIS ANS++Y  SR +  +++    PK
Sbjct: 376 SSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPK 435

Query: 413 FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHI 472
            F+   + G P +A+ AT +FG L+++  S     +F WL  ++G++  F W  I++SHI
Sbjct: 436 VFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHI 495

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTS-FTPTFNG---VNFL 528
           RF +A+  +  S DELP+ +      ++Y    ++ ++++  +TS F P  +G    +F 
Sbjct: 496 RFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFF 555

Query: 529 AAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAI 571
             Y+S  +FL  +I  +L  R  R       +D+DS RR  DIE +
Sbjct: 556 EGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEEL 601

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  284 bits (726), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 174/505 (34%), Positives = 274/505 (54%), Gaps = 13/505 (2%)

Query: 53  RSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXX 110
           + F +     +  +++ ++ + ++  +  A+  +K  LK RH                  
Sbjct: 53  QDFKDSFKRVEPIAVDPNLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGS 112

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              L   GP   LI +   G++ Y++  +LGE+A   P++  FT ++ RF+  +FG AN 
Sbjct: 113 GTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANN 172

Query: 171 YMYWFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFW 229
           + Y   W V   LE+      + FW T       ++++FWV+I  +NMF VK YGE EF 
Sbjct: 173 FNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFV 232

Query: 230 VASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVS 288
            + IKVI ++GF+I    + CG G  G     +YW +PGA+     + +   A+F G  S
Sbjct: 233 FSFIKVITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCS 287

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP 348
             + +AF+F G+ELVG+ A E+  PRK+VP+A K+V +RI  FYI SLL IGLLVPYND 
Sbjct: 288 VFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDK 347

Query: 349 KLTSATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
            L  A+S   + SPF+IAI+  G K LP + N VIL  ++S  NS IY  SR +  L++ 
Sbjct: 348 NLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQ 407

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
           +  P+ F+   + G P + +  TS FG +A++  S   G VF WLL ++G++  F W  I
Sbjct: 408 RFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGI 467

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNG 524
            + HIRF +AL  +G   DEL FK+      +Y+  F +V++ + Q + +  P   + + 
Sbjct: 468 CICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSA 527

Query: 525 VNFLAAYISVFLFLAIWILFELIFR 549
             F  AY+S  L +A++I  ++  R
Sbjct: 528 EGFFEAYLSFPLVMAMYIGHKIYKR 552

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  285 bits (730), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 172/520 (33%), Positives = 271/520 (52%), Gaps = 16/520 (3%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
            D++D  E    ++++K+ +K RH                     L   GP   +I Y+ 
Sbjct: 76  SDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 129 MGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
           +  + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL  
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELIT 195

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               IQ+W   +    +I IF++ +  +++F VK YGE EF     K++ I GF+I    
Sbjct: 196 ASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVV 255

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG  G +G  YW NPGA+     + + + ARF      L+   F+F G EL  ++
Sbjct: 256 INCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALS 310

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIA 365
             E +NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S    SP+++A
Sbjct: 311 VQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLA 370

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
               G K++PHI NAVIL +++S ANS++Y G R++  LS+   APKF     + G P  
Sbjct: 371 ASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLR 430

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
           A+    IFG +A++  S+    VF WL  I G++  F W  I +SH+RF QA+K +G S 
Sbjct: 431 ALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFN-GVNFLAAYISVFLFLAIWILF 544
           DEL +KA      + Y  FF +++ + Q + +  P  N G   + ++   +L   IW+ F
Sbjct: 491 DELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTF 550

Query: 545 ---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPE 577
               +I+   F     ++ +D+D  RR  D E I  E+ E
Sbjct: 551 FFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQE 590

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  284 bits (727), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 193/541 (35%), Positives = 291/541 (53%), Gaps = 30/541 (5%)

Query: 62  QDTFSMEEDIQ-DEDEGEVQ-------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           +D+F   E ++ D +  E +          +K +LK RH                     
Sbjct: 55  RDSFKRVEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKA 114

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP   LI +  MG++ Y++  +LGE+A   P++  FT ++ RF+  +FG A  + Y
Sbjct: 115 LRTGGPASLLIGWGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNY 174

Query: 174 WFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
              W VT  LE+      + +W T       ++++FW++I  +NMF VK YGE EF  + 
Sbjct: 175 MLQWLVTLPLEIVSASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSI 234

Query: 233 IKVIAIIGFLIYCFCMVCGAG-VTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKVI IIGF+I    + CG G   G +G +Y+ +PGA+     + +   A+F G  S  +
Sbjct: 235 IKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFV 289

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+ELVG+ A E+ +PRK+VP+A K+V +RI  FYI SLL IGLLVPYND +L 
Sbjct: 290 TAAFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLI 349

Query: 352 SATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
            A+S   + SPF+IAI   G K LP + N VIL  ++S  NS I+  SR    L++    
Sbjct: 350 GASSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFL 409

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           P+ F+   + G P + +  TS  G +A++  S     VF WLL ++G++  F W  I + 
Sbjct: 410 PQIFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICIC 469

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGV----N 526
           HIRF +AL  +G S DEL FK+      +Y+  F +V++ + Q + +  P  NG      
Sbjct: 470 HIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPV-NGSPSAEG 528

Query: 527 FLAAYISVFLFLAIWILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPKT 580
           F  AY+S  L LA++I  ++  R    WK+     ++DIDS RR  D+E +  E  E K 
Sbjct: 529 FFEAYLSFPLVLAMYIGHKIYKRN---WKLLIPAGEMDIDSGRREVDLELLKQEIAEEKA 585

Query: 581 L 581
           +
Sbjct: 586 I 586

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  284 bits (727), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 188/594 (31%), Positives = 305/594 (51%), Gaps = 40/594 (6%)

Query: 3   TPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNG- 61
           TP  D E  EK  Y          V   +       L++ +  S +  P +    G NG 
Sbjct: 7   TPDDDVEDIEKSFY----------VSGKEQARVSTDLAVDEPISVQPEPRK----GWNGF 52

Query: 62  QDTFSMEE-DIQDEDEGEVQN-------AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
            DTF   E  + D +  E +        A + R LK RH                     
Sbjct: 53  VDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKA 112

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L  AGP G LI +    ++   +  SLGE+A   PV+  +  ++ RF+  ++G AN + Y
Sbjct: 113 LATAGPAGVLIGWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNY 172

Query: 174 WFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
                V   LE+      + +W T      A++++FWV+I ++N+F V+ +GE E   + 
Sbjct: 173 MMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSL 232

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           IKVI IIGF+I    ++ G G    V G +YW +PG +       N    +F G  S  +
Sbjct: 233 IKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFV 287

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            AAF+F G+EL+G+ A E   PRK++P+A K+V +RI  FYI SLL +GLLVP N+  L 
Sbjct: 288 TAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLL 347

Query: 352 SATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410
           +      + SPF+IA++    +VLP I N VILT +IS  NS++Y  SR +  L++    
Sbjct: 348 APQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFL 407

Query: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470
           PK F    + G P  A+  TS+FG L ++  +   G++F WLL I+G++ FF WL I+++
Sbjct: 408 PKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLA 467

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTS-FTPTFNGVN--- 526
           H+RF  ALK +G + +EL F +      + YA   + V+++ Q + + + P+ +G +   
Sbjct: 468 HMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKP 527

Query: 527 ----FLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEE 575
               F   Y+S  + + +++  ++  R  +F  K +++DID+ RR+++  +++E
Sbjct: 528 SPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKE 581

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 176/540 (32%), Positives = 283/540 (52%), Gaps = 18/540 (3%)

Query: 51  PLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           P R F +    +DT S   D++D +       ++++ ++ RH                  
Sbjct: 31  PFRRFVDSFRREDT-SRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAAN 169
              L   GP G LI YL +  ++Y +  + GEMA   P +  +F  +S  F+S  FG A 
Sbjct: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149

Query: 170 GYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFW 229
            +++   W   F LEL     VI++W  +V    ++ IF++ I  ++ F  + YGE EF 
Sbjct: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209

Query: 230 VASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGI-ISKNKNEARFLGWV 287
               KV+ I+GF+I    +  GA G TG +G RYWRNPG++  G  + K K  A  L   
Sbjct: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVL--- 266

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
              + A F+F G EL  ++  E  NP+  +P A KK V+RIL  Y+ +++ IG LVP++ 
Sbjct: 267 ---VTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDS 323

Query: 348 PKLT-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSK 406
            +L  S ++ V  SP+++AIE  G KVLPHI NAVIL ++IS  NS +Y   R+L  L++
Sbjct: 324 DRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQ 383

Query: 407 SKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLF 466
              APK      + G P I++   +IFG +A+   S    K+F WL  I G++  F W  
Sbjct: 384 QGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTS 443

Query: 467 ISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TF 522
           I +SH RF QA+K +G S + L ++A      + YA FF +++ + Q + +  P      
Sbjct: 444 ICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKV 503

Query: 523 NGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           + ++F   Y++  L+L +++ + +  R    +  ++ +D+D+ RR  D+E +  EE E K
Sbjct: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 187/568 (32%), Positives = 292/568 (51%), Gaps = 27/568 (4%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEV--QNAE 83
            +E+ + H +   +S  D    E      F +     DT  ++ ++ D ++  +   NA 
Sbjct: 16  QLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTANAP 75

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +KR LK RH                     L  AGP G LI +   G++ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW-TYAVPLA 202
           A   P+   FT ++ RF+  +FG A   +Y   W V   LE+      + +W T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++F+V+I A+N F VK YGE EF  + IKVI +IG++I    +VCG G  G     R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
            W NPGA+  G          F G  S  + AAF+F G+ELVG+ A E ANPRK++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RI  FYI +LL +GLLVPY   +L   +S   + SPF+I+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL  ++S  NS ++  SR +  L+     PK F    + G P + +  T +FG L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S   G+VF WLL ++G++  F W  I + HIR  +AL  +  +  EL F A      + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 501 YATFFMVVIILIQGFTSFTPTFN---GVNFLAAYISVFLFLAIWILFELIFRCRFVWKI- 556
           Y    +++I++ Q + +  P  +      F  AY+S  + +A +I  ++    +  WK+ 
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKI---WKKNWKLF 542

Query: 557 ---EDVDIDSDRR--DIEAIVWEEPEPK 579
              +++DID+ RR  DIEA+  E  E K
Sbjct: 543 IRAKNIDIDTGRRETDIEALKQEIAEEK 570

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  283 bits (723), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/493 (33%), Positives = 270/493 (54%), Gaps = 13/493 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            + ++L  RH                     L   GP   +I ++ + S  ++V  +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           +A   P+   F V+  RF+ P+F  A    Y   W V+  LEL      I++W   +   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM-VCGAGVTGPVGFR 261
           AW++IF+V I  +NM  VK++ E EF ++ IK++AI+GF I    + V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YW +PGA+       +   +RF G  S  + AAF++ G E+  ++A E+ NPRKT+P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIENSGTKVLPHIFN 379
           K+  + I   YI  L  IG+LVPYND +L S +S V  S SP +IAIEN+G K LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 380 AVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYM 439
           A+IL  ++S ANS +YV SRV+  ++ +   PK FSK  K G P  ++FAT   G L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 440 ETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S    +VF WL  I G++  F W+ I+++HIRF  ALK++  S DEL + ++     +
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 500 YYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVW 554
           +Y    +V++++   + S  P    + +   F   Y+S  + +A +I  ++  +  ++V 
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVI 551

Query: 555 KIEDVDIDSDRRD 567
            +E++DID  +++
Sbjct: 552 PLEEIDIDLGKKN 564

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  284 bits (726), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 274/511 (53%), Gaps = 18/511 (3%)

Query: 80  QNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSV 136
           QNA+   +K+ +K RH                     L + GP G+ I +L MG   Y V
Sbjct: 83  QNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCV 142

Query: 137 TQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
            Q+ GE+A  +  +   F  +    + PA G A  ++Y   W   F LEL      I+FW
Sbjct: 143 IQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFW 202

Query: 196 --TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA- 252
             + +V    +++IF+V+I  +N F  + Y E EF+  S KV+ +IGF I    +  GA 
Sbjct: 203 PGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAV 262

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G +G +G +YWR+PG+ G        +   F G V++L+NAAF+   +E V +TA E AN
Sbjct: 263 GTSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGT 371
           PRK++P A KK++++I   ++GS++ IG LVP +  +L  S  S +  SP++IA+   G 
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGV 377

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
            V+P   NAVIL +++S  NS  Y  SR+L  L++   APK F    + G P +A+  + 
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
           +FG + ++  S    +VF WLL I+G++  F W  I +SHIRF +AL  +G S DEL FK
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPTF----NGVNFLAAYISVFLFLAIWILFELI 547
           A+     +Y +   MV+ ++ Q + S  P      +  +F   Y+++ +FL  +  +++ 
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 548 FRC-RFVWKIEDVDIDSDRRDIEAIVWEEPE 577
            +  R   + + +D+ S RR  +A V ++ +
Sbjct: 558 NKDWRLFIRADQIDLVSHRRIFDADVLKQED 588

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  283 bits (724), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 171/536 (31%), Positives = 277/536 (51%), Gaps = 24/536 (4%)

Query: 63  DTFSMEEDIQDEDEGEVQ--------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
           D+F   E    ED+ +++        N  +K+ +K RH                     L
Sbjct: 57  DSFKRAESQHLEDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 116

Query: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMY 173
             AGP   +I Y+ +  + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++
Sbjct: 117 KLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIF 176

Query: 174 WFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASI 233
              W     LEL      I++W   +    +I IF+V +  ++ F VK YGE EF  +S 
Sbjct: 177 CIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSC 236

Query: 234 KVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLIN 292
           K++ I GF+I    + CG AGV G +G +YWR+PG++  G         RF G    L+ 
Sbjct: 237 KILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEG-----NGATRFKGICFILVT 291

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT- 351
           A F+F G EL  ++  E +NPRK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  
Sbjct: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMG 351

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           S ++    SP+++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   AP
Sbjct: 352 SGSAATHASPYVLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           KF     + G P  A+F   + G + ++  S    + F WL  I G++  F W  I +SH
Sbjct: 412 KFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSH 471

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN----- 526
           IRF +A+K +G S DE+ +KA      +YY  FF +++ + Q + + +P  NG       
Sbjct: 472 IRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQA 531

Query: 527 FLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           F  +Y++  L+L +++ + L  R   F+  ++ +D+D  RR  D E I  E  E K
Sbjct: 532 FFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENK 587

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  285 bits (729), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 183/584 (31%), Positives = 293/584 (50%), Gaps = 42/584 (7%)

Query: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFS---------------MEED 70
           D E   T   R    +   K  E +P     NG N +                      D
Sbjct: 87  DFEEHTTKPSRIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHD 146

Query: 71  IQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMG 130
            Q  D    ++ E+K+ +K RH                     L  AGP G +I +  MG
Sbjct: 147 AQINDNS--KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMG 204

Query: 131 SLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVG 189
           S  Y + Q++GE+A  +  +   F  +    +  AF  A  ++Y   W     LEL    
Sbjct: 205 SCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTAS 264

Query: 190 QVIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
             I++WT  V    ++ IF+++I  +N+      Y E EF   S K++ +IGF I    +
Sbjct: 265 MTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITV 324

Query: 249 VCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
           +CG AG  G +G +YW +PGA     +  + +  RF G +++L+NAAF F  +E +G+TA
Sbjct: 325 ICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTA 379

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIAI 366
            E +NPRK +P A KK+++RIL  ++ S+  +G LVPYN  +L  +T S V  SP+++AI
Sbjct: 380 SEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAI 439

Query: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIA 426
              G +V+PH  NAVIL +++S ANS  Y  SR+L  L++   APK +S   + G P + 
Sbjct: 440 STHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVG 499

Query: 427 VFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRD 486
           +   +IFG +A+  TS    +VF WLL I+G++  F W+ I +SHIRF +A+  +G S  
Sbjct: 500 MATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIG 559

Query: 487 ELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-------TFNGVNFLAAYISVFLFLA 539
           EL F++++    + YA   M +I++ Q + +  P         +  NF   Y+++ + LA
Sbjct: 560 ELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLA 619

Query: 540 IWILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPE 577
            +  +++    +  WK+    +++D+ S R   D E I  EE E
Sbjct: 620 FYFGYKI---WKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDE 660

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  283 bits (724), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 174/556 (31%), Positives = 286/556 (51%), Gaps = 35/556 (6%)

Query: 62  QDTFSMEEDIQDEDEGEVQ-------------NAEVKRELKQRHXXXXXXXXXXXXXXXX 108
           +D+F   + I     G  +              A +KR++K RH                
Sbjct: 67  KDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLATGIGTGLLV 126

Query: 109 XXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGA 167
                L   GP G  I Y  MGS  YS+ Q+ GE+A   P +T +F  +    + PA   
Sbjct: 127 GNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFLVDPAMCF 186

Query: 168 ANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFE 227
           A   +Y   W   F LE+      I++W  ++    W  IF+V+I  +NM     Y E +
Sbjct: 187 ATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGINMCGSAGYAEAD 246

Query: 228 FWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGW 286
           F+  + K++   GF I    + CG AG +  +G +YW +PGA+     + +   +RF   
Sbjct: 247 FFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAF-----NGDTGISRFKAI 301

Query: 287 VSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN 346
           VS+L+ AAF F  +E V +TA E ANPRK +P A K+V++RI+  Y+ S++ +G LVPYN
Sbjct: 302 VSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYN 361

Query: 347 DPKL-TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLS 405
            P+L  S +S V +SP++IA+ + G KV+P   NAVIL +++S  N + Y  SR+L  LS
Sbjct: 362 SPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLS 421

Query: 406 KSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWL 465
           +   APKFF    + G P  A+   ++ G + ++  S+    VF WL+ ++G++  F W 
Sbjct: 422 EIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWT 481

Query: 466 FISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT---- 521
            I +SH+RF +A++ +  S  EL F++++    +YY  F M+++ + Q + +  P     
Sbjct: 482 NICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTD 541

Query: 522 -FNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPE 577
             +  NF A Y+++ +FLA++  F++  +  R      ++D+ S R+  D E +  E+ E
Sbjct: 542 GADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEE 601

Query: 578 PK------TLWDKFWN 587
            K      ++W K  N
Sbjct: 602 YKIKMKHASIWVKLSN 617

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 175/589 (29%), Positives = 298/589 (50%), Gaps = 24/589 (4%)

Query: 8   SEVEEKHMYTEPAGTFFH------DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNG 61
           +EV +      P G+         ++ +S    +R S SLK++              +NG
Sbjct: 11  AEVRDGFRTATPQGSSLSGGNNSIEMNSSFITEKR-SNSLKEDNVMIQTTSSGATKNING 69

Query: 62  QDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
               +    +  ED   +  + + ++L  RH                     L   GP  
Sbjct: 70  TSNPNDSNMLSKED---IDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPAS 126

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTF 181
            +I ++ + +  ++V  SLGE+A   PV   F+V+  RF+ P+   +    Y   W V  
Sbjct: 127 LVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLL 186

Query: 182 ALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGF 241
            LEL      I++W   +   AW+SIF+ +I  +NM  VK +GE EF ++ IK++AIIGF
Sbjct: 187 PLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGF 246

Query: 242 LIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
            I    + CG G  G     +YW +PGA+       +   ++F G  S  + AAF++ G 
Sbjct: 247 TILGIVLSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGI 301

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--S 358
           E++ ++A E+ +PRKT+P A K+  + I   Y+  L  IG LVPY+DP+L + +S V  +
Sbjct: 302 EMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVA 361

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
           +SP +IAIEN G K LP + NA+IL  ++S ANS +Y  SR +  ++     PK   +  
Sbjct: 362 SSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRID 421

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           K G P  A   T  FG ++++  S    +VF WL  ++G++  F W+ I++SHIRF +A+
Sbjct: 422 KKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAM 481

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISV 534
             +G S +E+P+ +++    ++Y    + ++++   +TS  P      N   F   Y+S+
Sbjct: 482 DIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSL 541

Query: 535 FLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE-AIVWEEPEPKTL 581
            + LA ++  +  F+  R      ++D+DS +RDI+  ++ EE + + L
Sbjct: 542 PILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEEL 590

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/567 (31%), Positives = 288/567 (50%), Gaps = 40/567 (7%)

Query: 24  FHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE 83
           F   E  +T  RR   S K    +E                 + +E +QD ++ E    +
Sbjct: 50  FEYFEGDETKFRRFVNSFKKAPGRE-----------------NDQESLQDNNKHE----K 88

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ ++ RH                     L N GP G  + +  MG+  Y V Q+ GEM
Sbjct: 89  LKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQAAGEM 148

Query: 144 ATFIPVTSS-FTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA 202
           A   P  S  F  +    + P FG A  ++Y   W   F LEL      I++WT A+   
Sbjct: 149 AVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTAINPD 208

Query: 203 AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFR 261
            ++++F+++I  +N F  + Y E EF+  + KV+ IIGF I    +  GA G  G +G +
Sbjct: 209 IFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGYIGAK 268

Query: 262 YWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 321
           YWR PG++G      +     F G VS+L+NAAF+   +E V +TA E ANPRK+VP A 
Sbjct: 269 YWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVPSAA 323

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIAIENSGTKVLPHIFNA 380
           KK+++++   ++GS+  IG LVP N  +L  +T S V  SP++IA+ + G +V+PH  NA
Sbjct: 324 KKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHFINA 383

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           VIL +++S  NS  Y  SR+L  L++   AP  F    + G P +A+  +   G L ++ 
Sbjct: 384 VILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVA 443

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S     VF WLL I+G++  F W  I +SHIRF +AL  +G   D L FKA+     +Y
Sbjct: 444 ASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSY 503

Query: 501 YATFFMVVIILIQGFTSFTPTF----NGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI 556
           Y+   M++  + Q +T   P      N  +F   Y++  +F+A++  +++  +    W++
Sbjct: 504 YSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKN---WQL 560

Query: 557 ----EDVDIDSDRRDIEAIVWEEPEPK 579
               E +D+D  R+  +A V ++ + +
Sbjct: 561 FIPAEKIDLDLHRKIFDADVLKQEDAE 587

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  283 bits (725), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 275/528 (52%), Gaps = 21/528 (3%)

Query: 56  PNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRE--LKQRHXXXXXXXXXXXXXXXXXXXXP 113
           PN    ++ +++ +D++D       + ++ ++  +K RH                     
Sbjct: 124 PNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKS 183

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYM 172
           L  +GP G ++ Y  +  + Y V Q+ GEMA   P +   F  +   F+S  FG A  ++
Sbjct: 184 LHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWI 243

Query: 173 YWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           +  +W     LEL      +++WT ++    ++ IF++ +  ++   ++ Y E EF+  S
Sbjct: 244 FALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNS 303

Query: 233 IKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
            K++ I GF+I+   + CG AG  G +G +YW +PG +     + +   ARF      LI
Sbjct: 304 CKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLI 358

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NA F++ GTEL  ++  E  NPRK VP A K  V+R+   Y+ +++ IG  VPYN P L 
Sbjct: 359 NAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLM 418

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
              +    SP+++A +  G K++PH  NAVIL ++IS ANS ++ G R+L  L++   AP
Sbjct: 419 GNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAP 478

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           KF +   + G P +A+   S+FG +A+  TS    +VF WL  I G++  FAW  I +SH
Sbjct: 479 KFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSH 538

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-A 530
           IRF  A+KY G S DE+ +KA      +YY  FF +++++ Q + + +   +G    A +
Sbjct: 539 IRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAIS 598

Query: 531 YISVFLFLAIWILFELIFRCRFVWK--------IEDVDIDSDRRDIEA 570
           +   +L   IW+ F L   C  ++         ++D+D+D  RR  +A
Sbjct: 599 FFESYLAFVIWVFFYL---CYMIYNKDWTILIPLKDIDVDYQRRIYDA 643

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  283 bits (723), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 269/506 (53%), Gaps = 13/506 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ ++ RH                     L NAGP G +I Y  MGS+ Y + Q+
Sbjct: 126 DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQA 185

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
            GEMA  +  +   + V+    +   FG A  ++Y   W     LEL      I++WT +
Sbjct: 186 TGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS 245

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
           V    +++IF+ +I  +N+F  K Y E EF+    KV+ +IGF I    +  G AG  G 
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G  YW  PGA+       + +   F G   +L+ AAF + GTE + +TA E +NPR  +
Sbjct: 306 LGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGTKVLPH 376
           P A KKV++RI+  Y+ S+L IG LVP++  +L  S  S  S SP+++A    G +V+PH
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPH 420

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
             NAVIL +++S  NS  Y  SR+L  L++   APK+F    + G P  A+  +++FG +
Sbjct: 421 FINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVI 480

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S    +VF WLL I+G++  F W  I +SHIRF  A+K +G S  E+ + A+   
Sbjct: 481 AFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGV 540

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTFNG----VNFLAAYISVFLFLAIWILFELIFRC-R 551
             ++YA F M +I + Q + +  P  +G     NF   Y+++ + + +++ +++ ++   
Sbjct: 541 WGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWT 600

Query: 552 FVWKIEDVDIDSDRRDIEAIVWEEPE 577
            + K ED+D+ S R+  +  + +E +
Sbjct: 601 LLIKAEDIDLQSHRQIFDEDLLKEED 626

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 178/543 (32%), Positives = 282/543 (51%), Gaps = 30/543 (5%)

Query: 53  RSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
           RS P G +  +T S++ D+ D          ++R ++ RH                    
Sbjct: 57  RSVPQGGD-LETASVQTDLTD--------GRLRRSIRPRHVAMMSVCTGIGTGLLVANGK 107

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGY 171
            L   GP G +I Y  +  +AY + Q+ GEMA   P +  +F  +S  F+S  FG A+ +
Sbjct: 108 SLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVW 167

Query: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           +Y   W   F LEL      I++WT +V    +I+IF+V I  ++ F  + YGE EF   
Sbjct: 168 LYCLQWLTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFG 227

Query: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
             KV+ I GF+I    + CG AG +G +G RYW +PGA+  G        ++F G+   L
Sbjct: 228 LCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVG-----DPASKFKGFCYVL 282

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           +   F++ GTEL  +T  E ++PR+ +  A K+ ++RIL  Y+ +++ IG LVP+   +L
Sbjct: 283 VTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDEL 342

Query: 351 --TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSK 408
             +   S    SP+++A+   G KV+PHI NAVIL  ++S  NS +Y G RVL  L++  
Sbjct: 343 MGSGGKSATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQG 402

Query: 409 LAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFIS 468
            APKF +   + G P +A+ A S+ G LA++  S     VF WL  I G++  F W  I 
Sbjct: 403 YAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAIL 462

Query: 469 VSHIRFMQALKYRGISRDELPFKAKLMPGL--AYYATFFMVVIILIQGFTSFTPT-FNGV 525
           +SHIRF QA+KY G S  +L +K+  + GL  + Y   F +++ + Q + +  P   NG 
Sbjct: 463 LSHIRFRQAMKYHGYSLSQLGYKS--ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGK 520

Query: 526 NFLAAYISVFLFLAIWILFELIFRC-----RFVWKIEDVDIDSDR--RDIEAIVWEEPEP 578
             + ++   +L   +W +F L +         +  ++D+DI+  R   D E I  E+ E 
Sbjct: 521 TDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEH 580

Query: 579 KTL 581
           KT+
Sbjct: 581 KTM 583

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/545 (31%), Positives = 287/545 (52%), Gaps = 25/545 (4%)

Query: 60  NGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
           N + T S +  I  ED  E  N    ++L  RH                     L + GP
Sbjct: 72  NIETTPSEQFSIAKEDINENLN----KDLSIRHLITLAVGGSIGVGLFVNSGAALASGGP 127

Query: 120 VGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAV 179
              +I ++ + +  ++V  +LGE+A   PV   F V+  RF+ P+   A    Y   W V
Sbjct: 128 ASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLV 187

Query: 180 TFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAII 239
              LEL      I++W   +   AW++IF+ +I   NM  VK +GE EF ++ +K++AII
Sbjct: 188 LLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAII 247

Query: 240 GFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           GF I    + CG G  G      YW +PG++       +K   +F G  S  + AAF++ 
Sbjct: 248 GFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAAFSYS 302

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV- 357
           G EL  ++A E+ +PRKT+P+A K+  + +   Y+  L  IG LVP++DP+L + +S V 
Sbjct: 303 GIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVD 362

Query: 358 -STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416
            + SP +I+I+N+G K L  + NA+IL +I+S ANS +Y  SR +  ++     PK  S+
Sbjct: 363 AAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSR 422

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
             K G P  A+ +T  FG L+++  S    +VF WL  ++G++  F W+ I+ SHIRF  
Sbjct: 423 VDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRA 482

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG----VNFLAAYI 532
           A+K +  + DELP+ ++     ++Y    + ++++   +TS  P  +G     +F   Y+
Sbjct: 483 AMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYL 542

Query: 533 SVFLFLAIWILFELIFR-CRFVWKIEDVDIDSDRRDIEA------IVWEEP--EPKTLWD 583
           S+ + +A ++  +L  R  + + K+ED+D+++ R+ I+A      I+ E+     K+   
Sbjct: 543 SLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIK 602

Query: 584 KFWNV 588
           +FW+V
Sbjct: 603 RFWHV 607

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  282 bits (721), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 180/592 (30%), Positives = 305/592 (51%), Gaps = 28/592 (4%)

Query: 6   QDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTF 65
           Q+S   +K   T+ +       E +Q        ++ +       P   F +     D  
Sbjct: 44  QESSSAKKETKTDESNNAVLIQEKTQEE------TIHNSDGSSRSPFGKFVDSFKRVDEK 97

Query: 66  SMEEDIQDEDEGEV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGAL 123
               D++    GEV  +N+++K+ +K+RH                     L +AGP G +
Sbjct: 98  QTTSDLES-GLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLV 156

Query: 124 ISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           I Y  MGS  Y + Q+ GE+A  +  + S+F ++    +  AFG A  ++Y   W     
Sbjct: 157 IGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCP 216

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++WT +V    ++SIF+V+I  +N F  + Y E EF+  S KV+ + GF 
Sbjct: 217 LELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFF 276

Query: 243 IYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I    + CG AG +G +G +YW +PGA+     + N+    F G +++   AAF F  +E
Sbjct: 277 ILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASE 331

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTS 360
            + +TA E +NPRK +P+A K +++RIL  ++ S+  IG LVPYN P L  S +     S
Sbjct: 332 FISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS 391

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           P+++A+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   APK F+   K 
Sbjct: 392 PYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKR 451

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           G P +A+  +++F  +A+   S    +VF WLL I+G++  F W+ I +SH+RF +ALK 
Sbjct: 452 GRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKV 511

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFL 536
           +G S  E+ FK+++    + YA   +++ ++ Q + +  P      +  NF   Y+++ +
Sbjct: 512 QGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPI 571

Query: 537 FLAIWILFELIFRC-RFVWKIEDVDIDSDRR----DI--EAIVWEEPEPKTL 581
            L ++  +++  R  +F      +D+ S R+    DI  + +   E E K L
Sbjct: 572 LLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNL 623

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  281 bits (718), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 169/522 (32%), Positives = 271/522 (51%), Gaps = 16/522 (3%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
            D++D  +    ++++K+ +K RH                     L   GP   +I Y+ 
Sbjct: 76  SDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVL 135

Query: 129 MGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
           +  + Y + Q+ GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL  
Sbjct: 136 VSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELIT 195

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               IQFW   +    +I IF+V +  ++ F VK YGE EF     K++ I GF++    
Sbjct: 196 ASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVV 255

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG  G +G  YW  PGA+     + + + ARF      L+ A F+F G EL  ++
Sbjct: 256 INCGGAGNDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLS 310

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIA 365
             E  NPRK+ P A K+ ++RI+  Y+ +++ IG  VPYND +L  A  S    SP+++A
Sbjct: 311 VQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLA 370

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
               G +++PHI NAVIL +++S ANS++Y G R++  L++   APKF     + G P  
Sbjct: 371 ASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLR 430

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
           A+    + G +A++  S+    VF WL  I G++  F W  I +SH+RF QA+K +G S 
Sbjct: 431 ALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSL 490

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIWILF 544
           +EL +KA      + Y +FF +++ + Q + +  P  NG    A A+   +L   IW++F
Sbjct: 491 NELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIF 550

Query: 545 ---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
               +I+   F     ++ +D+D  RR  D E +  E+ E K
Sbjct: 551 YIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  280 bits (715), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 183/550 (33%), Positives = 291/550 (52%), Gaps = 22/550 (4%)

Query: 22  TFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQN 81
           TF  D     T +R G        SK+ +   +    V      S+ +D + +D   V  
Sbjct: 2   TFEIDSTEGSTKNRIGYTVNGPRNSKDDWKDGTDHKIVVVDTNNSVSDDPESQDA--VIR 59

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
             + R L  RH                     L   GP   LI+Y+ MG + Y    SLG
Sbjct: 60  ERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYLTMLSLG 119

Query: 142 EMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW---TYA 198
           EM+TF+P++ S+  +S++F+S ++  A     W+S AV+ A +L+ +  V+ +W   T+ 
Sbjct: 120 EMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYWKTNTHH 179

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP- 257
            P  A   +FW +I  +N+  VK YGE E+W+A +KV+A+I F I      CG       
Sbjct: 180 FPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGHNQQHEY 239

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +GF+ W +  A  P +         F G+V+  + ++F++ GTE V +T GEA NP +  
Sbjct: 240 IGFKNWSHGDA--PFV-------QGFKGFVTIFVTSSFSYGGTETVTLTGGEAKNPVRNT 290

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHI 377
           P+ IK V +RIL FY+ ++ F+G+ +PY+ P L   T  V TSPF I  + +GTK     
Sbjct: 291 PKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL--KTKSVLTSPFTIVFQMAGTKAAGSF 348

Query: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP--KFFSKTTKGGVPYIAVFATSIFGA 435
            NAVI+T+ ISA N  ++ GSR+L+ +      P  +FF+KT +   PY+AV  T   G 
Sbjct: 349 MNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVITTWAVGG 408

Query: 436 LAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLM 495
           L +  +  G G++F+WL NI GV+   +WL I+V  IRF + L+ +G    EL F+    
Sbjct: 409 LCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELKFRNWTY 467

Query: 496 PGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK 555
           P   ++   F+ +IIL+QG+++F P ++  +F + Y+ + +F A WI + +I R RF  K
Sbjct: 468 PYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWVIKRDRFK-K 525

Query: 556 IEDVDIDSDR 565
            +D+D  +D+
Sbjct: 526 AKDMDFITDK 535

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  280 bits (716), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 277/528 (52%), Gaps = 20/528 (3%)

Query: 52  LRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXX 109
           + +F +G        ++ ++   +   +  A   +KR LK RH                 
Sbjct: 50  IHNFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVG 109

Query: 110 XXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAAN 169
               L   GP   +++++  GS+ YSV Q++GE+   +PV+ S+  +  RF+ P+FG A 
Sbjct: 110 SGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALPVSGSYLSYVSRFIDPSFGFAI 169

Query: 170 GYMYWFSWAVTFALELSVVGQVIQFWTYAVPLA-AWISIFWVIITAMNMFPVKYYGEFEF 228
            Y Y     VT  LE+      + +W      A  ++++F+V +  +N   VK YGE EF
Sbjct: 170 AYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEF 229

Query: 229 WVASIKVIAIIGFLIYCFCMVCGAGV--TGPVGFRYWRNPGAWGPGIISKNKNEARFLGW 286
             + IKV+AI+GF+I    +VCG G   TG +G +YW NPG +  G          F G+
Sbjct: 230 VFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG----------FKGF 279

Query: 287 VSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN 346
            +  + +AF+F G+E+  + A E+ NPR+ +P+A K+V +RI  FY+ SL  IG LVPY 
Sbjct: 280 AAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYT 339

Query: 347 DPKL-TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLS 405
           +  L  S++   S SPF+IAI+ +G   LP + N VIL  ++S  N+ ++  SR    L+
Sbjct: 340 NKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLA 399

Query: 406 KSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWL 465
                PK F+   + G P   +  + +FG L+++ +S   G VF W+L ++G+  FF W 
Sbjct: 400 HYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWG 459

Query: 466 FISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TF 522
            I V H+RF Q L+ +G S DEL FKA+     + Y    + V++  Q + +  P   + 
Sbjct: 460 SICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSP 519

Query: 523 NGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
           +  +F   Y+S+ + +  ++  ++  R  R V   +++D+D+ RR+++
Sbjct: 520 SAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVD 567

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  280 bits (715), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 165/515 (32%), Positives = 272/515 (52%), Gaps = 17/515 (3%)

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
           +E++I    +  V   ++ + L +    RH                     L + GP   
Sbjct: 57  IEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASL 116

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           +I ++ + +  ++V  SLGE+A   PV   F V+  RF+ P+F  A    Y   W V   
Sbjct: 117 VIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLP 176

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++W   +   AW++IF+ +IT  NM  VK +GE EF ++ +K++AIIGF 
Sbjct: 177 LELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFT 236

Query: 243 IYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I    + CG G  G     +YW NPGA+       + +  +F G  S  + AAF++ G E
Sbjct: 237 ILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIE 291

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV--ST 359
           +  ++A E+ +PRKT+P+A K+  + I   Y+  L  +G LVPY+DP+L S TS V  + 
Sbjct: 292 MTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAA 351

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTK 419
           SP +IAIEN G K L  + NA+IL +IIS ANS +Y  SR +  ++     PK   K  K
Sbjct: 352 SPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDK 411

Query: 420 GGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALK 479
            G P  A   T  FG L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+ 
Sbjct: 412 RGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMI 471

Query: 480 YRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVF 535
            +  S DE+P+ ++     + Y    + ++++   +TS  P    + +  +F   Y+S+ 
Sbjct: 472 KQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLP 531

Query: 536 LFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIE 569
           + +  +I  +L F+   +V  +E++D+D+ R+ ++
Sbjct: 532 ILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 175/585 (29%), Positives = 296/585 (50%), Gaps = 19/585 (3%)

Query: 8   SEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSM 67
           S++E+   +       +++   S T      +    E+S+     R F +     ++  +
Sbjct: 9   SKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHR-FVDSFRRAESQRL 67

Query: 68  EED--IQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           EED  ++D  +    N  +K+ +K RH                     L+ AGP   +I 
Sbjct: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127

Query: 126 YLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           Y+ +  + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++   W     LE
Sbjct: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      +++W   +    +I IF+V +  ++ F VK YGE EF   S K++ + GF+I 
Sbjct: 188 LITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIIL 247

Query: 245 CFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
              + CG AGV G +G +YWR+PG++  G         RF G    L++A F+F G EL 
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELF 302

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPF 362
            ++  E +NPRK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  S  S    SP+
Sbjct: 303 VLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPY 362

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   APKF +   + G 
Sbjct: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P  A+   S+ G + ++  S    + F WL  I G++  F W  I +SHIRF +A+K +G
Sbjct: 423 PLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIW 541
            S DE+ +KA      +YY  FF +++ + Q + + +P  NG    A A+   +L   +W
Sbjct: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLW 542

Query: 542 ILF---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
           I      ++++  F +   ++ +D+D  RR  D E +  E+ E K
Sbjct: 543 IFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  279 bits (713), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 268/521 (51%), Gaps = 27/521 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G    + +KR LK RH                     +   GP+G +I +   GS    
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIG 129

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             ++    W++IF+ +I ++N+F V+ +GE EF  ++IK I + GF+I C  ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPD 249

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    K L
Sbjct: 298 KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKAL 356

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           P I NAVIL +++S  NS I+  SR L  ++   L P +F    + G P + + A S+FG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S    +VF WL+ I G+A    WL I++SHIRF  A+K +G S DEL F + +
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 476

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTPTFNGVN-------FLAAYISVFLFLAIWILFELI 547
               + Y+     +I++ Q + S  P     +       F   Y+   + L I+I+ ++ 
Sbjct: 477 GIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIY 536

Query: 548 FRCRF-----VWKIEDVDIDSDRRDIE-AIVWEEPEPKTLW 582
           ++C+      V  ++D+D+++DR+DI+  IV +E   K ++
Sbjct: 537 YKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMY 577

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  277 bits (708), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 276/503 (54%), Gaps = 27/503 (5%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
           +D D       +++R LK RH                     L   GP    ++Y  MG 
Sbjct: 42  EDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGG 101

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQV 191
           + Y     LGEM+T++P++ SF  ++++F S +F  A  + YWF+ AV+ A +++ +  V
Sbjct: 102 VVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLV 161

Query: 192 IQFW-TYAVPLAAWIS--IFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
           + +W T A     W +  +FW ++  +N+  V++YGE E+W+A +KVIAII F I    +
Sbjct: 162 MDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVV 221

Query: 249 VCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFL----GWVSSLINAAFTFQGTELV 303
             G       +GF+ W             N  EA F+    G+ S  ++A+F + GTE +
Sbjct: 222 NVGHNPQHEYIGFKNW-------------NHGEAPFVDGFKGFASLFVSASFAYGGTESI 268

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFI 363
            +T GEAANP +  P+ +K V +RIL FY+GS  FI + +PY+ P L + +  V TSPF 
Sbjct: 269 TLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS--VVTSPFT 326

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP-KFFSKTTKGGV 422
           +  + +GTK      NAVI+T++ISA N  ++ GSRV++ +      P K  S+T +  V
Sbjct: 327 LVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKV 386

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           PY++V  TS  G L +  +  G G V+ WL NI GV+   AWL I ++ IRF + L+ +G
Sbjct: 387 PYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG 446

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWI 542
            +  EL +K    P   Y+   F+  IIL+QG+++F P ++  NF + Y+ +F+F   +I
Sbjct: 447 KTH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFI 504

Query: 543 LFELIFRCRFVWKIEDVDIDSDR 565
           ++ L  R RFV K+ED+D  +DR
Sbjct: 505 IWWLYKRDRFV-KLEDMDFVTDR 526

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  278 bits (711), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 175/511 (34%), Positives = 268/511 (52%), Gaps = 21/511 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  ++K+ +  RH                     L N GP G  I Y  MGS  Y + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA 198
            GEMA ++  ++ +F  +    + PA G +  ++Y   W     LEL      I++WT A
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 199 VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++ IF+V+   +N+F  + Y E EF+  + KV+ I GF I    + CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 258 VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTV 317
           +G +YW +PGA     +   K    F G +++++ AAF F  TE + +TA E ANPR+ +
Sbjct: 255 LGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAI 309

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTKVLPH 376
           P A KK+V+R+L  ++  ++ +G LVPYN D  + S  S    SP++IAI + G KV+PH
Sbjct: 310 PSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPH 369

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
             NAVIL +++S  NS  Y  SR+L  LS+   AP + +   + G P  A+  + IFG +
Sbjct: 370 FINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLI 429

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S     VF WLL I+G++  F W+ I VSHIRF +AL  +G S  EL +K++   
Sbjct: 430 AFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGV 489

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWK- 555
             +YYAT  M  ++  Q + +  P   G + L A      +LA+ IL  L F  R VWK 
Sbjct: 490 VGSYYATVIMACVLTGQFWVAIAPV--GTDKLDANNFFENYLAMPILIALYFGYR-VWKR 546

Query: 556 -------IEDVDIDSDRR--DIEAIVWEEPE 577
                  +E +D+ S R+  D + +  E+ E
Sbjct: 547 DWKLYIPLEQIDLVSHRKVFDEDLLKQEDAE 577

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  277 bits (708), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 173/511 (33%), Positives = 262/511 (51%), Gaps = 25/511 (4%)

Query: 66  SMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           S E D+   D     N  VKR LK RH                     L   GP+  L+ 
Sbjct: 35  SEEPDVSKFDP----NTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLG 90

Query: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           +  +G +A++V +S+GE+ T  P    FT  ++RF   A  A  GY Y   +    A E 
Sbjct: 91  FSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEY 150

Query: 186 SVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           + +  ++QFW   VPL  +I IFW       +  V  +GE E+W++  K++ ++ + I+ 
Sbjct: 151 NTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFS 210

Query: 246 FCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
              + G     P  GF YW +PG+   G          F G     +  +  + GTE V 
Sbjct: 211 IIYISGGIKDRPAFGFHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVA 260

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFII 364
           + A E+ NP K VP A+++ ++R+L  YIG  +F G  VP++DP L SAT+ V  SP  I
Sbjct: 261 LAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISI 319

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           AI  +G     H+ NA IL T ISA N ++Y+GSR L  L+   LAPK  + T + GVP 
Sbjct: 320 AISRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPI 379

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
            A+   +  G ++ M  S G    +++++N++GV  F  W  IS +H+R  +A   +G S
Sbjct: 380 PAITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRS 439

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI----SVFLFLAI 540
            +ELP+KA L P    ++    V + LIQG+TSF P F+  NF+ AYI    ++ L++AI
Sbjct: 440 LEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAI 498

Query: 541 WILFELIFRCRFVWKIEDVDIDSDRR-DIEA 570
            +     FR   +  ++ VD+D  RR DI+A
Sbjct: 499 CVFKNHHFR---IVDLKSVDLDEGRRKDIDA 526

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  277 bits (709), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 167/543 (30%), Positives = 281/543 (51%), Gaps = 29/543 (5%)

Query: 63  DTFS--MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           D+F    ++D+   DE    ++++K+ +K RH                     L  AGP 
Sbjct: 41  DSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPG 100

Query: 121 GALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAV 179
           G +I Y    ++ Y + Q+ GE+   +  +T ++T +S   + PA G +  ++Y   W  
Sbjct: 101 GLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMT 160

Query: 180 TFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAII 239
            F L+L      I++WT   P   +++I + +I  +N+F  K Y E EF   + KV+ ++
Sbjct: 161 VFPLQLVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMV 219

Query: 240 GFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           GF+I    + CG AG  G +G RYW  PGA+  G          F G       AAF + 
Sbjct: 220 GFVILGIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYG 269

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVS 358
           G E++ +TA E  NPRK++P A KKV++RIL  Y+ + L +  LVPY+ P+LTS  S   
Sbjct: 270 GIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASR 329

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SPF+IAI + G  V+PHI NAVIL  ++S  NS++Y   R+L  LS+   APK F+   
Sbjct: 330 ASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVD 389

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P +        G LA++  S     VF+WLL I+G++  F W+ I +SH+RF  A+
Sbjct: 390 RQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAM 449

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG-----VNFLAAYIS 533
           K +G S  E+ +K++     +++A    + +++ Q + +  P  NG      +F  +Y++
Sbjct: 450 KAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLA 509

Query: 534 VFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR-------DIEAIVWEEP-EPKTLWDK 584
             + + I+  +++ ++  R      +VD++S R+         E + W+E     ++W K
Sbjct: 510 APVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVK 569

Query: 585 FWN 587
            ++
Sbjct: 570 IYH 572

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  277 bits (708), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 169/525 (32%), Positives = 273/525 (52%), Gaps = 20/525 (3%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
           E D++D     V    +K+ +K RH                     L  +GP   +I Y+
Sbjct: 37  ENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYV 96

Query: 128 FMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
            +  + Y + Q+ GEMA   P +  SF  ++  F+S  FG A  ++++  W   F LEL 
Sbjct: 97  LVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELI 156

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W   +    +I IF+  +  ++ F VK YGE EF   S KV+ + GF+I   
Sbjct: 157 TASLTVKYWNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSI 216

Query: 247 CMVCG-AGVTGPVGFRYWRNPGAW--GPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
            + CG AG  G +G +YW +PG++  GP I        RF G    L++A F++ G EL 
Sbjct: 217 VINCGGAGTDGYIGAKYWHDPGSFADGPPI-------TRFKGVCFILVSAYFSYGGAELF 269

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVS-TSPF 362
            ++  E  NPRK+ P A K+ ++RIL  Y+ +++ IG  VP+N  +L  A S  +  SP+
Sbjct: 270 SLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPY 329

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++A      KV+PH  NAVIL ++IS ANS +Y   R++  L++   APKF +   + G 
Sbjct: 330 VLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGR 389

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P   +   ++FG + ++  S+   +VF WL  I G++  F W  I +SHIRF QA+K+ G
Sbjct: 390 PLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNG 449

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIW 541
            S DE+ FKA      +YY   F +++ + Q + + +P  +G    A A+   +L   IW
Sbjct: 450 KSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIW 509

Query: 542 ILF---ELIFRCRF--VWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           ++F    +I++  F  +  +E +D+D  RR  D + I  E+ E K
Sbjct: 510 LVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK 554

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 265/524 (50%), Gaps = 28/524 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G    + +KR LK RH                     L   GP+  +I +   GS    
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+    PV  +F  +S RFL P+       +Y   W     LE+      IQ+W
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             ++    W++IF+ +I ++N+F  + +GE EF  ++IK I I GF+I C  ++CG G  
Sbjct: 175 NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPD 234

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              +G +YW +PGA   G          F G +S L+ A+++  GTE+  + +GE  +P 
Sbjct: 235 HEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP- 282

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    K L
Sbjct: 283 KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKAL 341

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           P I NAVIL +I+S  NS I+  SR L  ++   L P+FF    + G P   +   S+FG
Sbjct: 342 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFG 401

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S+   +VF WL+ I G+A    WL I++SHIRF  A+K +  + DEL F + +
Sbjct: 402 LLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAV 461

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTP-------TFNGVNFLAAYISVFLFLAIWILFELI 547
               + Y+    V+I++ Q + S  P       +     F  +Y+   + L I+ + ++ 
Sbjct: 462 GIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVY 521

Query: 548 FRCRF-----VWKIEDVDIDSDRR--DIEAIVWEEPEPKTLWDK 584
           +R  F     V  ++D+D+++ R+  DI+ I  E  E K    K
Sbjct: 522 YRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 175/585 (29%), Positives = 286/585 (48%), Gaps = 46/585 (7%)

Query: 28  EASQTHHRRGSLSLKDEKSKELYPLRSF---------PNGVNGQDTFSMEED-IQDEDEG 77
            + +   RR  +   + KSK+L    S              N ++ F    D  +   +G
Sbjct: 12  SSEELKERRSKVEFVEYKSKQLTSSSSHNSKSSHHDDDGQYNNRNIFQRCVDSFKPPLDG 71

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVT 137
               + +KR LK RH                     +   GP+G ++ +   GS      
Sbjct: 72  SFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTV 131

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY 197
             LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W  
Sbjct: 132 HGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNS 191

Query: 198 AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
           ++    W++IF+ +I ++N+F  + +GE EF  +++K I + GF+I C  ++CG G    
Sbjct: 192 SIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHE 251

Query: 258 -VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K 
Sbjct: 252 FIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KG 299

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPH 376
           +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IAI+    KVLP 
Sbjct: 300 LPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPS 358

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
           I NAVIL +++S  NS I+  SR L  ++   L P +F    + G P + + A S+FG L
Sbjct: 359 IVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLL 418

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S    +VF WL+ I G+A    WL I++SH+RF  A+K +G S DEL F + +  
Sbjct: 419 AFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGI 478

Query: 497 GLAYYATFFMVVIILIQGFTSFTPTFNGV-----------NFLAAYISVFLFLAIWILFE 545
             + Y+     +I++ Q + S  P                N+L A I VF+F    ++ +
Sbjct: 479 WGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIF----VIHK 534

Query: 546 LIFRCRF-----VWKIEDVDIDSDRR--DIEAIVWEEPEPKTLWD 583
           + +RC+      V +++D+D+++DR+  DIE +  E  E K   D
Sbjct: 535 IYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLD 579

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  277 bits (709), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 169/523 (32%), Positives = 264/523 (50%), Gaps = 28/523 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G    + +KR LK RH                     +   GP+G ++ +   GS    
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             ++    W++IF+VII ++N+F V+ +GE EF  ++IK I + GF+I C  ++ G G  
Sbjct: 190 NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPD 249

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    KVL
Sbjct: 298 KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVL 356

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           P I N VIL +++S  NS I+  SR L  ++   L P +F    + G P + + A S+FG
Sbjct: 357 PSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S   G VF WL+ I G+A    WL I+VSHIRF  A+K +G   DEL F + +
Sbjct: 417 LLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAV 476

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTPTFNGVN-------FLAAYISVFLFLAIWILFELI 547
               + Y+     +I+L Q + S  P     N       F   Y+   + L I+I  ++ 
Sbjct: 477 GIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIY 536

Query: 548 FRCRF-----VWKIEDVDIDSDRR--DIEAIVWEEPEPKTLWD 583
           ++C+      +  ++D+D+++DR+  DIE +  E  E K   D
Sbjct: 537 YKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLD 579

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  278 bits (710), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 196/587 (33%), Positives = 311/587 (52%), Gaps = 16/587 (2%)

Query: 4   PKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQD 63
           P   S+ +E+         +      S+T   +   +   E + +    R+F +     +
Sbjct: 6   PNITSDAQEEKGQAVIENCYLGQDVISETLSYKDLSNTTPESTIDKSRWRNFLDSFKRIE 65

Query: 64  TFSMEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
              ++ ++ D ++  ++ A   ++ +LK RH                     L  AGP G
Sbjct: 66  VEEVDPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAG 125

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTF 181
            LI +   G++ +++  +LGE+A   PV+  F  ++ RF+  +FG AN + Y F W V  
Sbjct: 126 ILIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVAL 185

Query: 182 ALELSVVGQVIQFWTYAVPLA-AWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
            LE+      + +W   V     ++++FW+++  +NMF V+ YGE EF  + IKVIA+IG
Sbjct: 186 PLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIG 245

Query: 241 FLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQG 299
           F+I    +VCG G  G     RYW +PGA+     + +    RF G+ S  + AAF+F G
Sbjct: 246 FIILGIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAG 300

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VS 358
           +ELVGI + E+ NPRK+VP+A K+V +RIL FYI  LL +GLLVPY DP+L  ++    S
Sbjct: 301 SELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDAS 360

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SPF+IAI   G   LP + N VIL +++S  NS+IY  SR L  LS+    PK  +   
Sbjct: 361 ASPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYID 420

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P + +   S FG +A++  S    ++F WLL I+G++ F  W  I   HIRF  AL
Sbjct: 421 RKGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSAL 480

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYISVF 535
           K  G S DELPFK+ +    +Y+     V++++ Q + +  P   + N  +F +AY++  
Sbjct: 481 KVNGRSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAP 540

Query: 536 LFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           + LA +I  +L  R  + +  ++D+DID+ RR  DI  +  E  E K
Sbjct: 541 IVLAFYIAHKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEK 587

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  278 bits (710), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 272/512 (53%), Gaps = 15/512 (2%)

Query: 73  DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSL 132
           D+ + ++  + + ++L  RH                     L   GP   +I +  + + 
Sbjct: 75  DDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTA 134

Query: 133 AYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVI 192
            ++V  SLGE+A   PV   F V+  RF+ P+F  +    Y   W V   LEL      I
Sbjct: 135 LFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTI 194

Query: 193 QFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           ++W   +   AW++IF+ +I   N+  VK +GE EF ++ +K++AIIGF I    + CG 
Sbjct: 195 RYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGG 254

Query: 253 GVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           G  G     +YW +PGA+       +    +F G  S  + AAF++ G E++ ++A E+ 
Sbjct: 255 GPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQ 309

Query: 312 NPRKTVPRAIKKVVFRILTF-YIGSLLFIGLLVPYNDPKLTSATSYV--STSPFIIAIEN 368
           NPRKT+P A K+  F I+TF YI  L  +G LV YND +L + +S V  + SP +IAIEN
Sbjct: 310 NPRKTIPTAAKRT-FWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIEN 368

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVF 428
            G K LP + NA+IL  I+S ANS +Y  SR +  ++     PK  S   K G P  A+F
Sbjct: 369 GGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIF 428

Query: 429 ATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDEL 488
            T  FG L+++  S    +VF WL  ++G++  F W+ I+++HIRF QA+  +  S DE+
Sbjct: 429 TTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEM 488

Query: 489 PFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLFLAIWILF 544
           P+ ++     +YY T  + ++++   +TS  P      +   F   Y+S  + +A +I  
Sbjct: 489 PYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGH 548

Query: 545 ELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEE 575
           +L F+  R +  +E++D+ + R++++  + +E
Sbjct: 549 KLYFKNWRIMTPLEEIDLLTGRKEVDIDILKE 580

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  278 bits (711), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 187/588 (31%), Positives = 303/588 (51%), Gaps = 24/588 (4%)

Query: 11  EEKHMYTEPAGTFFHDVE--ASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSME 68
           + K+ Y     T  ++VE  ++  + + GS S+ +  +K+   LR F +     +     
Sbjct: 28  DGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKKKSNLRRFVDSFKRAEHMIPA 87

Query: 69  EDIQDE---DEGEVQNAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           +D  +E    E E + A V+  LKQ    RH                     L  AGP G
Sbjct: 88  DDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAG 147

Query: 122 ALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
            +  Y  MG+  Y + QS GEMA  +  +   F  +    + P F         F+    
Sbjct: 148 LVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDC 207

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
            +  +       ++WT  V    ++ IF+V+I  +N+F  + Y E EF+    KV+ + G
Sbjct: 208 LSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAG 267

Query: 241 FLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQG 299
           F I    + V GAG  G +G  YWRNPGA+       +K    F G V++L+ AAF F G
Sbjct: 268 FFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGG 322

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVS 358
           TE + +TA E +NPRK +P A KKV++RI+  Y+ S++ IG LVP+  P+L  S ++  +
Sbjct: 323 TEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATA 382

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SP++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  LSK   APK+F    
Sbjct: 383 ASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVD 442

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P  A+  +++FG +A+  TS    +VF WLL I+G++  F W+ I +SHIRF  A+
Sbjct: 443 REGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAM 502

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISV 534
           K +G S  E+ FKA+     +YY+ F M++ ++ Q + +  P      +  NF   Y+++
Sbjct: 503 KAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAM 562

Query: 535 FLFLAIWILFELIFRCRFVW-KIEDVDIDSDRR--DIEAIVWEEPEPK 579
            + +  +  +++  +   ++ K ED+D+ S R+  D E +  E+ E K
Sbjct: 563 PILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYELK 610

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 170/536 (31%), Positives = 275/536 (51%), Gaps = 24/536 (4%)

Query: 63  DTFSMEEDIQDEDEGEVQ--------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
           D+F   E  + ED+ +++        N  +K+ +K RH                     L
Sbjct: 57  DSFRRAESQRLEDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGL 116

Query: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMY 173
             AGP   +I Y+ +  + Y + Q+ GEM    P +  +F  ++  F+S +FG A  +++
Sbjct: 117 KLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLF 176

Query: 174 WFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASI 233
              W     LEL      I++W   +    +I+IF+V +  ++ F VK YGE EF   S 
Sbjct: 177 CIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSC 236

Query: 234 KVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLIN 292
           K++ I GF+I    + CG AGV G +G  YWRNPG++  G      +  RF G    L+ 
Sbjct: 237 KILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFILVT 291

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLT 351
           A F+F G EL  ++  E ANPRK+ P A K+ ++RIL  Y+ +++ IG  VP+ ND  + 
Sbjct: 292 AYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMG 351

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           S +S    SP+++A    G KV+PHI NAVIL ++IS ANS +Y   R++  L++   AP
Sbjct: 352 SGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAP 411

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           KF +   + G P  A+   S  G + ++  S+   + F WL  I G++  F W  I +SH
Sbjct: 412 KFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSH 471

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-FNGVNFLAA 530
           IRF +A+K +G S DE+ +K+      +YY   F +++ + Q + + +P   +G   + +
Sbjct: 472 IRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVES 531

Query: 531 YISVFLFLAIWILFEL---IFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
           +   +L   +WI   L   I+   F     ++ +D+D  RR  D E +  E+ E K
Sbjct: 532 FFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 161/531 (30%), Positives = 275/531 (51%), Gaps = 17/531 (3%)

Query: 62  QDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           Q     + D++++ +  V + ++K+ +K RH                     L  AGP  
Sbjct: 53  QPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAP 112

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180
            +I+Y  +  + Y + Q+ GEMA   P +  +F  +   F+S  FG A  ++++  W   
Sbjct: 113 LVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTV 172

Query: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240
             LEL      +Q+W  ++    ++ IF+V +  ++ F VK YGE EF     K++ + G
Sbjct: 173 LPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGG 232

Query: 241 FLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQG 299
           F+I+   + V GAG +G +G +YW +PGA+     + + N  RF G    L+ A F++ G
Sbjct: 233 FIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGG 287

Query: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVS 358
            EL  ++  E  NPR++ P A K+ ++RI+  Y+ +++ +G  VP N  +L  S  S   
Sbjct: 288 MELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTH 347

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTT 418
            SP+++A    G KV+PHI NAVIL ++IS  NS +Y   R++  L++   APKF     
Sbjct: 348 ASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVD 407

Query: 419 KGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQAL 478
           + G P  A+   S+FG + ++  S+   +VF WL  I G+A  F W  I +SHIRF QA+
Sbjct: 408 REGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAM 467

Query: 479 KYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISV 534
           K +  S DE+ +K+      +Y+  FF +++ + Q + +  P      +   F  +Y++ 
Sbjct: 468 KLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAF 527

Query: 535 FLFLAIWILFELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPKTL 581
            +F A +  + +I++  F     +E VD+D  RR  D E +  E+ E K +
Sbjct: 528 PIFFAFYFGY-MIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEM 577

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  276 bits (706), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 165/532 (31%), Positives = 281/532 (52%), Gaps = 20/532 (3%)

Query: 63  DTFSMEEDIQDEDEGE---VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
           D+F   +D  D ++ E     + E K+ +K RH                     L+ AGP
Sbjct: 69  DSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128

Query: 120 VGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
              +I+Y  +  + Y + Q+ GEMA   P +  SF  ++  F+S  FG A  +++   W 
Sbjct: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++W  ++    ++ IF+V +  ++ F V+ YGE EF   + K++ I
Sbjct: 189 TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMI 248

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
            GF+I+   + CG AG  G +G +YW +PGA+     + +   +RF G   +L+NA F++
Sbjct: 249 GGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSY 303

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT--S 355
            G EL  ++  +  NPRK+ P A K  V+RI+  Y+ +++ IG +VP+N  +L  A+  +
Sbjct: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN 363

Query: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFS 415
            +  SP+++A    G KV+PHI NAVIL  +IS ANS++Y G R+L  L++   AP+F S
Sbjct: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423

Query: 416 KTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFM 475
              + G P  A+  +++ G + +  TS    +VF WL  I+G++  F W  I  SHIRF 
Sbjct: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISV 534
           +A+K +  S D L +KA      +Y+   F +++   Q + + +P  +G    A ++ + 
Sbjct: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS 543

Query: 535 FLFLAIWILFELIFRCRF-----VWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           +L + IW++F   + C +     +  +  VD+D+ R+  D E +  E+ E K
Sbjct: 544 YLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  276 bits (706), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/515 (32%), Positives = 277/515 (53%), Gaps = 20/515 (3%)

Query: 75  DEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAY 134
           DE  ++  E+KR++ QRH                     L +AGP G LI Y  MG+  Y
Sbjct: 108 DEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVY 167

Query: 135 SVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQ 193
            V Q+ GE+  T+  +   F  +    ++P+F  + G++Y   W     LEL      I+
Sbjct: 168 CVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIK 227

Query: 194 FWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-A 252
           +WT  V    ++ IF+++I  +N F  K Y E +F+   +K+  I GF I    + CG A
Sbjct: 228 YWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGA 287

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G  G +G +YW NPGA+        K    F G  S  + +AF F G+E V ++A E AN
Sbjct: 288 GHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQAN 342

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTK 372
           PRK++P A K +++RI+  Y+ S+  +G LVP++ P+L  ++    TSP+++AI   G K
Sbjct: 343 PRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVK 402

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           V+PH+ NAVIL  ++S +NS  +  SR+L  LS+   APK+F    + G P  A+  +++
Sbjct: 403 VVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISAL 462

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           FG + +  TS     VF+WLL I+G++  F +  I VSHIR   A+K +G S  EL F++
Sbjct: 463 FGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRS 522

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFTPTFNGV--------NFLAAYISVFLFLAIWILF 544
           ++    ++YA   +V+ ++ + + +  P   G         N+LAA I +  +   ++++
Sbjct: 523 QVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFG-YMIW 581

Query: 545 ELIFRCRFVWKIEDVDIDSDRR--DIEAIVWEEPE 577
           +  FR  F+ + +D+D+D  R+  D + I  E+ E
Sbjct: 582 KKDFRI-FI-RSKDIDLDFKRQVFDEDLIKQEDEE 614

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  276 bits (706), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 167/523 (31%), Positives = 279/523 (53%), Gaps = 16/523 (3%)

Query: 66  SMEEDIQDEDEGEV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGAL 123
           ++   I + ++G    ++ ++K+ +K RH                     L+ AGP   +
Sbjct: 100 AISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALV 159

Query: 124 ISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           I Y  MG+  Y + Q+ GE+A  +  +   F  +    + PA G +  ++Y   W     
Sbjct: 160 IGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCP 219

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL      I++WT  V    ++ IF+V+I A+N F  + Y E EF+    KV+ + GF 
Sbjct: 220 LELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFF 279

Query: 243 IYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I    +  G AG  G +G +YW +PGA+     + +K+  RF G + + + AAF F  TE
Sbjct: 280 ILGIIITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATE 334

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTS 360
            + +TA E +NPRK +P A KKV++RI+  ++ S+  IG LVPYN D  L S  S +  S
Sbjct: 335 FIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKAS 394

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           P++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   APK+F    + 
Sbjct: 395 PYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDRE 454

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           G P+ A+  +++FG +A+  TS    +VF+WLL I+G++  F W+ I VSHIRF +A++ 
Sbjct: 455 GRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQV 514

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           +G S  E+ + ++     + YA   + + ++ Q + +  P   G      +   +L + I
Sbjct: 515 QGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPI 574

Query: 541 WILFELIFRC-RFVWKI----EDVDIDSDRRDI-EAIVWEEPE 577
            I F   +R  +  WK+    +D+D+D+ R+   E I+ +E E
Sbjct: 575 LIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDE 617

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  273 bits (699), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 170/489 (34%), Positives = 255/489 (52%), Gaps = 14/489 (2%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  VKR LK RH                     L+  GP+  L+ +  +G +A++V +S+
Sbjct: 41  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESI 100

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVP 200
           GEM T  P  S F+  S+RF S A  A +GY Y   +    A E + +  ++QFW   VP
Sbjct: 101 GEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 160

Query: 201 LAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV-G 259
           L  +I IF V      M  V  +GEFE+W+A  K+I +I + I+    + G     P  G
Sbjct: 161 LYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFG 220

Query: 260 FRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPR 319
           F YW NPGA   G          F G     +  +  + GTE V + A E+ NP K VP 
Sbjct: 221 FHYWNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPI 270

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFN 379
           AIK+  +RI+  Y+G  +F G  VPYND  L + T  +  SP  IAI  +G +   H+ N
Sbjct: 271 AIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALK-SPIAIAITRAGWEGGVHLVN 329

Query: 380 AVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYM 439
           A IL T +SA N ++Y+GSR L  L+   LAPKF   T K GVP  A+   +  G ++ M
Sbjct: 330 AFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLM 389

Query: 440 ETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S G    +++++N++GV  F  W  IS++H+RF +A   +G S  ELP+K+ L P   
Sbjct: 390 NVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGP 449

Query: 500 YYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRF-VWKIED 558
            ++    + + LIQG+T+F P F+  +F+ AYI +   + ++I+  L+    F +  +  
Sbjct: 450 IFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIVISLVKIGGFKLVDLRT 508

Query: 559 VDIDSDRRD 567
           VD++  RR+
Sbjct: 509 VDLEEGRRE 517

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  275 bits (702), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 185/537 (34%), Positives = 283/537 (52%), Gaps = 23/537 (4%)

Query: 55  FPNGVNGQDTFSMEEDIQDEDEGEV--QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
           F +     +T  ++  +   ++  +   NA +KR LK RH                    
Sbjct: 45  FKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGK 104

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
            L  AGP G LI +   G++ Y +  ++GE+A   PV   +T ++ RF+  +FG A   +
Sbjct: 105 SLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTV 164

Query: 173 YWFSWAVTFALELSVVGQVIQFW-TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           Y   W +T  LE+      + +W T A    A++++F+V+I  +N+F VK YGE EF  +
Sbjct: 165 YAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFIFS 224

Query: 232 SIKVIAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
            IKVIA+IGF+I    +VCG G  G     R W NPGA+  G          F G  S  
Sbjct: 225 FIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVF 274

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           + AAF+F G+ELVG+ A E ANPRK++P A K+V +RI  FYI +LL +GLLVPY   +L
Sbjct: 275 VTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL 334

Query: 351 TSATSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
              +S   + SPF+I+I+N+G K LP + N VIL  ++S  N  ++  SR +  L+    
Sbjct: 335 IGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGS 394

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
            PK F    + G P + +  T +FG L+++  S   G+VF WLL ++G++  F W  I +
Sbjct: 395 LPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILL 454

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA 529
            HIR  +AL  +  +  EL F A      + Y+   +++I++ Q + +  P   G    A
Sbjct: 455 CHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFP-IGGKPSAA 513

Query: 530 AYISVFLFLAIWILFELIFRC-RFVWKI----EDVDIDSDRR--DIEAIVWEEPEPK 579
           A+   +L   I+I+F +  +  +  WK+     D+DIDS RR  DIEA+  E  E K
Sbjct: 514 AFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEK 570

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 172/509 (33%), Positives = 278/509 (54%), Gaps = 28/509 (5%)

Query: 66  SMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           S   D   + E  ++  ++ R LK R                      L   GP    ++
Sbjct: 33  SFTTDENYDPEANIRE-DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMN 91

Query: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           Y  MG + Y    +LGEM+T++P++ SF V++++F S +F  A  + YWF+ AV+ A +L
Sbjct: 92  YTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDL 151

Query: 186 SVVGQVIQFWT---YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           + +  V+ +W    +  P  A   IFW ++  +N+  V++YGE E+W+A +K+IAII F 
Sbjct: 152 TALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFF 211

Query: 243 IYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFL----GWVSSLINAAFTF 297
           I    +  G       +GF+ W              + EA F+    G+ S  ++A+F +
Sbjct: 212 ILSIVVNVGKNPQHEYIGFKNW-------------TRGEAPFVDGIKGFASLFVSASFAY 258

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357
            GTE + +T GEA NP +  P+ +K V +RIL FY+GS  FI + +PY+ P L S +  +
Sbjct: 259 GGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--I 316

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP-KFFSK 416
            TSPF +  + +GTK      NAVI+T++ISA N  ++ GSR+++ +      P +  S+
Sbjct: 317 VTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSR 376

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
           T +  VPY++V  T+  GAL +  +  G G ++ WL NI GV+   AWL I ++ IRF +
Sbjct: 377 TNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRK 436

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFL 536
            L+ +G +  EL +K    P   Y+   F+  IILIQG+++F P +N  NF + Y+ +F+
Sbjct: 437 GLEKQGKTH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFV 494

Query: 537 FLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           F   +I++ L+ R RFV K ED+D  +DR
Sbjct: 495 FPVCFIIWWLVKRDRFV-KYEDMDFTTDR 522

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  273 bits (697), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 283/525 (53%), Gaps = 22/525 (4%)

Query: 45  KSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXX 104
           K K +Y   S   GV+  ++    E    + E  ++  ++KR+L  RH            
Sbjct: 33  KVKAVYSTHSVLEGVHSLESI---ESASFDPESNIRE-DLKRDLSPRHINMISIAGVIGT 88

Query: 105 XXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPA 164
                    L   GP    ++Y   G + Y     LGEM+T++P++ SF  ++++F S +
Sbjct: 89  GLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSES 148

Query: 165 FGAANGYMYWFSWAVTFALELSVVGQVIQFW---TYAVPLAAWISIFWVIITAMNMFPVK 221
           F  A  + YWF+ AV+ A +L+ +  V+ +W    +  P  A   +FWV +  +N+  V+
Sbjct: 149 FACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVR 208

Query: 222 YYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNE 280
            YGE E+W+A +KVIAII F I    +  G       +GF  W +  A  P +       
Sbjct: 209 LYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYIGFHNWNHGDA--PFV------- 259

Query: 281 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIG 340
             F G+ S  ++A+F + GTE + +T GEA NP +  P+ IK V +RIL FY+ S  FI 
Sbjct: 260 NGFKGFASLFVSASFAYGGTESITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIA 319

Query: 341 LLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRV 400
           + VPY+ P L  AT  V TSPF I  + +G+K      NAVI+T++ISA N  ++ GSRV
Sbjct: 320 MNVPYDYPGL--ATKSVMTSPFTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRV 377

Query: 401 LFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAG 460
           ++ +S     PK+ +KT +   PY+AV  T   G L +  +  G G V+ WL NI GV+ 
Sbjct: 378 MYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSN 437

Query: 461 FFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP 520
             AWL I+++ IRF + L+ +G +  EL FK    P   Y+   F+  +ILIQG+++F P
Sbjct: 438 QIAWLCIAITSIRFRRGLELQGKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP 496

Query: 521 TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
            ++  NF + Y+ +F+F A ++++ L  R +F+ K ED+D  +D+
Sbjct: 497 -WSTSNFFSVYLELFVFPACYLIWWLYKRDKFI-KYEDMDFVTDK 539

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  273 bits (698), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 175/571 (30%), Positives = 288/571 (50%), Gaps = 44/571 (7%)

Query: 18  EPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEG 77
           E A +   +  A Q   ++ S  L  E+S+ L   R+   G+  +   S +  +    +G
Sbjct: 8   EKAASELSNTSAVQRVLKKRSSVL--EESRLLEESRTNKRGLVRRCIDSFKPPV----DG 61

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVT 137
                 +KR LK RH                     L   GP+  LI +   G+      
Sbjct: 62  SFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTI 121

Query: 138 QSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY 197
             LGE+    PV  +F  +S RFL P+       +Y   W     LE+      ++FWT 
Sbjct: 122 HGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT 181

Query: 198 AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP 257
           +V    W+++F+ +I ++N+F V+++G+ +F  + IK++ I GF+I C  ++ G G T  
Sbjct: 182 SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHE 241

Query: 258 -VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316
            +G RYW +PGA   G          F G  + ++ A+++  G+E+  + +GE  +P K 
Sbjct: 242 FIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KE 289

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPH 376
           +P AIK++ +RI+ F++ SL  +G LVPY + +L   ++ V+ SPF+IAI+    +VLPH
Sbjct: 290 IPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSN-VNNSPFVIAIKMHNIRVLPH 348

Query: 377 IFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGAL 436
           I N VIL +I+S  NS I+  SR L  ++   L P+ F    + G P   +   S+FG L
Sbjct: 349 IINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLL 408

Query: 437 AYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S+  G VF WL+ + G+A    WL I+VSHIRF  A+K +G S DEL F + +  
Sbjct: 409 AFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGM 468

Query: 497 GLAYYATFFMVVIILIQGFTSFTPT-------------FNGVNFLAAYISVFLFLAIWIL 543
             + Y+    VV+++ Q + S  P              F   N+L A I +F+F+A    
Sbjct: 469 WGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQ--NYLCALILLFMFVA---- 522

Query: 544 FELIFRCRFV--WKI---EDVDIDSDRRDIE 569
            ++ +R      WKI    ++D++S R++I+
Sbjct: 523 HKIYYRSTTGQWWKILPLAEIDLESGRKNID 553

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  275 bits (702), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 165/528 (31%), Positives = 274/528 (51%), Gaps = 23/528 (4%)

Query: 66  SMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           S  + +  +  G+  +A +++ ++ RH                     L+ AGP   +I 
Sbjct: 102 SKSKQLHGQKNGD-DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIG 160

Query: 126 YLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           Y  MGS  Y + Q+ GEMA  +  +  +F  +    +         ++Y   W     LE
Sbjct: 161 YGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLE 220

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I +WT  V    ++ IF+V+IT +N F  K Y E EF+  S KV+ + GF I 
Sbjct: 221 LVTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFIL 280

Query: 245 CFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
              +   GAG  G +G +YW NPGA+       +K+  RF   +S+   AAF F  +E +
Sbjct: 281 AIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFI 335

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TSATSYVSTSP 361
            I A E +NPR+ +P A K +++RIL  ++ S+  +G LVPY+  +L  +  ++    SP
Sbjct: 336 AIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASP 395

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
           ++IA+ + G +V+PH  NAVIL +++S ANS  Y   R+L+ L++   APK+F    + G
Sbjct: 396 YVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREG 455

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
            P  A+  T+IFG +A+   S     VFAWLL+I G++  F W  I +SHIRF +A+K +
Sbjct: 456 RPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQ 515

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGVNFLAAYISVFLF 537
           G S DE+ FK+++    + YA   M++ ++ + + S  P      +  NF   Y+++ + 
Sbjct: 516 GRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPIL 575

Query: 538 LAIWILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPK 579
           + ++  +++    +  WK+    +D+D+ S R   D E +  EE E K
Sbjct: 576 IVLYFGYKIY---KKDWKLFIRAKDIDLISHRTIFDGELVRQEEEEYK 620

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  272 bits (696), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/484 (33%), Positives = 251/484 (51%), Gaps = 18/484 (3%)

Query: 62  QDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
            + ++ E+ +  ED  +  ++ VKR+LK RH                     L   GP+ 
Sbjct: 35  NNEYAEEQSLNREDTFD-PDSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLA 93

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTF 181
            L+ +  +G LA+ + +S+GEM T  P    FT  ++RF S A  A  GY Y   +    
Sbjct: 94  LLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVL 153

Query: 182 ALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGF 241
           A E + +  ++QFW   VPL  +I IFW       +  V  +GE E+W+A  K++ ++ +
Sbjct: 154 ANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTY 213

Query: 242 LIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
            I+    + G     P  GF+YW +PGA   G          F G  +  +  +  + GT
Sbjct: 214 YIFSIVYISGGVKNRPAFGFQYWNDPGALSNG----------FKGIANVFVFCSTFYSGT 263

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           E V + A E+ NPR+ VP AI++  +RIL  Y+G  +F G+ VPYND  L  AT  V  S
Sbjct: 264 ESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFATK-VLKS 322

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           P  IAI  +G     H+ NA IL T ISA N ++Y+GSR L  L+   LAPK  + T + 
Sbjct: 323 PIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRR 382

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVP  A+   +  G ++ M  S      + +++N++GV  F  W  IS++H+RF +A K 
Sbjct: 383 GVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKL 442

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI----SVFL 536
           +G +RDELP+KAKL P     +    + + L+QG++ F P F+  NF+ AYI     + L
Sbjct: 443 QGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIIL 501

Query: 537 FLAI 540
           +L +
Sbjct: 502 YLGV 505

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  271 bits (693), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 175/528 (33%), Positives = 275/528 (52%), Gaps = 28/528 (5%)

Query: 43  DEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXX 102
           D   +E+Y + S         +  ++E   D D  +    ++ R L  RH          
Sbjct: 14  DSGKQEIYEVSS---------SLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGII 64

Query: 103 XXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L N GP    ++Y  +G + Y     LGEM+TF+P++ SF  ++++F S
Sbjct: 65  GTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGS 124

Query: 163 PAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYA---VPLAAWISIFWVIITAMNMFP 219
            +F  A  + YWF+ AV+ A +L+ +  V+ +W  A    P      IFW  +  +N+  
Sbjct: 125 ESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIH 184

Query: 220 VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNK 278
           V+ YGE E+W+A +KVIAI+ F I    +  G       +GF+ W +  A  P +     
Sbjct: 185 VRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEA--PFV----- 237

Query: 279 NEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLF 338
               F G+ S  ++A F + GTE + +T GEA+NP +  P+ +K V +RIL FY+ S  F
Sbjct: 238 --NGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFF 295

Query: 339 IGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGS 398
           IG+ +PY+ P L+  T  V TSPF +  + +GT+      NAVILT++ISA N  ++ GS
Sbjct: 296 IGMNIPYDYPGLS--TKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGS 353

Query: 399 RVLFGLSKSKLAP-KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITG 457
           R+++ ++     P K   +T +   PY+AV  T   G L    +  G G ++ WL NI G
Sbjct: 354 RIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVG 413

Query: 458 VAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTS 517
           V+   AWL I ++ IRF + L+ +G   D L FK    P   Y+   F V IILIQG+ +
Sbjct: 414 VSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQA 472

Query: 518 FTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           F P ++  +F + Y+ +F+F  ++I++ L  R  FV K ED+D  +DR
Sbjct: 473 FDP-WSVTDFFSVYLELFVFPFVYIIWWLWKRDWFV-KYEDMDFVTDR 518

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  273 bits (697), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 159/507 (31%), Positives = 259/507 (51%), Gaps = 26/507 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G      +KR LK RH                     +   GP+  +I +   GS    
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+    PV  +F  +S RFL P+       +Y   W     LE+      +Q+W
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             ++    W++IF+  I ++N+F  + +GE EF  +S+KV+ I GF+I C  ++CG G  
Sbjct: 197 NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPD 256

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG +YW +PG    G          F G +S L+ A+++  GTE+V + +GE  +P 
Sbjct: 257 HDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP- 304

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK+  +RIL F++ SL  IG LVPY +  L   +S V+ SPF+IAI+    KVL
Sbjct: 305 KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVL 363

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           P I NAVIL +I+S  NS I+  SR L  ++   L P+FF    + G P   +   S+FG
Sbjct: 364 PSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFG 423

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S+   +VF WL+ I G+A    WL I++SHIRF  A+K +G S DEL F + +
Sbjct: 424 LLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAV 483

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTP-------TFNGVNFLAAYISVFLFLAIWILFELI 547
               + Y+     +I++ Q + +  P       +     F  +Y+   + + +++  ++ 
Sbjct: 484 GIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIF 543

Query: 548 FRCRF-----VWKIEDVDIDSDRRDIE 569
           +R +      +  +  +D+++DR++I+
Sbjct: 544 YRYKTGKWWSMLPLNKIDLETDRKNID 570

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  271 bits (692), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 278/521 (53%), Gaps = 16/521 (3%)

Query: 76  EGEVQNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSL 132
           EG+  + E    +R+L  R                      + + GP   LI++     +
Sbjct: 34  EGQAPSLEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVV 93

Query: 133 AYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVI 192
              ++Q +  M T++PVT SF  F++RF+  + G + G+ Y+   A     E++ V  V+
Sbjct: 94  FIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVV 153

Query: 193 QFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA 252
           +FWT  +P AA ISI   +  ++N+F V  +GE EF+++  KVI  IG + +   ++ G 
Sbjct: 154 EFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGG 213

Query: 253 GVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA 311
                V GF+ W NPGA+    ISK  +  +F G++S LI A + F G + +G  A EA 
Sbjct: 214 NPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEAM 271

Query: 312 NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIE 367
           NPRK +P + +KV  R++ FYIG  + +G+LVP+ND  +  A S        SP++ A++
Sbjct: 272 NPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMK 331

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
             G  VLPHI N +ILT+IISA NS++Y  SRVL  L+    APK F K TK GVP    
Sbjct: 332 TLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCC 390

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
            A  +   LAY+  S     V  W LN+   A    ++FI +S+++F +  K + I    
Sbjct: 391 VAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKT 450

Query: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSF-TPTFNGVNFLAAYISVFLFLAIWILFEL 546
           LP+ +  +P L +++ F++V+++ + G+  F   +++  +F+ +Y  +  F+ ++   +L
Sbjct: 451 LPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKL 510

Query: 547 IFRCRFVWKIEDVDIDSDRRDI--EAIVWEEPEPK-TLWDK 584
             + RFV  +E +D+ S   ++  E   WEE  PK  L DK
Sbjct: 511 YKKTRFVKPVE-MDLFSGIAELAEEDAYWEENPPKMNLLDK 550

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 173/588 (29%), Positives = 296/588 (50%), Gaps = 25/588 (4%)

Query: 8   SEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSM 67
           S++E+   +       +++   S T      +    E+S+     R F +     ++  +
Sbjct: 9   SKMEKNTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHR-FVDSFRRAESQCL 67

Query: 68  EE--DIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           EE  D++D       N  +K+ +K RH                     L  AGP   +I 
Sbjct: 68  EENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIG 127

Query: 126 YLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           Y+ +  + Y + Q+ GEM   +  +  +F  ++  F+S +FG A  +++   W     LE
Sbjct: 128 YVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           L      I++W  ++    +I IF+V +  ++ F VK YGE EF   S K++ + GF+I 
Sbjct: 188 LITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIIL 247

Query: 245 CFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
              + CG AGV G +G +YWR+PG++  G      N  RF G    L+ A F+F G EL 
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELF 302

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPF 362
            ++  E +N RK+ P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  S ++    SP+
Sbjct: 303 VLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPY 362

Query: 363 IIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGV 422
           ++A      +V+PHI NAVIL ++IS ANS +Y   R++  L++   AP+F +   + G 
Sbjct: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGR 422

Query: 423 PYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRG 482
           P  A+   ++ G + ++  S    + F WL  I G++  F W  I +SHIRF +A+K +G
Sbjct: 423 PLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQG 482

Query: 483 ISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG---------VNFLAAYIS 533
            S  EL +KA      +YY  FF +++ + Q + + +P  NG           +LAA + 
Sbjct: 483 RSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLW 542

Query: 534 VFLFLAIWILFELIFRCRFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           +F++L  ++L+   F    +  ++ +D+D  RR  D E +  E+ E K
Sbjct: 543 IFMYLG-YMLYNKDF--TLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  272 bits (696), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 161/524 (30%), Positives = 274/524 (52%), Gaps = 14/524 (2%)

Query: 71  IQDEDEGEVQNAEV-----KRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALIS 125
           +Q+ D  + Q+  +     +R+L  R                      +   GP   LI+
Sbjct: 99  LQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIA 158

Query: 126 YLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALEL 185
           +     +   +++ +  M T++PVT SF  F++RF+  + G A G+ Y+   A     E+
Sbjct: 159 FCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEI 218

Query: 186 SVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYC 245
           + V  V+++WT  +P AA IS+  ++  ++N++ V ++GE EF+++  KV+  IG +I+ 
Sbjct: 219 TAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFT 278

Query: 246 FCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
             ++ G      V GF+ W NPGA+   I   + +  RF G++S L+ A + F G + +G
Sbjct: 279 VVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLG 336

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTS 360
             A EA NPRK +P + +KV  R++ FYIG  + +G+L+PYNDP +  A          S
Sbjct: 337 NAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGAS 396

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           P++ A++  G +VLPHI N +ILT+IISA NS++Y  SRVL  L+    AP+ F  TTK 
Sbjct: 397 PYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKK 456

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           GVP     A  +   LAY+  S     V  W LN+   A    ++FI VS+++F +    
Sbjct: 457 GVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLA 516

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLA 539
           + +    LP+ +  +P LA+++ F++V+++L+ G+T F   +++  +F+ +Y  +  FL 
Sbjct: 517 QNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLV 576

Query: 540 IWILFELIFRCRFVWKIE-DVDIDSDRRDIEAIVWEEPEPKTLW 582
                +L    + V  +E D+    +    E   W E  P   W
Sbjct: 577 FLFGHKLYKGTKSVRPLEMDLFTGIEELADEDRYWAENPPTLNW 620

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  269 bits (688), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 259/505 (51%), Gaps = 22/505 (4%)

Query: 72  QDEDEGEVQ-NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMG 130
            D D  E   N  VKR LK RH                     L   GP+  L+ ++ +G
Sbjct: 19  DDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIG 78

Query: 131 SLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQ 190
            +A++V +S+GEM T  P    FT  ++RF S A  A  GY Y   +    A E + +  
Sbjct: 79  IIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSS 138

Query: 191 VIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVC 250
           ++QFW   VPL A+  IFW++     +  V  +GE E+W++ +K++ +I + I+    + 
Sbjct: 139 ILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMS 198

Query: 251 GAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGE 309
           G     P  GF YW++PG+   G          F G     +  +  + GTE V +TA E
Sbjct: 199 GGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATE 248

Query: 310 AANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENS 369
           + NP K+VP A+++ ++RI+  YIG  +F G  VP+NDP L S  + V  SP  IAI  +
Sbjct: 249 SKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISRA 307

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429
           G     H+ NA IL + ISA N ++Y+GSR L  L+   LAPKF + T K GVP  A+  
Sbjct: 308 GWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITI 367

Query: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489
            +  G ++ M  S G    +++++N++GV  F  W  IS +H+R  +A   +G   +ELP
Sbjct: 368 FNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELP 427

Query: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI----SVFLFLAIWILFE 545
           +KA   P    ++    + + LIQG+TS  P F    F+ AYI    ++ L++ + +   
Sbjct: 428 YKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKN 486

Query: 546 LIFRCRFVWKIEDVDIDSDRR-DIE 569
             FR   +  +  V++D  RR D+E
Sbjct: 487 HNFR---IVDLTSVNLDEGRRKDME 508

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  272 bits (696), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 164/506 (32%), Positives = 270/506 (53%), Gaps = 19/506 (3%)

Query: 72  QDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
             +DEG+  + ++K+ ++ RH                     L  AGP G +I Y  MGS
Sbjct: 105 HKKDEGDTGD-KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGS 163

Query: 132 LAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQ 190
           L Y + Q+ GEMA  ++ +   F  +    + P F  A  ++Y   W     LEL     
Sbjct: 164 LIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASM 223

Query: 191 VIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMV 249
            I++WT  V    ++ IF+V I  +N+    + Y E EF   S K++ +IGF I    ++
Sbjct: 224 TIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIII 283

Query: 250 CGAGVT-GPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAG 308
           CG   T G +G RYW +PGA+        +   RF G V++L+ AAF+F  +E + +TA 
Sbjct: 284 CGGAGTDGYIGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTAS 338

Query: 309 EAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIE 367
           E +NPR+ +P A KK+++R L  Y+ S++ +G LVPYN  +L  A S  +  SP+++A+ 
Sbjct: 339 EQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVA 398

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
           N G +V+PH  NAVI+ +++S +NS  Y   R+L  LS+   APK FS   + G P + +
Sbjct: 399 NHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGI 458

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
              S+F  +A+  TS    +VF WLL ++G++  F W+ I +SH+RF +A+  +G S  E
Sbjct: 459 IVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGE 518

Query: 488 LPFKAKL-MPGLAYYATFFMVVIILIQGF-TSFTPTFNGVNFLAAYISVFLFLAIWILFE 545
             F +++ + G AY  +FF++ +IL+  F  +  P  +      ++   +L   IWI   
Sbjct: 519 CGFLSQVGIYGSAY--SFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALY 576

Query: 546 LIFRC-----RFVWKIEDVDIDSDRR 566
           + ++C     R   K +D+D+ + R+
Sbjct: 577 IGYKCYTKDWRLYIKSQDIDLVAHRQ 602

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  271 bits (693), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 271/523 (51%), Gaps = 16/523 (3%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
             D++D +     + ++K+ +K RH                     L   GP G LI Y 
Sbjct: 55  SSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYF 114

Query: 128 FMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
           F+  ++Y + Q+ GEMA   P +  +F  +S  F+S  FG A  +++   W     LEL 
Sbjct: 115 FVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELI 174

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
               V+++WT  +    ++ IF++ I  ++    + YGE EF   S KV+ + GF+I   
Sbjct: 175 TSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGI 234

Query: 247 CMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            + CGA G  G +G +YW  PGA+  G         RF G    L+ A F++ G EL  +
Sbjct: 235 LINCGAVGDDGYIGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYAL 289

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFII 364
           +  E  NPRK +P A  K V+RIL  Y+ +++ IG LVP++  KL  S +S V  SP+++
Sbjct: 290 SVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVL 349

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           A+   G K++PHI NAVIL ++IS  NS +Y G R+L  L++   APK      + G P 
Sbjct: 350 ALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPL 409

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
           +A+   S+FG +A++  S     +F WL  I+G++  F W  I +SH RF +A+K +G S
Sbjct: 410 MALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRS 469

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNF-----LAAYISVFLFLA 539
            + L +++      + YA  F V +++ Q + +  P  NG  F       + +++ L+L+
Sbjct: 470 LETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLS 529

Query: 540 IWILFELIFRCRFVWK-IEDVDIDSDRR--DIEAIVWEEPEPK 579
           + + + ++ +   +   +  + +DS RR  D+E +  E+ E K
Sbjct: 530 MAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEYK 572

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  271 bits (692), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/520 (31%), Positives = 264/520 (50%), Gaps = 26/520 (5%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           +  +  ++G    + +K+ LK RH                     L   GP+  +I +  
Sbjct: 71  DSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAI 130

Query: 129 MGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVV 188
            GS        LGE+    PV  +F  +S RFL P+       +Y   W     LE+   
Sbjct: 131 AGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISS 190

Query: 189 GQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCM 248
              +Q+W  ++    W++IF+V I ++N+F V+ +GE EF  ++IKVI I GF++ C  +
Sbjct: 191 AMTVQYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIIL 250

Query: 249 VCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
           + G G     VG RYW NPG    G          F G +S ++ A+++  GTE+  + +
Sbjct: 251 IAGGGPDHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLAS 300

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367
           GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+
Sbjct: 301 GET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIK 357

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427
               KVLP I NAVIL +I+S  NS I+  SR L  ++   L P +F    + G P + +
Sbjct: 358 IHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGI 417

Query: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487
              S+FG LA++  S    +VF WL+ I G+A    WL I+VSHIRF  A+K +G S +E
Sbjct: 418 ITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNE 477

Query: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN-------FLAAYISVFLFLAI 540
           L F + +    + Y+     +I++ Q + S  P     N       F  +Y+   + + I
Sbjct: 478 LEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCI 537

Query: 541 WILFELIF--RCRFVWK---IEDVDIDSDRRDIEAIVWEE 575
           WI  ++ +  +   +W    + ++D+D  R++I+  V ++
Sbjct: 538 WIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQ 577

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 274/530 (51%), Gaps = 18/530 (3%)

Query: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
            QD  S E D++D  +     + +K+ +K RH                     L+  GP 
Sbjct: 54  AQD--STENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPG 111

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAV 179
             +I Y+ +  + Y + Q+ GEMA   P +  +F  ++  F+S  FG A  ++++  W  
Sbjct: 112 SLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLT 171

Query: 180 TFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAII 239
            F LEL      I++W   +    +I IF+V +  ++ F VK YGE EF   S KV+ I 
Sbjct: 172 VFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIA 231

Query: 240 GFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQ 298
           GF+I    + CG AG  G +G +YWR+PG++  G      +  +F G    L+ A F++ 
Sbjct: 232 GFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEG-----DSVEKFKGICYILVTAYFSYG 286

Query: 299 GTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYV 357
           G EL  ++  E  NPRK+ P+A K+ ++RIL  Y+ +++ IG  VP+N+ +L  S  S  
Sbjct: 287 GAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSAT 346

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417
             SP+++A    G KV+PH  NAVIL ++IS ANS +Y   R++  L++   APKF    
Sbjct: 347 HASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYV 406

Query: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477
            + G P  A+   ++FG + ++  S+   +VF WL  I G++  F W  I +SH+RF Q 
Sbjct: 407 DREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQC 466

Query: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFL 536
           +K  G S +E+ F+A      + Y   F +++ + Q + +   P+ +G     ++   +L
Sbjct: 467 MKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYL 526

Query: 537 FLAIWILF---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
              IW+ F    ++++  F +   ++ +D++  RR  D E I  E+ E K
Sbjct: 527 AAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  270 bits (691), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 160/532 (30%), Positives = 264/532 (49%), Gaps = 47/532 (8%)

Query: 72  QDEDEGEVQN---------------------AEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           QD+D+GE  N                     + +KR LK RH                  
Sbjct: 46  QDDDDGEHSNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGS 105

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
              +   GP+G ++ +   GS        LGE+    PV  +F  +  RFL P+      
Sbjct: 106 GKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVS 165

Query: 171 YMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWV 230
            +Y   W     LE+      +Q+W  ++    W++IF+ +I  +N+F  + +GE EF  
Sbjct: 166 TIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAF 225

Query: 231 ASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSS 289
           +++K I + GF+I    ++CG G     +G +YW +PG    G          F G ++ 
Sbjct: 226 STVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLAV 275

Query: 290 LINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349
           L+ A+++  G E+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +  
Sbjct: 276 LVVASYSLGGIEMTCLASGET-DP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQN 333

Query: 350 LTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
           L   +S V  SPF+IA++    KVLP I NAVIL +++S  NS I+  SR L  ++   L
Sbjct: 334 LLGGSS-VDNSPFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGL 392

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
            P +F    + G P + + A S+FG LA++  S     VF WL+ I G+A    WL I++
Sbjct: 393 IPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINL 452

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVN--- 526
           SHIRF  A+K +G S DEL F + +    + Y+     +I++ Q + S  P     +   
Sbjct: 453 SHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKE 512

Query: 527 ----FLAAYISVFLFLAIWILFELIFRCRF-----VWKIEDVDIDSDRRDIE 569
               F   Y+   + L I+++ ++ ++C+      V  ++D+D+++DR+DI+
Sbjct: 513 RAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDID 564

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 174/570 (30%), Positives = 292/570 (51%), Gaps = 23/570 (4%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE-----VKRELKQRHX 93
           +S     + E+  L    + +  +  FS+     +  +G V + E     + R LK RH 
Sbjct: 1   MSPSSNSTVEVPTLPYVTDRMKEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHV 60

Query: 94  XXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSF 153
                               L+  GP   LI+Y  M    +SV   + EM T IP+    
Sbjct: 61  QLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGES 120

Query: 154 TVFS--QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVI 211
           T++S  + +++       G+  +++ A+    E++    ++Q+WT A P A +ISIF V+
Sbjct: 121 TLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVL 179

Query: 212 ITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAW 269
             A+ M PVK +GE EFWV+SIK++ I+G +I    +  G G      +GF YW+ PGA+
Sbjct: 180 SVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAF 239

Query: 270 GPGIISKNKNEARFLGWVSSLINAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVFRI 328
            P ++       +FL + +++I + F+F    E+V   A EA  PR+ +PRA K+ ++R+
Sbjct: 240 KPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRL 297

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS----PFIIAIENSGTKVLPHIFNAVILT 384
             FY+  +L +G++V Y++ +L +A +   +S    PF+I I+ +G +VLPHI NA ILT
Sbjct: 298 ALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILT 357

Query: 385 TIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTG 444
           +  S     +Y  SR L  ++    AP+  +   K GVPY     TS+F  LAY+  S  
Sbjct: 358 SAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNS 417

Query: 445 GGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATF 504
              VF WL NI  ++GF +W+ +S+++IRF   +    ++ D +PF+      LAY A  
Sbjct: 418 SSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMG 476

Query: 505 FMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWI---LFELIFRCRFVWKIE-DV 559
           F  ++ L  GF  F    ++  NF AAYI++   L +++   ++   +RCR + +IE D+
Sbjct: 477 FFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYKEWRCRDIAEIEQDI 536

Query: 560 DIDSDRRDIEAIVWEEPEPKTLWDKFWNVV 589
                  + E   ++ P P+   +K W V+
Sbjct: 537 LPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  270 bits (690), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 173/537 (32%), Positives = 280/537 (52%), Gaps = 22/537 (4%)

Query: 60  NGQD-TFSMEEDIQDED------EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXX 112
           NG D   S  E +  ED      +   ++  +K+ +K RH                    
Sbjct: 56  NGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGK 115

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGY 171
            L N GP   LI Y  + ++ Y V QS  E+A  +  ++  F  +    +  AF  +  +
Sbjct: 116 SLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSW 175

Query: 172 MYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVA 231
           +Y   W     LEL      I++W  ++   A++ IF+V++  +N      Y E EF+  
Sbjct: 176 VYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFN 235

Query: 232 SIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
           + KV+ +IGF I    + CG AG  G +G  YW +PGA+       N    RF G V+ L
Sbjct: 236 TCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVL 290

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           +NAAF + G E   +TA E  NP+K++  A KK+V+RI+  Y+ +   +G LVPYN P+L
Sbjct: 291 VNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPEL 350

Query: 351 T-SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
             S ++    SPF+IAI + G KV+PHI NAVIL +++S ANS +Y  SR+L  LS+   
Sbjct: 351 LGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGF 410

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
           APK F+   + G P   +  + +FG L ++  S     VF WLL I+G++  F W  IS+
Sbjct: 411 APKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISL 470

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT----FNGV 525
           SH+RF +++  +G S DEL +++      AYYA   +++I++ Q + + +P      +  
Sbjct: 471 SHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDAN 530

Query: 526 NFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           NF   Y+++ + + +++ ++L +R  R +    +VD+ S R+  D E +  E+ E K
Sbjct: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  269 bits (688), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 161/532 (30%), Positives = 275/532 (51%), Gaps = 17/532 (3%)

Query: 60  NGQDTFSMEEDIQDEDEGEVQNAE-VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
             Q   +++ + +D D G  +  + +K  +K RH                     L   G
Sbjct: 43  RAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGG 102

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           P G +I Y+   ++ Y V Q+  E+   +  +  ++  +    +   FG A   +Y   W
Sbjct: 103 PAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQW 162

Query: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
           A    LEL      +++WT +V    +++IF+V +  ++ F  + Y E EF   S+KV+ 
Sbjct: 163 ATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL 222

Query: 238 IIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           + GF+I    +  GA   G +G +YW +PGA+G      ++   RF G  S  + AAF +
Sbjct: 223 MAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAY 277

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT--S 355
            G+E + +TA E ANPR++VP+A K+ ++R++  ++  ++ IG LVP+N  +L SA   S
Sbjct: 278 GGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGS 337

Query: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFS 415
               SPF+IA    G +V+PHI N +ILT++IS  NS +Y   R+L  L++  + PK F+
Sbjct: 338 GSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFT 397

Query: 416 KTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFM 475
              + G P + +   S+FG +A++  S     VF WL  I G++  F W  I+VSH+RF 
Sbjct: 398 YVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFR 457

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-FNGVNFLAAYISV 534
           +A++ +G S  EL ++A      +YYA FF V++++ Q + +  P   +G   +  +   
Sbjct: 458 RAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN 517

Query: 535 FLFLAIWILFELIFRC-----RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           +L   + ++F L ++      R V    +VD+ S R+  D E ++ EE E K
Sbjct: 518 YLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  268 bits (686), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 167/539 (30%), Positives = 279/539 (51%), Gaps = 19/539 (3%)

Query: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           +G       S+ ED++     + +   +++ ++ RH                     +  
Sbjct: 14  SGAEADSVESVAEDVEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIAC 73

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWF 175
           AG  G LI Y  +G +     QS+GE+    P ++  F  + +RF+ P+ G +  +++  
Sbjct: 74  AGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCL 133

Query: 176 SWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKV 235
            W +   LEL      I++W  ++  + ++S+F+ +I  +N F    Y E EF   S+KV
Sbjct: 134 QWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKV 193

Query: 236 IAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAA 294
           + IIGF+I    +  G  G +G +GFRY  +PG +       NKN         +L+NAA
Sbjct: 194 VVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAA 246

Query: 295 FTFQGTELVGITAGEAA--NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT- 351
           F+  G E + ++A E    N  K++ RA  +V  RI  FY+ S+  +GLLVP+N P L  
Sbjct: 247 FSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMG 306

Query: 352 SATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAP 411
           S ++ + +SP++ A+  +G  V+PHI NAVIL  +IS ANS +Y  SR L  L++   AP
Sbjct: 307 SGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAP 366

Query: 412 KFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSH 471
           K+F+K  K G P   +F +++FG ++++        +F WLL+I+G++  F W  I ++H
Sbjct: 367 KYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAH 426

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNG----VN 526
           IRF  A+K RG S + L +K+      +Y AT   +VI+++Q + S  P   NG    V 
Sbjct: 427 IRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQ 486

Query: 527 FLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDK 584
           F   Y++V + L  +I  ++  +    + +  +VDI +D RDI     E+P+ K L   
Sbjct: 487 FFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTD-RDIYCPTIEDPKIKVLMQN 544

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  269 bits (687), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 269/534 (50%), Gaps = 22/534 (4%)

Query: 63  DTFSMEE------DIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           D+F   E      D++D       +  +K+ +K RH                     L  
Sbjct: 50  DSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYL 109

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWF 175
           AGP   +I Y  +  + Y V Q+ GEMA   P +   F  ++  F+S  FG A  +++  
Sbjct: 110 AGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCI 169

Query: 176 SWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKV 235
            W     LEL      I++W   +    ++ I +V +  ++ F V+ YGE EF   S K+
Sbjct: 170 QWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKI 229

Query: 236 IAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAA 294
           + I GF+I    + CG AGV G +G +YWR+PGA+     + +   +RF G    L+ A 
Sbjct: 230 LMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAY 284

Query: 295 FTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT 354
           F++ G EL  ++  E  NPR++ P A K+ ++RIL  Y+ +++ IG  VP+N  +L  A 
Sbjct: 285 FSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAG 344

Query: 355 -SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKF 413
            S    SP+++A+   G KV+PHI NAVIL ++ S ANS +Y   R+L  L++   APK+
Sbjct: 345 GSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKY 404

Query: 414 FSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIR 473
           F+   + G P  A+   SIFG +A+   S     +F WL  I G++  F W  I +SH+R
Sbjct: 405 FNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVR 464

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-FNGVNFLAAYI 532
           F  A+K +G S +EL + +      + Y  FF V++ + Q + + +P    GV    A+ 
Sbjct: 465 FRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFF 524

Query: 533 SVFLFLAIWILFELIFRC-----RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
             +L   +W+ F L +        F+  ++ +D+D+ RR  D E +  E+ E K
Sbjct: 525 ESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  270 bits (691), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/499 (33%), Positives = 271/499 (54%), Gaps = 16/499 (3%)

Query: 78  EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVT 137
           E ++ E+K+ +K RH                     L  AGP G L+ +  MG+  Y + 
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 138 QSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWT 196
           Q++GEMA  +  +   F  +    + PAFG +  ++Y   W     LEL      I++WT
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 197 YAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
             V    ++ IF+V+I A+N+      Y E EF   S K++ +IGF I    ++CG    
Sbjct: 263 TKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGN 322

Query: 256 -GPVGFRYWRNPGAW-GPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            G +G +YW  PGA+ G   I       RF G +++L+NAAF F  +E +G+TA E +NP
Sbjct: 323 DGYIGGKYWHEPGAFRGEHAID------RFKGVMATLVNAAFAFGMSEFIGVTASEQSNP 376

Query: 314 RKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTSATSYVSTSPFIIAIENSGTK 372
           RK +P A KK+++RI+  ++ S+  +G LVPY+ D  L S+   V  SP+++A+   G K
Sbjct: 377 RKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVK 436

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432
           V+PH  NAVIL +++S ANS  Y  SR+L  L++   APK F    + G P + +   S+
Sbjct: 437 VVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASL 496

Query: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492
           FG +A+  TS    +VF WLL I+G++  F W+ I VSH+RF +A+  +G S  EL F++
Sbjct: 497 FGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRS 556

Query: 493 KLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIF 548
           ++    + YA   MV I++ Q + +  P      +  NF   Y+++ + LA++  +++  
Sbjct: 557 QVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYT 616

Query: 549 RCRFVW-KIEDVDIDSDRR 566
           +   ++ + +D+D+ S R 
Sbjct: 617 KNWTIFIRAKDIDLVSHRN 635

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 175/542 (32%), Positives = 273/542 (50%), Gaps = 28/542 (5%)

Query: 35  RRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXX 94
           +R ++ +++   K++ P   F + V   D   ++ED  D    + Q   VKR LK RH  
Sbjct: 7   KRETVDIEETAKKDIKPY--FASNVEAVD---IDED-PDVSRYDPQTG-VKRALKNRHIS 59

Query: 95  XXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154
                              L   GP+  L+ +  +G +A+SV +S+GEM T  P    FT
Sbjct: 60  LLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFT 119

Query: 155 VFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITA 214
             ++RF S A  A  GY Y   +    A E + +  ++QFW   VPL  +I IFW     
Sbjct: 120 TLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEI 179

Query: 215 MNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGI 273
             +  V  +GE E+W+A +K++ ++ + I+    + G     P  GF YW +PGA   G 
Sbjct: 180 FQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG- 238

Query: 274 ISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI 333
                    F G     +  +  + GTE V + A E+ NP K VP A+++ ++RIL  YI
Sbjct: 239 ---------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYI 289

Query: 334 GSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSN 393
           G  +F G  VP++DP L SA++ V  SP  IAI  +G     H+ NA IL T ISA N +
Sbjct: 290 GIAVFYGATVPFDDPNL-SASTKVLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGS 348

Query: 394 IYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLL 453
           +Y+GSR L  L+   LAPK  + T + GVP  A+   +  G ++ M  S G    +++++
Sbjct: 349 LYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIV 408

Query: 454 NITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQ 513
           N++GV  F  W  IS +H+R  +A   +G S +ELP++A   P     +    + + LIQ
Sbjct: 409 NLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQ 468

Query: 514 GFTSFTPTFNGVNFLAAYI----SVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRR-DI 568
           G++ F P F+  NF+ AYI     + L++ I +     FR      +  +++D  RR D+
Sbjct: 469 GWSYFVP-FDAGNFVDAYILLPVGILLYIGICVFKSNHFRTV---DLRSINLDEGRRKDM 524

Query: 569 EA 570
           EA
Sbjct: 525 EA 526

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/540 (30%), Positives = 272/540 (50%), Gaps = 26/540 (4%)

Query: 63  DTFSMEEDIQDEDEGEVQNAE---------VKRELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           ++F   E       G++++A          +KR +K RH                     
Sbjct: 53  NSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKS 112

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYM 172
           L   GP G +I Y  +  +AY + Q+ GEMA   P +  +F  +S + +S  FG A  ++
Sbjct: 113 LRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWL 172

Query: 173 YWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           Y   W     LEL      I++W  ++    +I+IF+V I  ++ F  + YGE EF    
Sbjct: 173 YCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGI 232

Query: 233 IKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
            KV+ IIGF+I    + CG AG    +G +YW +PGA+  G         +F G    L+
Sbjct: 233 CKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLV 287

Query: 292 NAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL- 350
              F++ GTEL  +T  E +NPR+ +    K+ ++RIL  Y+ +++ IG LVP+   +L 
Sbjct: 288 TGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELM 347

Query: 351 -TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKL 409
            +S  S    SP+++A+   G K++PHI NAVIL  +IS  NS +Y G R+L  L++   
Sbjct: 348 GSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGY 407

Query: 410 APKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISV 469
           AP+F +   + G P +A+ A S+FG LA++  S     VF WL  I G++  F W  I +
Sbjct: 408 APRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIML 467

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-----TFNG 524
           SH+RF QA++Y      EL +KA      +     F +++ + Q + S  P       + 
Sbjct: 468 SHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDV 527

Query: 525 VNFLAAYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPKTL 581
           ++F  +Y++  L++ ++  + ++FR    +  ++D+D+D  R   D + +  E+ E K L
Sbjct: 528 LSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKIL 587

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  268 bits (684), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/530 (31%), Positives = 280/530 (52%), Gaps = 18/530 (3%)

Query: 63  DTFS--MEEDIQDEDEGEVQNAE--VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAG 118
           D+F   +E++  D +E  +++ +  +K+ +K RH                     L+  G
Sbjct: 41  DSFKPPVEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGG 100

Query: 119 PVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           P   +I Y+ +  + Y + Q+ GEMA   P +  SF  ++  F+S   G A  +++   W
Sbjct: 101 PGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQW 160

Query: 178 AVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIA 237
                LEL      IQ+W  ++    WI IF+V +  +++F VK YGE EF   + K++ 
Sbjct: 161 LTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILF 220

Query: 238 IIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFT 296
           I GF+I+   +   GAG  G +G +YW+NPG++     + + +  RF      L+ A F+
Sbjct: 221 IGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFS 275

Query: 297 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-S 355
           + GTEL  ++  E ANPR++ P+A K+ ++RIL  Y+ +++ IG  VP+++ +L  A  S
Sbjct: 276 YGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGS 335

Query: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFS 415
               SP+++A    G KV+PHI NAVIL  + S  NS++Y   R+   L++   APK  +
Sbjct: 336 STHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLA 395

Query: 416 KTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFM 475
              + G P IA+ A ++ G +A+   S+   +VF WL  I  ++  F W  I +SHIRF 
Sbjct: 396 YIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFR 455

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP---TFNGVNFLAAYI 532
            A+K +G   +EL +KA      + +   F V++ + Q + + +P   T +   F  +Y+
Sbjct: 456 MAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYL 515

Query: 533 SVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
           +  L+L  +  + L  R   F+ K+ED+D+D+ RR  D E +  E+ E K
Sbjct: 516 AFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERK 565

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  267 bits (682), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 173/521 (33%), Positives = 270/521 (51%), Gaps = 27/521 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G   +  +KR+LK RH                     L   GP+  +I +   GS    
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+    PV  +F  +S R L P+       +Y   W     +EL      +QFW
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           T  V    W++IF+VI+ ++N+F VK +GE EF  + +KVI IIGF+I    ++CG G  
Sbjct: 182 TTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPD 241

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              +G  YW +PGA   G          F G  S  + A+++  G+E+V + + E  +P 
Sbjct: 242 HRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP- 289

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V+ SPF+IAI+ SG +VL
Sbjct: 290 KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVL 348

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           P I NAVIL +I+S  NS I+  SR L  ++   L P+ F    + G P + +   S+FG
Sbjct: 349 PSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFG 408

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S   G VF WL+ I G+A    WL I++SHIRF  A+K +  S DEL FK+ +
Sbjct: 409 LLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSV 468

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTPTFNGV-----------NFLAAYISVFLFLAIWIL 543
               + Y+    ++I++ Q + S  P                N+L A + VF+F+   I 
Sbjct: 469 GVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIY 528

Query: 544 FELIFRCRFVWK-IEDVDIDSDRRDIE-AIVWEEPEPKTLW 582
           F+      F +K + ++D+++DR++I+  IV +E   + ++
Sbjct: 529 FKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMY 569

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  265 bits (677), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 181/529 (34%), Positives = 277/529 (52%), Gaps = 23/529 (4%)

Query: 42  KDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXX 101
           KD+ + E Y   +  N  +  +  S+E    D +  E     + R L  RH         
Sbjct: 9   KDKVTPEQYISIADENYSSDLEQPSLEGLTTDNNVRE----HLNRSLSPRHVNMIAIAGV 64

Query: 102 XXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L   GP   LI+Y  +G + Y+   SLGEM+T++P++ SF  F+++F 
Sbjct: 65  IGTGLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFG 124

Query: 162 SPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW-TYAVPLAAWIS--IFWVIITAMNMF 218
           S +F  A    YWF+ AV+ A +L+ +  V+ +W T       WI+  IFWV +  +N+ 
Sbjct: 125 SESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVI 184

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            VK YGE E+W+A +KVIAII F I       G       +GFR W    A  P +    
Sbjct: 185 HVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTRGDA--PFV---- 238

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
                F G+ +  ++A+F + GTE + +T+GE  NP +  P+ IK V +RIL FYI ++ 
Sbjct: 239 ---NGFRGFATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVF 295

Query: 338 FIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FIG+ VPY+ P L+  +  V TSPF I  +  G+K      NAVILT+++SA N  ++ G
Sbjct: 296 FIGMNVPYDYPNLSEKS--VMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAG 353

Query: 398 SRVLFGLS-KSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNIT 456
           SR+LF L  +    PK  ++T    VPY+AV  T   G L +  +  G G ++ WL N+ 
Sbjct: 354 SRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLV 413

Query: 457 GVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFT 516
           GV+   AWL I V  IRF + L  +G +  EL F     P   Y+    +  IIL+QG++
Sbjct: 414 GVSNQIAWLSIGVISIRFRRGLSRQGKTH-ELKFVNWTYPYGPYFVIISVSFIILVQGWS 472

Query: 517 SFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           S +P  +  +F + Y+ +F+FLA W+++    R  FV + +D+D  +D+
Sbjct: 473 SSSP-MDVTSFFSYYVELFIFLACWLVWWAFKRDGFV-REKDMDFVTDK 519

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 170/542 (31%), Positives = 272/542 (50%), Gaps = 35/542 (6%)

Query: 63  DTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
           D+F   ED      G      +K+ LK RH                     L   GP+  
Sbjct: 63  DSFKPPED------GSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAV 116

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           +I +   GS        LGE+    PV  +F  ++ RFL P+       +Y   W     
Sbjct: 117 IIGWAVAGSQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLP 176

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           LE+      +Q+W  ++    +++IF+ +I ++N+F  + +GE EF  +++K+I I GF+
Sbjct: 177 LEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFI 236

Query: 243 IYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I C  ++ G G     +G +YW NPG+   G          F G +S L+ A+++  GTE
Sbjct: 237 ILCIVLIAGGGPDHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTE 286

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSP 361
           +  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +P L   +S V  SP
Sbjct: 287 MTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSS-VDNSP 343

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
           F+IAI+    KVLP I NAVIL +I+S  NS I+  SR L  ++   L P +F    + G
Sbjct: 344 FVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAG 403

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
            P   +   S+FG LA++  S+   +VF WL+ I G+A    WL I++ H+RF  A+K +
Sbjct: 404 RPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQ 463

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP----TFNGV---NFLAAYISV 534
             + DEL F + +    + Y+     +I++ Q + +  P    T +G     F   Y+  
Sbjct: 464 NRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCA 523

Query: 535 FLFLAIWILFELIFRCR--FVWK---IEDVDIDSDRR--DIEAIVWEEPEPKT-LWDKFW 586
            + + ++I  ++ +R      W+   ++D+D+D+DR+  DIE I  E  E K  L  K W
Sbjct: 524 LILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPW 583

Query: 587 NV 588
            V
Sbjct: 584 YV 585

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  264 bits (675), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/517 (32%), Positives = 253/517 (48%), Gaps = 27/517 (5%)

Query: 5   KQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDT 64
              ++ +EK  +     +F    +    H+    +    + +K+ Y    F   +   D+
Sbjct: 11  SNSAKTDEKSAFATTERSFVATKKHGAYHYEDDQV----QPNKKAYKRNLFHRCI---DS 63

Query: 65  FSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           F   E+      G      +KR LK RH                     L   GP+  +I
Sbjct: 64  FKPPEN------GSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVII 117

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
            +L  G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE
Sbjct: 118 GWLIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLE 177

Query: 185 LSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIY 244
           +      IQFW  ++    W++IF+V I A+N+F V+ +GE EF  +SIKVI I GF+I 
Sbjct: 178 IIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIIL 237

Query: 245 CFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELV 303
           C  ++ G G T   VG RYW +PGA   G          F G  S  + A+++  G+E+ 
Sbjct: 238 CIVLIVGGGPTHEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMA 287

Query: 304 GITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFI 363
            + +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V+ SPF+
Sbjct: 288 CLASGET-DP-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFV 344

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           IA      KVLP I NAVIL +I+S  NS I+  SR L  ++   L P+ F    + G P
Sbjct: 345 IACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRP 404

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
            + +   S+FG LA++  S+   +VF WL+ I G+A    WL I+VSHIRF  A+K +  
Sbjct: 405 LVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDK 464

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP 520
           + DEL F + +    + Y+    V+I++ Q + S  P
Sbjct: 465 TLDELEFVSAVGIWGSVYSAVVNVLILIAQFYISLWP 501

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  265 bits (676), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 261/527 (49%), Gaps = 29/527 (5%)

Query: 76  EGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYS 135
           +G    + +KR LK RH                     L   GP+  +I +   G+    
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
               LGE+   +PV  +F  +S RFL P+       +Y   W     LE+      ++FW
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT 255
           T +V    W+++F+ +I ++N+  V+ +GE EF  +S+KVI I GF+I C  ++ G G T
Sbjct: 190 TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPT 249

Query: 256 GP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              VG RYW +PG    G          F G  + ++ A+++  G+E+  + +GE  +P 
Sbjct: 250 HQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP- 297

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVL 374
           K +P AIK++ +RIL F++ SL  +G LVPY +  L   +S    SPF++A+     KV+
Sbjct: 298 KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVV 356

Query: 375 PHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFG 434
           PHI N VIL +I+S  NS I+  SR L  ++   L P  F    +GG P + + A SIFG
Sbjct: 357 PHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFG 416

Query: 435 ALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKL 494
            LA++   +    VF+WL+ I G+A    WL I+VSH+RF  A+K +  S DEL F + +
Sbjct: 417 LLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSV 476

Query: 495 MPGLAYYATFFMVVIILIQGFTSFTPT-------FNGVNFLAAYISVFLFLAIWILFELI 547
               + YA     + ++ Q + +  P             F   Y+   + +A++   +  
Sbjct: 477 GVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCY 536

Query: 548 FRCRF-----VWKIEDVDIDSDRR--DIEAIVWEEPEPKT-LWDKFW 586
           FR        + K+ +VD+D+ R   DIE I  E  E K  L +K W
Sbjct: 537 FRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  264 bits (675), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 267/521 (51%), Gaps = 23/521 (4%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           ++++ E+E      ++K+ +K RH                     L  AGP G +I Y  
Sbjct: 55  KELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAV 114

Query: 129 MGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
              + Y + Q+ GE+   +  +  ++T +S   + PA G +  ++Y   W     L+L  
Sbjct: 115 ASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVT 174

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               +++WT A P   ++++F+V+I  +NMF  K Y E EF     KV+ I GF+I    
Sbjct: 175 AAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIA 233

Query: 248 MVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGIT 306
           + CG AG +G +G +YW +PG++  G          F G       AAF++ G E++ +T
Sbjct: 234 INCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLT 283

Query: 307 AGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TSATSYVSTSPFII 364
           A E  NPRK++P A KKV++RIL  Y+ + + +  LVPYN  +L  +S  S    SP +I
Sbjct: 284 ASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVI 343

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           A+ + G K++PHI NAVIL ++IS  NS++Y   R+L  LS+   APKF +   + G P 
Sbjct: 344 AVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPL 403

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
           I    T +   +A++  S     +FAWLL I+G++  F W  I +SH+RF  A+  +G+S
Sbjct: 404 ICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLS 463

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-----FNGVNFLAAYISVFLFLA 539
             ++ +K++     +++A    V++++ Q + +  P       N   F   Y++  + L 
Sbjct: 464 LGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLG 523

Query: 540 IWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPE 577
            +  +++  +  R      +VD+ S R   D E +  E+ E
Sbjct: 524 AYFGYKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYE 564

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  264 bits (674), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 170/554 (30%), Positives = 282/554 (50%), Gaps = 41/554 (7%)

Query: 64  TFSMEEDIQDEDEGEVQ-------NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           T S++ED  D + G +        + +++R LK RH                     L+ 
Sbjct: 34  TESIQED--DLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFIGTGGALST 91

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPV--TSSFTVFSQRFLSPAFGAANGYMYW 174
            GP   LISY+ M    +++   L EM    P+   +S    ++ +L+       G+  +
Sbjct: 92  CGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLF 151

Query: 175 FSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIK 234
           ++ A+    E++    +IQ+WT A   A ++SIF VI  A+   PVK +GE EFWV+ IK
Sbjct: 152 YAQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVITIAVTALPVKVFGESEFWVSMIK 210

Query: 235 VIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLIN 292
           +I I G +I    +  G G      +GF YW++PGA+ P I     N  +FL   +++I 
Sbjct: 211 LITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIK 268

Query: 293 AAFTF-QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           + F F    E +   + EA  PR+ +PRA  + V+R++ FYIG  L +G+ V Y++  L 
Sbjct: 269 SGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLL 328

Query: 352 SA----TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKS 407
           SA     S  + SPF+I I+  G KVLPHI NA ILT   SA  + +Y  SR+L  ++  
Sbjct: 329 SAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALK 388

Query: 408 KLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFI 467
             APK F++  + GVPY ++   S F  LAY+  S    +VF WL NI+ ++GF +W+F+
Sbjct: 389 GNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFV 448

Query: 468 SVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVN 526
           S++++RF + + Y  ++ D + F+       AY++  F V++ L  G+  FT   ++  +
Sbjct: 449 SITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSD 507

Query: 527 FLAAYISVFLFLAIWILFELIFRCRFVWKIED-----------VDIDSDRRDIEAIVWEE 575
           F A YI++   + ++I+    ++    W+  D           +D+  +    E ++   
Sbjct: 508 FFANYITIGFVVVLFIMGTAYYK---EWRFRDMEEIRSELIPKIDMADEEESNEIVI--- 561

Query: 576 PEPKTLWDKFWNVV 589
            EP T + K  NV+
Sbjct: 562 -EPTTWYGKLGNVL 574

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 167/545 (30%), Positives = 279/545 (51%), Gaps = 28/545 (5%)

Query: 66  SMEEDIQDEDEGEVQ----NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
           ++E+DI+     ++     + EV R LK RH                     L++ GP  
Sbjct: 42  AVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAP 101

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVT--SSFTVFSQRFLSPAFGAANGYMYWFSWAV 179
            LISY  M    +++   + EM   IP++  SS    +  +L+       G+  +++ ++
Sbjct: 102 LLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSM 161

Query: 180 TFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAII 239
               E++    +I++WT A   A +++IF ++ T +++ PVK +GE EF V+ IK++ I+
Sbjct: 162 VVPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTIL 220

Query: 240 GFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           G ++    +  G G      +GF YW  PGA+   ++  +     FL    ++I + F F
Sbjct: 221 GLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGA--FLAVWKAIIKSGFAF 278

Query: 298 -QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSY 356
               E+    + EAA PRK +PRA ++ V+R+  FY+   L IG++V Y++  L  A S 
Sbjct: 279 VMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISS 338

Query: 357 ----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPK 412
                + SPF+I I+ +G ++LPHI NA ILT+  S + S +Y  SRVL  L+    APK
Sbjct: 339 GKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPK 398

Query: 413 FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHI 472
           FFSK  K GVPY +V ATS+FG LAY+  S     VF WL NI  ++GF  W+F+S++++
Sbjct: 399 FFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYL 458

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAY 531
           RF +   Y  I+ D +P++ +    LAY +  F  ++ +  GF  F    +N  +F   Y
Sbjct: 459 RFRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCY 517

Query: 532 ISVFLFLAIWILFELIFRCRFVWKIEDVDI-------DSDRRDIEAIVWEEPEPKTLWDK 584
           +++     ++I   + ++    W   D+D+         D+ D E      P PK   ++
Sbjct: 518 VTIGFVGVLFIGSSIYYK---EWTFRDMDVVGREIMPKIDQADQEEKEEYLPPPKNWVER 574

Query: 585 FWNVV 589
            W +V
Sbjct: 575 VWRIV 579

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 160/529 (30%), Positives = 270/529 (51%), Gaps = 14/529 (2%)

Query: 60  NGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
           +GQ     + D++      +  + +K+ +K RH                     L  +GP
Sbjct: 77  DGQRAGFDDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGP 136

Query: 120 VGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
              +++Y  +  + Y + Q+ GEMA   P +  +F  +   F+S  FG A  +++   W 
Sbjct: 137 APLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWL 196

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
               LEL      I++W   +    ++ IF+V +  ++ F V+ YGE EF   S K++ I
Sbjct: 197 TVLPLELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMI 256

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
            GF+I+   + CG AG  G +G +YW +PGA+     + + N  RF G    L+ A F++
Sbjct: 257 AGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSY 311

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTSATSY 356
            GTEL  ++  E  NPRK+ P+A K+ ++RI+  Y+ +++ IG  VP+ ND  + S  S 
Sbjct: 312 GGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSA 371

Query: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSK 416
              SP+++A    G +++PH  NAVIL ++IS ANS++Y   R+L  L++   APKF + 
Sbjct: 372 THASPYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTY 431

Query: 417 TTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQ 476
             + G P  A+   S+FG + +   S    +VF WL  I G++  F W  I +SH+RF Q
Sbjct: 432 IDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQ 491

Query: 477 ALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFN---GVNFLAAYIS 533
           A+K +G   +EL +KA      + Y  FF +++   Q + +  P  +    ++F  +Y++
Sbjct: 492 AMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLA 551

Query: 534 VFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
             +F   +  + L  +   F+  +E +D+D  RR  D E I  E  E K
Sbjct: 552 FPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKK 600

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/514 (32%), Positives = 255/514 (49%), Gaps = 28/514 (5%)

Query: 70  DIQDEDEGEVQNAE-------VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
           D  +  EG+  NA        VKR LK RH                     L   GP+  
Sbjct: 30  DQIETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLAL 89

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           L+ +  +G +A+++ +S+GEM T  P    FT  ++RF S +  A  GY Y   +    A
Sbjct: 90  LLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMA 149

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
            E + +  + QFW   VPL  +I IFW    A  M  V  +GE E+W++  K++ ++ F 
Sbjct: 150 NEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFY 209

Query: 243 IYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I+    + G     P  GF YW NPGA   G          F G     +  +  + GTE
Sbjct: 210 IFSTIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTE 259

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSP 361
            V  +A E+ NP + +P AI++  +RIL  YIG   F G+ VPYND  L + T  +  SP
Sbjct: 260 SVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SP 318

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGG 421
             IAI  +G +   H+ NA IL T ISA N ++++GSR +  L+   LAPKF + T + G
Sbjct: 319 ISIAITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRG 378

Query: 422 VPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYR 481
           VP  A+   +  G ++ M  S G    +++++N++GV  F  W  I ++H+RF +A   +
Sbjct: 379 VPIPAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQ 438

Query: 482 GISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI----SVFLF 537
           G +  ELP+KA   P          + + LIQG+TSF P F   +F+ AY+    +  L+
Sbjct: 439 GRTVKELPYKALFYPYTQIIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLY 497

Query: 538 LAIWILFELIFRCRFVWKIEDVDIDSDRR-DIEA 570
           + I +L    F+      +  +D+D  RR D++A
Sbjct: 498 IGISLLKTHSFKTV---DLLTIDLDEGRRVDLDA 528

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 169/576 (29%), Positives = 285/576 (49%), Gaps = 41/576 (7%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAE-------VKRELKQR 91
           L L  + S  L P  S  N +  Q   S+ + I D D+G   + E       + R LK R
Sbjct: 5   LELSQQASISLSPYIS--NRIKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTR 62

Query: 92  HXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTS 151
           H                     L+  GP   LI+Y+ +    +S+   + EM   IP+  
Sbjct: 63  HIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPG 122

Query: 152 SFTVFS--QRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFW 209
             +++S  + +L+       G+  +++ A+    E++    ++Q+WT A   A +ISIF 
Sbjct: 123 EASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISIFI 181

Query: 210 VIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPG 267
           V+   + M PVK +GE EFWV+SIK++ I+G +I    +  G G      +GF YW+NPG
Sbjct: 182 VVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPG 241

Query: 268 AWGPGIISKNKNEARFLGWVSSLINAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVF 326
           A+ P +     N  RFL   +++I + F+F    E V   + E   PR+ +P+A ++ ++
Sbjct: 242 AFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIY 299

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTSA----TSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           R+  FYI   L +G++V +N+ +L +A     S  + SPF+I I+ +G K+LPHI NA I
Sbjct: 300 RLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACI 359

Query: 383 LTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETS 442
           LT+  S     +Y  SR L+ ++    APK F+K  + G PY +    S+F  LAY+  S
Sbjct: 360 LTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCS 419

Query: 443 TGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
                VF WL NI  ++GF +W+F+S+++IRF + +    ++ D +PF+      LAY  
Sbjct: 420 KSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLT 478

Query: 503 TFFMVVIILIQGFTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIED--- 558
             F  ++ L  G+  F    +N  +F A+Y+++   + ++++    ++    W   D   
Sbjct: 479 CGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYK---QWTFRDFKE 535

Query: 559 --------VDIDSDRRDIEAIVWEEPEPKTLWDKFW 586
                   +DI  +    + I    P P+   +K W
Sbjct: 536 IEVEILPKIDIADEEERNDVI----PVPRNFMEKVW 567

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 180/602 (29%), Positives = 287/602 (47%), Gaps = 47/602 (7%)

Query: 26  DVEASQ----THHRRGSLSLKDEKSKELYPLRSFPNGVN-------------GQDTFSME 68
           DV +SQ        + S+   +EKS E Y   +     N              +D    E
Sbjct: 11  DVLSSQELRTDASNKKSVDQINEKSVESYASNAEVGATNPTMFRRFVDSFKPAEDNKHSE 70

Query: 69  EDIQDEDEGEV-----QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGAL 123
            D   E  G+       +  +K+ +K RH                     L   GP   +
Sbjct: 71  VDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALV 130

Query: 124 ISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFA 182
           I Y  +  + Y + Q+ GEMA   P +  +F  ++  F+S  FG A  +++   W     
Sbjct: 131 IGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLP 190

Query: 183 LELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFL 242
           LEL     +I++WT  V    ++ IF+V +  ++   VK YGE EF     K++ I GF+
Sbjct: 191 LELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFI 250

Query: 243 IYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTE 301
           I+   + CG AG  G +G +YW +PGA+       N  E RF G    L++  F++ GTE
Sbjct: 251 IFSIVVNCGGAGHDGYIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTE 305

Query: 302 LVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTS 360
           L  ++  E  NPRK+ P A K+ ++RIL  Y+ +++ IG  VP+ND +L  A  S    S
Sbjct: 306 LYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS 365

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420
           P+++A    G +V+PHI NAVIL  +IS ANS++Y   R+L  L++   APKF +   + 
Sbjct: 366 PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDRE 425

Query: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480
           G P  A+ A ++FG +A+   S    +VF WL  I G++  F W  I +SH+RF QA+K 
Sbjct: 426 GRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKL 485

Query: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540
           +G   +E+ + A      + Y   F +++ + Q + +  P  + +    ++   +L   I
Sbjct: 486 QGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPIT-AQSFFESYLAFPI 544

Query: 541 WILFELIFRC-----RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK------TLWDK--- 584
           WI F   +        F+  ++ +D+D  RR  D E +  E+ E K       +W K   
Sbjct: 545 WIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKW 604

Query: 585 FW 586
           FW
Sbjct: 605 FW 606

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  261 bits (668), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/534 (30%), Positives = 275/534 (51%), Gaps = 20/534 (3%)

Query: 59  VNGQDTFSMEEDIQDEDEGEVQN--AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
           V  ++  +++E I+   +G + N   ++K+ LK RH                     L  
Sbjct: 22  VQLEEGVTLDETIK---QGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKK 78

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176
            GPVG LI+Y+ +G +      ++ E+A+F+P T +    S++F+  A G      + F 
Sbjct: 79  TGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTFG 132

Query: 177 WAVTFAL----ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVAS 232
           W  T++     ELS    V+ +WT   P A +I+IF V+    N++ +++YGE E++   
Sbjct: 133 WISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGW 191

Query: 233 IKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLIN 292
           +K+  I   +I    +  G      +GF YWRNPG +   ++    +  +F+G+ ++L +
Sbjct: 192 LKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLV--GGDTGKFVGFWAALSS 249

Query: 293 AAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTS 352
             +++ G + + I AGE  N R  +    K V  RI+  Y+ ++  + L+VPYND  + +
Sbjct: 250 VVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIAT 309

Query: 353 ATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPK 412
            +    +SPF+IA+E +G KVLPHI NA+ILT+  SA N  I  GSR LF L+    APK
Sbjct: 310 GSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPK 369

Query: 413 FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHI 472
            F KT+K G+P++ V   S F  LAYM  S     VF+W   +        W+ IS +HI
Sbjct: 370 IFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHI 429

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAY 531
              +AL+ +G SR +LP+   + P  A+++     + +L  GF +F    F+  +F + Y
Sbjct: 430 HMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRY 489

Query: 532 ISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKF 585
             + L +A++  ++L  + R++ +  +VD+ S   DI       PE   LW + 
Sbjct: 490 FIIPLAIALFTFWKLFKKTRYL-RPHEVDLQSIFEDIRENPEYIPETTPLWKRL 542

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  261 bits (668), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 177/529 (33%), Positives = 280/529 (52%), Gaps = 30/529 (5%)

Query: 42  KDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXX 101
           K ++   +Y   S+  GVN   T   E +I+++         + R LK RH         
Sbjct: 19  KKQQDHLIYETTSY--GVNEVYTIDPEANIRED---------LTRALKPRHINMISIAGI 67

Query: 102 XXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L   GP    I+Y  +G + Y     L EM+T++P++ SF  ++++F 
Sbjct: 68  IGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSFCTYAKKFG 127

Query: 162 SPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW---TYAVPLAAWISIFWVIITAMNMF 218
           S +F  A  + YWF+ AV+ A +L+ +  V+ +W   +   P  A   IFW  + ++N+ 
Sbjct: 128 SDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVI 187

Query: 219 PVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKN 277
            V++YGE E+W+A +KVIAII F I    +  G       +GF+ W          + + 
Sbjct: 188 HVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWT---------VGEA 238

Query: 278 KNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLL 337
                F G+ S  ++A+F + GTE + +T+GE+ NP +  P+ +K V +RIL FYIG+  
Sbjct: 239 PFVDGFKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTF 298

Query: 338 FIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           FI + VPYN P L+S +  V TSPF I  + +GT       NAVI+T++ISA N  ++ G
Sbjct: 299 FIAMNVPYNYPGLSSGS--VVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHALFAG 356

Query: 398 SRVLFGLSKSKLAPK-FFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNIT 456
           SR+++ +      PK   S+T +  VPY+AV  T   G L +  +  G G ++ WL NI 
Sbjct: 357 SRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIV 416

Query: 457 GVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFT 516
           GV+   AWL I+++ IRF Q L+ +  +  EL FK    P   Y+    +  IIL+QG++
Sbjct: 417 GVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPFGPYFLVVAVTFIILVQGWS 475

Query: 517 SFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565
           SF P +N  NF + YI +F+F   +I++ L  R  FV K +D+D  +D+
Sbjct: 476 SFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKRDPFV-KCKDMDFVTDK 522

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  261 bits (667), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 156/468 (33%), Positives = 241/468 (51%), Gaps = 18/468 (3%)

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
           +E D  +E +    ++ VKR LK RH                     L   GP+  L+ +
Sbjct: 28  LETDSLNEFD---PHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGF 84

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
             +G + +S+ +S+GE+ T  P    F   ++RF S    A +GY Y   +    A E +
Sbjct: 85  GIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYN 144

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
            +  ++QFW   VP+  +  IFW       +  V  +GE E+W+A  K++ ++ F I+  
Sbjct: 145 TISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSI 204

Query: 247 CMVCGAGVTG--PVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
             + G G+ G  P+GF+YW+NPGA   G          F G     +  +  + GTE V 
Sbjct: 205 VYMSG-GIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVA 253

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFII 364
           + A E+ NPRK VP A+++  +RIL  Y+G   F G+ VPYNDP L + T  +  SP  I
Sbjct: 254 LAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLK-SPISI 312

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPY 424
           A+  +G     H+ NA IL T ISA NS++Y+GSR L  L+   LAP+  + T K GVP 
Sbjct: 313 ALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPV 372

Query: 425 IAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGIS 484
            A+   +  G ++ M  S G    + +++N++GV  F  W  IS++H+RF +A   +G S
Sbjct: 373 PALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRS 432

Query: 485 RDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYI 532
             ELP++A   P    ++    + + LIQG+TS  P F   +F+ AYI
Sbjct: 433 LSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI 479

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 169/563 (30%), Positives = 282/563 (50%), Gaps = 27/563 (4%)

Query: 39  LSLKDEKSKELYPLRS----------FPNGVNGQDTFSMEEDIQDEDEGEVQNAE-VKRE 87
           LS   EKS  ++PL S          F +     +    + D++D  +    + + +K+ 
Sbjct: 22  LSEITEKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKHADSDLEDGSKSITSDDDHMKKA 81

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147
           +K RH                     L  AGP   ++ Y  +  + Y + Q+ GEMA   
Sbjct: 82  MKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTY 141

Query: 148 P-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWIS 206
           P + +SF  ++  F+S  FG A  +++   W     LEL      I++W   +    +I 
Sbjct: 142 PTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIV 201

Query: 207 IFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRN 265
           IF+V +  ++ F VK YGE EF   S K++ I GF+I    + CG AG  G +G +YW N
Sbjct: 202 IFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWIN 261

Query: 266 PGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325
           PGA+     +     ARF G    L+   F++ GTEL  ++  E  NPRK+ P A K+ +
Sbjct: 262 PGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSI 316

Query: 326 FRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIAIENSGTKVLPHIFNAVILT 384
           +RIL  Y+ +++ IG  VP++  +L  A  S    SP+++A    G KV+PH  NAVIL 
Sbjct: 317 YRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILI 376

Query: 385 TIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTG 444
           +++S ANS +Y   R++  L++   APK+F+   + G P  A+    +FG + ++  S  
Sbjct: 377 SVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQ 436

Query: 445 GGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATF 504
             + F WL  I G++  F W  I +SHIRF  A+K +G S +EL ++A      + Y+ F
Sbjct: 437 EEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVF 496

Query: 505 FMVVIILIQGFTSFTP-----TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIED 558
           F +++ + Q + + +P      ++   F  +Y++  L+L  +  + +  R   F+  ++ 
Sbjct: 497 FNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDK 556

Query: 559 VDIDSDRR--DIEAIVWEEPEPK 579
           +D+D  RR  D E +  E+ E K
Sbjct: 557 IDLDFHRRIYDPELLRQEDAETK 579

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  260 bits (665), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 156/512 (30%), Positives = 263/512 (51%), Gaps = 21/512 (4%)

Query: 68  EEDIQDEDEGEVQNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
           +ED  D ++   + +E   +++ +K RH                     +  AG  G LI
Sbjct: 6   KEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLI 65

Query: 125 SYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFAL 183
            YL +G +     QS+GE+    P +   F  + ++F+ P+ G    +++   W V   L
Sbjct: 66  GYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPL 125

Query: 184 ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLI 243
           EL      I++W   +  + ++S F+++I  +N F    Y E EF    +KV+ +  F++
Sbjct: 126 ELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIV 185

Query: 244 YCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTEL 302
               ++ G  G +GP+GF+Y + PGA+       N N   F     +L+NAAF+  G E 
Sbjct: 186 LGIVIITGGLGNSGPIGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEF 238

Query: 303 VGITAGEAA--NPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVST 359
           + ++A E    N  K++ RA ++V  R+  FY+ S+  +GLLVPY+ P L  S +    T
Sbjct: 239 LALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHT 298

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTK 419
           SP++ AI   G +++PHI NAVIL  ++S ANS +Y  SR L  L++   AP++F+   K
Sbjct: 299 SPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNK 358

Query: 420 GGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALK 479
            G P   +  ++I G ++++        VF WLL+I+G++  F W  I ++HIRF  ALK
Sbjct: 359 HGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALK 418

Query: 480 YRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFN-----GVNFLAAYISV 534
            +G S D L +++      +Y AT   VV+I++Q + S  P  N      V F   Y++V
Sbjct: 419 LQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAV 478

Query: 535 FLFLAIWILFELIFRCRFVW-KIEDVDIDSDR 565
            + + +++  +L       W +   VDI++DR
Sbjct: 479 PVAVLLYLGHKLYTNDWTPWIRTHCVDINTDR 510

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  261 bits (667), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/574 (29%), Positives = 287/574 (50%), Gaps = 26/574 (4%)

Query: 20  AGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEV 79
           A T   D+  + + +R    SL   K+   Y  R+F +     +  ++ E   D ++G  
Sbjct: 29  ASTNDDDISIASSQNR----SLSHRKNTSYY--RNFIDSFKRAEHGNLNEKSADLEDGTA 82

Query: 80  Q---NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSV 136
                + +K+ LK RH                     L   GP   +I Y+ +  + Y +
Sbjct: 83  SIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFM 142

Query: 137 TQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
            Q+ GEMA   P +  +F  +   F+S ++G A  +++   W     LEL      IQ+W
Sbjct: 143 IQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYW 202

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGV 254
           T  +    ++ IF+V +  ++   VK YGE EF     K++ I GF+I+   + CG AG 
Sbjct: 203 T-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGN 261

Query: 255 TGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
            G +G +YW  PG++  G        +RF G    L+   F++ GTEL  ++  E A PR
Sbjct: 262 DGYIGGKYWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPR 316

Query: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFIIAIENSGTKV 373
           K  P A KK ++RIL  Y+ +++ IG  VP+N  +L  A  S    SP+++A    G KV
Sbjct: 317 KATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKV 376

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIF 433
           +PHI NAVIL +++S ANS++Y   R+L  L++   APK  +   + G P +A+   ++F
Sbjct: 377 VPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVF 436

Query: 434 GALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAK 493
           G +A++ +S    +VF WL  I G++  F W  I  SH+RF  A+K +    DE+ +KA 
Sbjct: 437 GCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKAT 496

Query: 494 LMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIWILFELIFRC-- 550
                +++ + F V++++ Q + + +P  +G    A ++   +L + IW+ F +++    
Sbjct: 497 AGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYN 556

Query: 551 ---RFVWKIEDVDIDSDRR--DIEAIVWEEPEPK 579
                +  +  +D+D+ RR  D + I  E+ E K
Sbjct: 557 KEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENK 590

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/548 (29%), Positives = 279/548 (50%), Gaps = 28/548 (5%)

Query: 60  NGQDTFSMEEDIQDEDEG----EVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
           N +  + +++ I  ED      E Q  +V R+LK RH                     L+
Sbjct: 39  NEKSAYQVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALS 98

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQR--FLSPAFGAANGYMY 173
             GP   LISY+ M    + +   L EM   +P++   ++F+    +L+       G   
Sbjct: 99  VCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINL 158

Query: 174 WFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASI 233
           +++ ++    E++    +IQ+WT A   A +ISIF V+  ++ M PV ++GE EFWV+ I
Sbjct: 159 FYAMSMIAPSEITATAILIQYWTDANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSII 217

Query: 234 KVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLI 291
           K+  I G +I    +  G        +GF YW++PGA+ P ++  N    +FL   +++I
Sbjct: 218 KLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPGNT--GKFLACWTAII 275

Query: 292 NAAFTFQGT-ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
            + F++    E+V   A EA +PR+ +PR  ++ V+R+  FY+   L IG++V Y++ +L
Sbjct: 276 KSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRL 335

Query: 351 TSAT----SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSK 406
            +A     S  + SPF+I I+  G +VLPHI NA ILT+  S   S +Y  SRVL  ++ 
Sbjct: 336 LNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAV 395

Query: 407 SKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLF 466
           +   PK F+ T + G PY +  A S+F  LAY+  S     VF WL NI  ++GF  W+ 
Sbjct: 396 NGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWML 455

Query: 467 ISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGV 525
           + V ++RF + +++  ++ D++PF+ + M  LAY +  F  ++ L  G+  F    +N  
Sbjct: 456 VCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVS 514

Query: 526 NFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE-------P 578
           +F A Y ++ L   ++I   + ++     K+ D+D  +     +  + +E E       P
Sbjct: 515 DFFACYTTLGLAAVLYIGAAIYYK---TIKLRDLDEVAAEIIPKIAMADEEEKGEVPIVP 571

Query: 579 KTLWDKFW 586
           K   +K W
Sbjct: 572 KNWLEKVW 579

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 157/525 (29%), Positives = 267/525 (50%), Gaps = 23/525 (4%)

Query: 69  EDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLF 128
           E ++  D    Q  ++K+ +K RH                     L   GP G +I Y+ 
Sbjct: 62  ETVRTNDYNATQK-KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVT 120

Query: 129 MGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187
             ++ Y V Q+  E+  ++  +  ++  +    +   F  A  ++Y   WA+   LEL  
Sbjct: 121 TSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVT 180

Query: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247
               I++W  ++    +++IF+  I  ++ F  + Y E EF   S KV+ ++GF+I    
Sbjct: 181 SSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGIS 240

Query: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307
           + CGA  +G +G +YW  PGA+        K    F G  S  + +AF + G+E + +TA
Sbjct: 241 VNCGASKSGYIGGKYWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTA 295

Query: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVST--SPFIIA 365
            E  NPRK+VP+A K+ ++R+L  ++  ++ +G LVPY+ P L  +    ++  SPF+IA
Sbjct: 296 AEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIA 355

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
             + G KV+PHI NAVIL ++IS  NS  Y   R+L  L++  + PK F+   + G P +
Sbjct: 356 AASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLV 415

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
            +   +IFG ++++  S     VF WL  I  ++  F W  IS+SHIRF  A+K +G S 
Sbjct: 416 TMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSL 475

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG-----VNFLAAYISVFLFLAI 540
            EL +KA      ++YA  F ++++  Q + +  P  NG      NF   Y++  + +  
Sbjct: 476 GELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFF 535

Query: 541 WILFELIFRCRFVWKI----EDVDIDSDRR--DIEAIVWEEPEPK 579
           +  ++L +R    WK+    + VD++S R+  D + I  E+ E K
Sbjct: 536 YFGYKLWYRD---WKLFIPADKVDLESHRKIFDADLIKQEDFEHK 577

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  260 bits (664), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 170/544 (31%), Positives = 281/544 (51%), Gaps = 25/544 (4%)

Query: 55  FPNGVNGQ--DTFSMEEDI--QDEDEGE-VQNAEVKRELKQRHXXXXXXXXXXXXXXXXX 109
           F  G+ G+  D++    DI  QD+ EG+ V NA +K+ LK RH                 
Sbjct: 66  FQRGILGRVVDSYR-RADIPGQDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIA 124

Query: 110 XXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAA 168
               L+NAGP   LI Y  +    Y + Q+ GE+A   P +  SF  ++ + +S  FG A
Sbjct: 125 NGKGLSNAGPAPLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFA 184

Query: 169 NGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEF 228
             ++++  W   F +EL  +   ++FWT  V    ++ IF+V +  ++   V+ YGE EF
Sbjct: 185 TTWLFFVQWLTMFPMELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEF 244

Query: 229 WVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWV 287
           ++   KV+ +IGF+I+  C+  G AG +G +G +YW +PGA+       +  E RF G  
Sbjct: 245 FLNLFKVLMVIGFVIFAICVAAGGAGDSGYIGAKYWHDPGAF-----VSHTAEGRFKGVC 299

Query: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347
             L++A F++ GTEL  ++  E  NPRKT+P A K  ++RI+  Y+ +++ +G  VP N 
Sbjct: 300 YVLVSAYFSYGGTELFVLSVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNH 359

Query: 348 PKLTSA----TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFG 403
           P+L  +        S SP+++A      +VLPH  NAV++  ++S +NS +Y   R++  
Sbjct: 360 PRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICS 419

Query: 404 LSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFA 463
           L++    PK+F    + G P  A+    I G +A+  +S     +F+WL  I G++  F 
Sbjct: 420 LAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFT 479

Query: 464 WLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTF 522
           W  I +SH+RF  A+K +G   +EL +K+      + Y  FF +++   Q + + + P  
Sbjct: 480 WSSIMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNS 539

Query: 523 NGVNFLAAYISVFLFLAIWILFELIFRC-----RFVWKIEDVDIDSDRR--DIEAIVWEE 575
            G    + +   +L L IW+ F + F        F+  +  VD+DS RR  D E +  E+
Sbjct: 540 GGKCSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQED 599

Query: 576 PEPK 579
            E K
Sbjct: 600 EEHK 603

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  259 bits (661), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 162/561 (28%), Positives = 287/561 (51%), Gaps = 36/561 (6%)

Query: 31  QTHHRRGSLSLKDEKS----KELYPLRSFPNGVNGQDTF---SMEEDIQDEDEGEVQ--- 80
           Q      S+S+ ++K+    + ++   ++P  +  +DT    S E+   D   G+ +   
Sbjct: 4   QQEQYPESISMGNDKNMYKPETMFGTMNWPK-LMSKDTLISDSSEDITNDSTTGKTEKGH 62

Query: 81  ----NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSV 136
               N ++K+ +K  H                     +++AG  G L+ Y  +GS+    
Sbjct: 63  TGSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCC 122

Query: 137 TQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195
            QS+GE+    P +   F  + +RF+ P+FG    +++   W +   LEL      I++W
Sbjct: 123 MQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYW 182

Query: 196 TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GV 254
             ++  + +++IF+ +I  ++ F  + Y + EF     KV+ I GF+I    +  GA G 
Sbjct: 183 NNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGT 242

Query: 255 TGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAA--N 312
           +G +G +Y + PGA+             F    S+L+NA F+  G E + ++A E A  N
Sbjct: 243 SGYIGIKYLKTPGAF--------NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGN 294

Query: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-SATSYVSTSPFIIAIENSGT 371
             K++ RA  +V+ R+  FYI S+  IGLLVPYN P+L  S++  + +SP++IA+ + G 
Sbjct: 295 ISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGV 354

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATS 431
           KV+PH+ NAVIL  ++S ANS +Y  SR L  L++   AP +F+K    G P+  +  + 
Sbjct: 355 KVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSG 414

Query: 432 IFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFK 491
           +FG L+++        VF WLL+I+G++  F W  I V+H+RF  A+K +  S +EL  +
Sbjct: 415 VFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHR 474

Query: 492 AKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG------VNFLAAYISVFLFLAIWILFE 545
           A      +YY      + +++Q + S  P  +G      VNF   Y++V   L +++  +
Sbjct: 475 AWSGIYGSYYVIAINSLTLVVQFWVSLFP-LDGDGRPDFVNFFQNYMAVPFALCLYVGHK 533

Query: 546 LIFRC-RFVWKIEDVDIDSDR 565
           +  R  +F+   + +D+D+ R
Sbjct: 534 IYTRSWQFIIPADKIDVDTSR 554

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  258 bits (660), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 149/455 (32%), Positives = 230/455 (50%), Gaps = 14/455 (3%)

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
           M +  +   +G   +  +K+ LK RH                     L   GP+  +I +
Sbjct: 56  MVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGW 115

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W  +VP  AW++IF+  I  +N+  V+ +GE EF  + IKV+ IIGF+I C 
Sbjct: 176 AAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCV 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G  +  + A+++  GTE+  +
Sbjct: 236 VLICGGGPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IA
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIA 342

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
           I   G K LP + NAVIL +++S  NS I+  SR L  ++   L P+ F    + G P +
Sbjct: 343 IRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLV 402

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
            +     FG LA++  S+    VF WL+ I G+A    WL I+VSHIRF  A+K +G+S 
Sbjct: 403 GILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSL 462

Query: 486 DELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP 520
           DEL F + +    + Y+    V+I++ Q + S  P
Sbjct: 463 DELEFVSAVGVYGSVYSATINVLILVAQFYVSLWP 497

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/537 (30%), Positives = 276/537 (51%), Gaps = 31/537 (5%)

Query: 62  QDTFSMEEDIQDEDEGEVQN--AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
            D  S+EE ++    G + N   ++K+ LK+RH                     L   GP
Sbjct: 28  HDIVSVEETVK---RGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGP 84

Query: 120 VGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAV 179
           VG LI+YLF+G +      ++ E+A+F+P T +    +++F+  + G      + F W  
Sbjct: 85  VGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWIS 138

Query: 180 TFAL----ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKV 235
           T++     ELS    ++++WT   P A +I++F ++    N++ +++YGE E+    +K+
Sbjct: 139 TYSSLMPGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKL 197

Query: 236 IAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINA 293
           + I   +I    +  G G  G   +GF YWR PG +   ++  +    +F+G+ +++ + 
Sbjct: 198 VLIFILIISGLVIDLG-GTKGQERLGFHYWREPGPFANYLVGGHI--GKFVGFWAAISSV 254

Query: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA 353
            +++ G + + I AGE  N R  +    K V  RI+  Y+ ++  + L+VPYND  + + 
Sbjct: 255 VYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATG 314

Query: 354 TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKF 413
           T    +SPF+IA+  +G KVLPHI NA+ILT+  SA N  I  GSR LF L+    APK 
Sbjct: 315 TGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKI 374

Query: 414 FSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIR 473
           F +T+K G+PY+ V   S F  LAYM  S     VF W   +        W+ IS +HI 
Sbjct: 375 FLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIH 434

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTP-TFNGVNFLAAYI 532
             +ALK +G SR +LP+   + P  A+++     + +L  GF +F    F+  +F   Y 
Sbjct: 435 MDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYF 494

Query: 533 SVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPE----PKTLWDKF 585
            + L + ++  ++L  + +++ +  +VD++S   DI+    E PE     K  W +F
Sbjct: 495 IIPLAIGLFTFWKLFKKTKYL-RPHEVDLESIFDDIK----ENPEHIVKTKNAWARF 546

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  256 bits (654), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 161/531 (30%), Positives = 269/531 (50%), Gaps = 36/531 (6%)

Query: 63  DTFSMEEDIQ---DEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGP 119
           D+F    D+      D  +   A++K+ +K RH                     L  AGP
Sbjct: 41  DSFRRGRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGP 100

Query: 120 VGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178
            G ++ Y+   ++ Y + ++ GE+   +  +T ++T +S   + PA G +  ++Y   W 
Sbjct: 101 AGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWM 160

Query: 179 VTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAI 238
             F L+L     +IQ+WT   P   +++I + +I  +N+F  K Y E EF+    KV+ I
Sbjct: 161 TVFPLQLVTAAMIIQYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMI 219

Query: 239 IGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTF 297
           IGF+I    + CG AG +G +G +YW  P  +  G          F G       AAF +
Sbjct: 220 IGFVILGVVINCGGAGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAY 269

Query: 298 QGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYV 357
            G E++ ++A E  NPRK++  A KKV++RI+  Y+ + + +  LVP + P L S  S  
Sbjct: 270 GGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS-- 327

Query: 358 STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKT 417
             SP +IA+   G K++PHI NAVIL  ++S  NS++Y   R+L  L++   APK F+  
Sbjct: 328 RASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYI 387

Query: 418 TKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQA 477
            + G P  A F   +FG LA++  S     VF WLL I+G++  F W+ I +SHIRF  A
Sbjct: 388 DRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDA 447

Query: 478 LKYRGISRDELPFKAKLMPGLAYYATFFMVV----IILIQGFTSFTPT----FNGVNFLA 529
           +K +G S  E+ +KA+      Y+ ++  VV    I++ Q + + +P      +  +F  
Sbjct: 448 MKAQGRSMGEVGYKAR----TGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQ 503

Query: 530 AYISVFLFLAIWILFELIFRC-RFVWKIEDVDIDSDRRDIEAIVWEEPEPK 579
           +Y++  + L  +  +++  +  R      +VD+ S R+     V++E E K
Sbjct: 504 SYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQ-----VFDEDELK 549

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  256 bits (654), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 268/524 (51%), Gaps = 24/524 (4%)

Query: 62  QDTFSMEEDIQD--EDEGEVQNA--------EVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           +D+F   + ++D  E EG+ + A        ++K  +K RH                   
Sbjct: 39  KDSFKRADVVEDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASG 98

Query: 112 XPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANG 170
             L   GP G LI YL   ++ Y V Q+  E+   +  +  ++  +    +   FG A  
Sbjct: 99  KALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVA 158

Query: 171 YMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWV 230
            +Y   WA+   LEL      I++WT +V    +++IF++ I  ++ F  + Y E EF  
Sbjct: 159 LVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIF 218

Query: 231 ASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSL 290
            ++KV+ + GF+I    + CGA   G +G +YW NPG +     +  ++     G  S  
Sbjct: 219 NTLKVLLMAGFIIMGISLNCGASKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVW 273

Query: 291 INAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           + +AF + G+E + +TA E ANPR++VP A K+ ++R++  ++  +  I  LVPY   +L
Sbjct: 274 VQSAFAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQL 333

Query: 351 --TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSK 408
             +S  S    SPF+IA    G K++PHI NA+ILT++IS  NS +Y   R+L  L+++ 
Sbjct: 334 LSSSGASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENG 393

Query: 409 LAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFIS 468
           L PK F+   + G P   +    +FG L+++  S     VF WL  I G++  F W  I+
Sbjct: 394 LCPKIFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIA 453

Query: 469 VSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPT-----FN 523
           +SHIRF  A+K +G S  EL + +      +YYA FF +V+++ Q + +  P       +
Sbjct: 454 LSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELD 513

Query: 524 GVNFLAAYISVFLFLAIWILFELIFR-CRFVWKIEDVDIDSDRR 566
             +F   Y++  + +  ++ +++ +R  + +  ++ +D+++ R+
Sbjct: 514 AESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  255 bits (651), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 173/556 (31%), Positives = 283/556 (50%), Gaps = 31/556 (5%)

Query: 43  DEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQN--AEVKRELKQRHXXXXXXXX 100
             + KE     ++   V   D  S +E ++   +G + N   ++K+ LK+RH        
Sbjct: 4   SSQDKEKVKATAYEADVEDCDIRSTDETLK---QGVLHNDRTKLKQGLKERHIKMLTLVG 60

Query: 101 XXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF 160
                        L   GPVG LI+YLF+G +      ++ E+A+F+P T +    +++F
Sbjct: 61  VFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQF 120

Query: 161 LSPAFGAANGYMYWFSWAVTFAL----ELSVVGQVIQFWTYAVPLAAWISIFWVIITAMN 216
           +  + G      + F W  T++     ELS    ++++WT   P A +I+IF V+    N
Sbjct: 121 IDESVG------FTFGWISTYSSLMPGELSATAVIMRYWTDISP-AVFITIFGVLFVVTN 173

Query: 217 MFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP--VGFRYWRNPGAWGPGII 274
           ++ +++YGE E+    +K+I I   +I    +  G GV G   +GF YWR+PG +   I+
Sbjct: 174 IYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLG-GVKGQERLGFHYWRDPGPFAEYIV 232

Query: 275 SKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIG 334
             +    +F+G+ S+L +  +++ G + + I AGE  N R  +    K V  RI+  Y+ 
Sbjct: 233 GGSI--GKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLV 290

Query: 335 SLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNI 394
           ++  + L+VPYND  + S T    +SPF+IA+  +G KVLPHI NA++LT+  SA N  I
Sbjct: 291 TVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAI 350

Query: 395 YVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLN 454
             GSR LF L+    APK F KT+K G+PY+ V   S F  LAYM  S     VF W   
Sbjct: 351 IEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQE 410

Query: 455 ITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQG 514
           +        W+ IS +HI   +ALK +G SR +LP+   + P  A+++     + +L  G
Sbjct: 411 LVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGG 470

Query: 515 FTSFTP-TFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVW 573
           F +F    F+  +F   Y  + L + ++  ++L  + R++ + E+VD+ S   DI     
Sbjct: 471 FYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYL-RPEEVDLASIFDDIR---- 525

Query: 574 EEPE----PKTLWDKF 585
           E PE     K +W + 
Sbjct: 526 ENPEHIEKSKPIWARL 541

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  256 bits (654), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 172/567 (30%), Positives = 277/567 (48%), Gaps = 27/567 (4%)

Query: 30  SQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEG---EVQNAEVKR 86
           ++ H R+ ++ +K+++ K        P     ++    E ++   DE    E   A++K+
Sbjct: 91  AKPHKRKFNIEIKNKRIKNWIDSFKPP-----EECMESELELNSIDENGHREKPRAQLKK 145

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATF 146
            +K RH                     L+ +GP   +I Y  +  + Y + Q+ GEM   
Sbjct: 146 TMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVA 205

Query: 147 IP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWI 205
            P +  +F  +   FLS   G A  ++    W     LEL      I++WT ++    ++
Sbjct: 206 YPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTTSISPDVFV 265

Query: 206 SIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG-AGVTGPVGFRYWR 264
            IF+V +  ++ F    YGE EF     K++ IIGF+I    + CG AG  G +G +YW 
Sbjct: 266 VIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWH 325

Query: 265 NPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324
            PGA+    + KN + +RF      L+ A F++ GTEL  +T  E  NPRK+ P A K  
Sbjct: 326 TPGAF----VGKN-SASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTT 380

Query: 325 VFRILTFYIGSLLFIGLLVPYNDPKLTSATSY----VSTSPFIIAIENSGTKVLPHIFNA 380
           ++RIL  Y+ +++ +G  VPY++  L SATS     +S SP+++A    G KV+PH  NA
Sbjct: 381 IYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINA 440

Query: 381 VILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYME 440
           V+L  +IS ANS  Y   R++  L++  +APKF +   + G P   +   S+ G + +  
Sbjct: 441 VVLIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAA 500

Query: 441 TSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S    +VF WL  I G+A  F W    +SHIRF  A+K +G   +E+ +KA      + 
Sbjct: 501 ASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSI 560

Query: 501 YATFFMVVIILIQGFTSFTPTFNGVNFLAA-YISVFLFLAIWILFE----LIFRCRFVWK 555
               F V++++   + S TP   G N  A  +    L L IWI F     +I +   +W 
Sbjct: 561 IGACFNVLVLIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWN 620

Query: 556 -IEDVDIDSDRR--DIEAIVWEEPEPK 579
            IE +D+D  R+  D E +  E+ E +
Sbjct: 621 PIESIDLDYCRKIYDPEQLKREDEENR 647

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  253 bits (645), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 187/562 (33%), Positives = 290/562 (51%), Gaps = 35/562 (6%)

Query: 39  LSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDE---DEGEVQNAEVKRELKQRHXXX 95
           +SLK+++  E+  + +         + S+  D QD    + G V+   + R L  RH   
Sbjct: 1   MSLKNDQEVEVIGIAT---------SQSLSSDTQDAGALNRGHVRE-NLNRSLTPRHINM 50

Query: 96  XXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTV 155
                             L N GP   LI+Y  +G + Y +   LGEM+TF+P++ SF  
Sbjct: 51  ISIAGVIGTGLYLGTGKALANGGPASLLINYGIIGLVVYLIMLCLGEMSTFMPISGSFCS 110

Query: 156 FSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW---TYAVPLAAWISIFWVII 212
           ++++F S +        YWF+ AV+ A +L+ +  ++ +W       P  A   IFW  +
Sbjct: 111 YAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDYWKNPNSHFPYWAASLIFWFAL 170

Query: 213 TAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGP 271
             +N+  V+ YGE E+W+A +KVIAII F I    +  G       +GF+ W    A  P
Sbjct: 171 LLLNVVHVRVYGEAEYWLALLKVIAIIMFFIISIIVNAGHNSDHAYIGFKNWGVGDA--P 228

Query: 272 GIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTF 331
            +         F G+ S  ++++F F GTE + +TAGEA NP +  P+ IK V +RIL F
Sbjct: 229 FV-------NGFKGFASLFVSSSFAFGGTESITLTAGEAVNPVRNTPKIIKTVFWRILIF 281

Query: 332 YIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN 391
           Y+ +  FIG+ VPYN P L+  +  V TSPF I  +  G++      NAVILT++ISA N
Sbjct: 282 YVFTAFFIGMNVPYNYPNLSEKS--VMTSPFTIVFQMVGSRGAGSFMNAVILTSVISAGN 339

Query: 392 SNIYVGSRVLFGLS-KSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFA 450
             ++ GSRVLF +  +    P F +KT +  VPY+AV  T   G L +  +  G G ++ 
Sbjct: 340 HALFAGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLITWAAGGLCFGSSFIGAGTLWT 399

Query: 451 WLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVII 510
           WL NI GV+   AWL ISV  IRF + L  +G +  EL F     P   Y+   F+  II
Sbjct: 400 WLQNIVGVSNQLAWLCISVISIRFRRGLARQGKTH-ELQFVNWTYPYGPYFLVVFVTFII 458

Query: 511 LIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRR---D 567
            +QG++SF P ++  +F + YI + +F+A++  + L  R  FV K +++D  +D+    +
Sbjct: 459 FVQGWSSFAP-WSVSDFFSYYIELIVFVALYAFWWLWKRDSFV-KSDEMDFVTDKYVSPE 516

Query: 568 IEAIVWEEPEPKTLWDKFWNVV 589
            E ++ E  +    W K   VV
Sbjct: 517 EEVLLNERLDNLKGWKKVRQVV 538

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  254 bits (648), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 161/524 (30%), Positives = 265/524 (50%), Gaps = 17/524 (3%)

Query: 68  EEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
            ED++D       + + K+ L  RH                     L   GP   +I Y+
Sbjct: 61  SEDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYV 120

Query: 128 FMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
            +  + Y + Q+ GEMA   P +  +F  +   F+S ++G A  +++   W     LEL 
Sbjct: 121 LVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELI 180

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFP-VKYYGEFEFWVASIKVIAIIGFLIYC 245
                I++W   +    ++ IF+V + A+++   ++ YGE EF   S K++ +IGF+I  
Sbjct: 181 TSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILS 240

Query: 246 FCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVG 304
             +   GAG  G +G +YW  PG++  G        +RF G    L++  F++ GTEL  
Sbjct: 241 IVINAGGAGNDGYIGGKYWHEPGSFAEG-----DATSRFKGICLVLVSGYFSYGGTELYV 295

Query: 305 ITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSAT-SYVSTSPFI 363
           ++  E A PRK  P A KK ++RIL  Y+ +++ IG  VP+N+ +L  A  S    SP++
Sbjct: 296 LSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYV 355

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVP 423
           +A    G K++PH  NAVIL ++IS ANS+++ G R+L  L+    APK  S   + G P
Sbjct: 356 LAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRP 415

Query: 424 YIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGI 483
            +A+  + + G +A++  ++   +VF WL  I G++  F W  I  SH+RF  A+K +G 
Sbjct: 416 LVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGK 475

Query: 484 SRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLA-AYISVFLFLAIWI 542
             +EL +KA      + Y  FF V++++ Q + +  P  NG    A A+   +L   IW+
Sbjct: 476 DINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWV 535

Query: 543 LF---ELIFRCRFVW--KIEDVDIDSDRR--DIEAIVWEEPEPK 579
                 +I+   F     ++ +D+DS RR  D E I  E+ E K
Sbjct: 536 ACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENK 579

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  250 bits (639), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 143/440 (32%), Positives = 220/440 (50%), Gaps = 18/440 (4%)

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
           M +  +  ++G   +  +K+ LK RH                     L   GP+  +I +
Sbjct: 56  MVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGW 115

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W  +V    W++IF+ II  +N+  V+ +GE EF  + IKVI I+GF+I C 
Sbjct: 176 AAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCI 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G    L+ A+++  GTE+  +
Sbjct: 236 VLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IA
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIA 342

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
           I   G   LP I NAVIL +++S  NS I+  SR L  ++   L P+ F    + G P  
Sbjct: 343 IRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLT 402

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
            +    +FG LA++  S   G VF WL+ I G+A    WL I++SHIRF  A+K +G+  
Sbjct: 403 GILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDL 462

Query: 486 DELPFKAKLMPGLAYYATFF 505
           +EL F    + G+  Y + +
Sbjct: 463 EELEF----VSGVGIYGSVY 478

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  250 bits (639), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 143/440 (32%), Positives = 220/440 (50%), Gaps = 18/440 (4%)

Query: 67  MEEDIQDEDEGEVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISY 126
           M +  +  ++G   +  +K+ LK RH                     L   GP+  +I +
Sbjct: 56  MVDSFKPPEDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGW 115

Query: 127 LFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELS 186
              G+        LGE+    PV  +F  +  RFL P+       +Y   W     LE+ 
Sbjct: 116 TIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 187 VVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCF 246
                +++W  +V    W++IF+ II  +N+  V+ +GE EF  + IKVI I+GF+I C 
Sbjct: 176 AAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCI 235

Query: 247 CMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGI 305
            ++CG G     VG +YW +PG    G          F G    L+ A+++  GTE+  +
Sbjct: 236 VLICGGGPKKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACL 285

Query: 306 TAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIA 365
            +GE  +P K +P AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IA
Sbjct: 286 ASGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIA 342

Query: 366 IENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYI 425
           I   G   LP I NAVIL +++S  NS I+  SR L  ++   L P+ F    + G P  
Sbjct: 343 IRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLT 402

Query: 426 AVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISR 485
            +    +FG LA++  S   G VF WL+ I G+A    WL I++SHIRF  A+K +G+  
Sbjct: 403 GILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDL 462

Query: 486 DELPFKAKLMPGLAYYATFF 505
           +EL F    + G+  Y + +
Sbjct: 463 EELEF----VSGVGIYGSVY 478

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  252 bits (643), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 180/528 (34%), Positives = 276/528 (52%), Gaps = 25/528 (4%)

Query: 68  EEDIQDEDEGEVQN---AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
             D+Q + EG+  +     + R L  RH                     L   GP   +I
Sbjct: 21  SSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPASLVI 80

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALE 184
           +Y  +G + Y     LGEM+TF+P++ SF  ++++F S +        YWF+ AV+ A +
Sbjct: 81  NYSIIGLVVYLTMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASD 140

Query: 185 LSVVGQVIQFWTYA---VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGF 241
           L+ +  ++ FW  +    P  A   IFW ++  +N+  V+ YGE E+W+A +KVIAII F
Sbjct: 141 LTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLKVIAIIIF 200

Query: 242 LIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300
            I    +  G       +GF+ W          + +      F G+ S  ++++F + GT
Sbjct: 201 FIISIVVNAGHNQDHSYIGFKNWS---------VGEAPFVNGFKGFASLFVSSSFAYGGT 251

Query: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360
           E + +TAGEA NP +  P+ IK V +RIL FY+ +  FIG+ VPYN PKL+  +  V TS
Sbjct: 252 ESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKLSEKS--VMTS 309

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLS-KSKLAPKFFSKTTK 419
           PF I  +  GTK      NAVILT++ISA N  ++ GSRVLF L  +    P   +KT +
Sbjct: 310 PFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIITKTNR 369

Query: 420 GGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALK 479
             +PY+AV  T   G L +  +  G G ++ WL NI GV+   AWL IS+  IRF + L 
Sbjct: 370 YQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFRRGLA 429

Query: 480 YRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLA 539
            +G +  EL F     P   Y+   F+  IIL+QG++SF P +N  +F + YI + +F+A
Sbjct: 430 KQGKTH-ELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP-WNVTDFFSYYIELIVFVA 487

Query: 540 IWILFELIFRCRFVWKIEDVDIDSDRR---DIEAIVWEEPEPKTLWDK 584
           +++ + L  R  FV + ED+D  +D+      E ++ EE +    W K
Sbjct: 488 LYVFWWLWKRDAFV-RSEDMDFVTDKYISPHEEVLLNEELDNLKGWKK 534

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,826,870
Number of extensions: 2448674
Number of successful extensions: 11628
Number of sequences better than 10.0: 424
Number of HSP's gapped: 10391
Number of HSP's successfully gapped: 439
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)