Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.31.80ON48348324830.0
Skud_5.251.80ON48348322360.0
YEL064C (AVT2)1.80ON48048321920.0
Smik_5.231.80ON48348321060.0
NCAS0J018401.80ON44543814040.0
TDEL0C062101.80ON47948614030.0
ZYRO0F16720g1.80ON49243813111e-178
Kwal_33.133861.80ON46946812731e-172
SAKL0C02574g1.80ON47346512631e-171
Ecym_10841.80ON49542912391e-167
KLTH0F02332g1.80ON46943312271e-165
NDAI0I001301.80ON44443412031e-162
KLLA0C02277g1.80ON46546711381e-152
AFR671W1.80ON48848910441e-137
KNAG0C007801.80ON51346310451e-137
ZYRO0B04026g7.420ON4364392245e-19
YBL089W (AVT5)7.420ON4594082113e-17
KAFR0L019107.420ON4454552104e-17
KLTH0C06006g7.420ON4454532087e-17
Smik_2.317.420ON4594522051e-16
Suva_2.287.420ON4594081999e-16
TPHA0K006707.420ON4643471981e-15
Kwal_27.107027.420ON4674051953e-15
KNAG0B021907.420ON4614661891e-14
Skud_5.2607.420ON4484071892e-14
CAGL0H04587g7.420ON4454021863e-14
KLLA0E06931g7.420ON4564631854e-14
SAKL0F13134g7.420ON5104801865e-14
Skud_2.197.420ON4594091811e-13
Kpol_1045.207.420ON4663081802e-13
Suva_5.2407.420ON4484081802e-13
YER119C (AVT6)7.420ON4484051741e-12
Smik_5.2647.420ON4484061732e-12
TDEL0C028207.420ON4544111703e-12
Ecym_71337.420ON4574101703e-12
CAGL0G03619g7.420ON4603141623e-11
CAGL0M06611g2.295ON4853141581e-10
TBLA0F014007.420ON4533001581e-10
TDEL0G022502.295ON4673351581e-10
TBLA0F01390singletonON4284131571e-10
TBLA0C030305.252ON5234551526e-10
NCAS0B062102.295ON4813141501e-09
SAKL0E07392g2.295ON4722111501e-09
NDAI0E040107.420ON4714651482e-09
KLLA0E08559g2.295ON4603161472e-09
Kpol_1032.885.252ON5754241463e-09
Kwal_27.114852.295ON4713541454e-09
Kpol_1003.442.295ON4704181445e-09
CAGL0E06468g5.252ON6814271455e-09
AER380C2.177ON7164631412e-08
Smik_9.972.295ON4902641375e-08
TPHA0C034602.295ON4733421365e-08
KLLA0E13795g5.252ON5734181366e-08
ZYRO0B09548g2.177ON7184351358e-08
NDAI0C037905.252ON7214251322e-07
KLTH0G10604g2.295ON4683501302e-07
KNAG0A053802.295ON4743301303e-07
AGL285C7.420ON4403961276e-07
NCAS0E024407.420ON4953361268e-07
SAKL0E10362g2.177ON7334411251e-06
YIL088C (AVT7)2.295ON4903591241e-06
Suva_9.1122.295ON4912171232e-06
TPHA0B025305.252ON5964251223e-06
ZYRO0A02112g2.295ON4673061204e-06
KAFR0H036605.252ON6464251205e-06
Skud_11.815.252ON7124391206e-06
Smik_14.2242.177ON7154541189e-06
Smik_11.905.252ON6804351171e-05
NDAI0B035102.295ON4963141161e-05
Ecym_82495.252ON6272981162e-05
TPHA0F017002.177ON4444311152e-05
KLLA0C13277g2.177ON7214851152e-05
Suva_11.795.252ON7194371153e-05
TDEL0F013202.177ON7154301134e-05
YKL146W (AVT3)5.252ON6924391134e-05
Skud_9.862.295ON4901981116e-05
CAGL0G06622g2.177ON7334751117e-05
Kpol_505.52.177ON6874471117e-05
ADL205C2.295ON4681971091e-04
Kwal_23.28395.252ON6144451091e-04
TBLA0B072102.295ON4973311081e-04
KLTH0D09042g2.177ON7184831082e-04
NCAS0F023105.252ON6684251062e-04
KAFR0J013202.295ON4793351053e-04
KNAG0H023305.252ON6434301054e-04
Kpol_1029.62.177ON7674321036e-04
Kwal_26.84012.177ON7204731027e-04
TPHA0B029802.177ON749432990.002
Skud_14.2292.177ON713441960.004
Suva_14.2382.177ON716441930.010
YNL101W (AVT4)2.177ON713441900.021
Ecym_33352.295ON474303890.025
KLTH0G07502g5.252ON601445870.045
NCAS0G026302.177ON705430850.091
TBLA0C056302.177ON742323840.10
SAKL0G12452g5.220ON602195840.10
KAFR0D039401.83ON597128820.18
TDEL0E037405.252ON613166810.23
Skud_15.2915.457ON900102800.32
TBLA0F03230singletonON561221800.34
ZYRO0A10538g5.252ON608427800.37
SAKL0G11462g5.252ON616174790.47
KLTH0F02926g1.106ON37488780.54
KAFR0D020002.177ON714155780.60
NDAI0A006101.83ON565115760.95
KNAG0C033807.420ON545173741.6
CAGL0B04455g2.177ON605152741.8
Ecym_54082.177ON715334732.3
NDAI0F026602.177ON710441732.6
NDAI0I020305.220ON616118713.7
KNAG0I019702.177ON736463697.9
CAGL0D03036g5.220ON622268688.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.3
         (483 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   961   0.0  
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   865   0.0  
YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   848   0.0  
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   815   0.0  
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   545   0.0  
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   545   0.0  
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   509   e-178
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   494   e-172
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   491   e-171
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   481   e-167
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   477   e-165
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   468   e-162
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   442   e-152
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   406   e-137
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   407   e-137
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    91   5e-19
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    86   3e-17
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    86   4e-17
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    85   7e-17
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    84   1e-16
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    81   9e-16
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    81   1e-15
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    80   3e-15
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    77   1e-14
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    77   2e-14
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    76   3e-14
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    76   4e-14
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    76   5e-14
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    74   1e-13
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    74   2e-13
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    74   2e-13
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    72   1e-12
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    71   2e-12
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    70   3e-12
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    70   3e-12
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    67   3e-11
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    65   1e-10
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    65   1e-10
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    65   1e-10
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    65   1e-10
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    63   6e-10
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    62   1e-09
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    62   1e-09
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     62   2e-09
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    61   2e-09
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    61   3e-09
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    60   4e-09
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    60   5e-09
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    60   5e-09
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    59   2e-08
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    57   5e-08
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    57   5e-08
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    57   6e-08
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    57   8e-08
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    55   2e-07
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    55   2e-07
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    55   3e-07
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    54   6e-07
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     53   8e-07
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    53   1e-06
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    52   1e-06
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    52   2e-06
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    52   3e-06
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    51   4e-06
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    51   5e-06
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    51   6e-06
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    50   9e-06
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    50   1e-05
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     49   1e-05
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    49   2e-05
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    49   2e-05
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    49   2e-05
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    49   3e-05
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    48   4e-05
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    48   4e-05
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    47   6e-05
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    47   7e-05
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    47   7e-05
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    47   1e-04
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    47   1e-04
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    46   1e-04
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    46   2e-04
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    45   2e-04
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    45   3e-04
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    45   4e-04
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    44   6e-04
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    44   7e-04
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    43   0.002
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    42   0.004
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    40   0.010
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    39   0.021
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    39   0.025
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    38   0.045
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     37   0.091
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    37   0.10 
SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]...    37   0.10 
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...    36   0.18 
TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.2...    36   0.23 
Skud_15.291 Chr15 complement(523091..525793) [2703 bp, 900 aa] {...    35   0.32 
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               35   0.34 
ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} simila...    35   0.37 
SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} simila...    35   0.47 
KLTH0F02926g Chr6 complement(252354..253478) [1125 bp, 374 aa] {...    35   0.54 
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    35   0.60 
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...    34   0.95 
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    33   1.6  
CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some s...    33   1.8  
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    33   2.3  
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    33   2.6  
NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.2...    32   3.7  
KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {O...    31   7.9  
CAGL0D03036g Chr4 complement(314724..316592) [1869 bp, 622 aa] {...    31   8.4  

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/483 (97%), Positives = 472/483 (97%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60
           MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN
Sbjct: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60

Query: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120
           NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL
Sbjct: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAF           DTIPHVLRAVF
Sbjct: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVF 180

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
           SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP
Sbjct: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI
Sbjct: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360

Query: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420
           LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT
Sbjct: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420

Query: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480
           TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480

Query: 481 CQI 483
           CQI
Sbjct: 481 CQI 483

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/483 (89%), Positives = 456/483 (94%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60
           M+E+G Y+KLENKELRTEFELT+FPL GITDNDSDDGSQGKD PN +YPI SDTDD LVN
Sbjct: 1   MTEVGGYTKLENKELRTEFELTDFPLLGITDNDSDDGSQGKDSPNFVYPITSDTDDPLVN 60

Query: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120
           +VLRENDKKSSMRMAFMNLANSILGAGIITQP AIKNAGI+GGLI+YIALGFIVDWTLRL
Sbjct: 61  SVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRL 120

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           IVINLTLAGKRTYQGTVE+VMGKKGKLLILFTNGLFAF           DTIPHVLRAVF
Sbjct: 121 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVF 180

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
           SQNDGEVHFWLRRNVII++VTIFISFPLSLKRNIEGLSKASFLAV+SMI+IVLTVVIRGP
Sbjct: 181 SQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGP 240

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           MLPYDW+GH+LK  D  +KTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT+LTHI
Sbjct: 241 MLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 300

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           SI+ISVICCGLMG+SGFAAFKEKTKGNVLN+FPGTDTAINVARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFV 360

Query: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420
           LRDVVGN LHECHLIK+YDEHTQLS+KQHTIITS+LVFITM ISLTTCNLGALFELIG+T
Sbjct: 361 LRDVVGNSLHECHLIKSYDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGALFELIGST 420

Query: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480
           TASTMAYILPPYTNLLLTSKKKNWKAKLPYY CICFGFMIMIVSSTQTILDA+NG D QH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAINGADEQH 480

Query: 481 CQI 483
           C+I
Sbjct: 481 CEI 483

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/483 (87%), Positives = 447/483 (92%), Gaps = 3/483 (0%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60
           MSELGEYSKLENKELRTEFELTNFP  G TDNDSDDGSQG++  N I P   D DD LVN
Sbjct: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITP---DMDDTLVN 57

Query: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120
           +VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI+GGL+SY+ALGFIVDWTLRL
Sbjct: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           IVINLTLAGKRTYQGTVE+VMGKKGKLLILFTNGLFAF           DTIPHVLRA+F
Sbjct: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIF 177

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
           SQNDG VHFWLRRNVII+MVT FISFPLS+KRNIE LSKASFLAV+SMI+IVLTVVIRGP
Sbjct: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           MLPYDW+GH+LKLSD F+K TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT+LTHI
Sbjct: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           SI+ISVICC LMGYSGFA FKEKTKGNVLNSFPGTDTAIN+ARLCFGFNMLTTFPMEIFV
Sbjct: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357

Query: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420
           LRDVVGNLLHEC+LIKNYDEHTQLS KQH +ITS LVFITMGISLTTCNLGALFELIGAT
Sbjct: 358 LRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGAT 417

Query: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480
           TASTMAYILPPYTNLLLTSKKK+WK +LP+Y CICFGFMIMI+SSTQTI+DAVNG DGQH
Sbjct: 418 TASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAVNGSDGQH 477

Query: 481 CQI 483
           CQI
Sbjct: 478 CQI 480

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/483 (87%), Positives = 451/483 (93%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60
           M+ELG Y+KLENKELRTEFELT+FPL GITDN+SDD SQGKD    IYPI SDTDD LVN
Sbjct: 1   MAELGAYTKLENKELRTEFELTDFPLPGITDNNSDDRSQGKDSLKAIYPIASDTDDTLVN 60

Query: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120
            VL ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI+GGLISYIALGFIVDWTLRL
Sbjct: 61  KVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRL 120

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           IVINLTLAGKRTYQGTVE+VMGKKGKLLILFTNGLFAF           DTIPHVLRA+F
Sbjct: 121 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIF 180

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
           SQ DG++HFWLRRNVIII+VTIFISFPLSLKRNIE LSKASFLAV+SMI+IV+TVVIRGP
Sbjct: 181 SQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGP 240

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           MLPYDW+GH+L+L D F+KTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT+LTHI
Sbjct: 241 MLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 300

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           SI+ISVICCGLMGYSGFAAFKEKTKGN+LNSFPGTDTAIN+ARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 360

Query: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420
           LRDVVGNLLHEC +IKNYDEHTQLS KQH +ITS+LVFITMGISLTTCNLGALFELIGAT
Sbjct: 361 LRDVVGNLLHECKIIKNYDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALFELIGAT 420

Query: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480
           TASTMAYILPPYTNLLLTSKKK+W AKLP+Y CICFGFMIMI+SSTQTILDAVNG DGQH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAVNGSDGQH 480

Query: 481 CQI 483
           CQI
Sbjct: 481 CQI 483

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/438 (62%), Positives = 337/438 (76%), Gaps = 11/438 (2%)

Query: 51  ISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIAL 110
           + DT ++L   ++ EN+KKS++ MAFMN+ANSILGAGIITQP A+KNAGI+G +I YI L
Sbjct: 14  LPDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILL 73

Query: 111 GFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXD 170
           GFIVDWTLRL+VIN+TL+ K+TYQ TVE+VMGKKGK LIL  NGLFA            D
Sbjct: 74  GFIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGD 133

Query: 171 TIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV 230
           TIPHVLR  F+         + RN++I + T+FIS+PLSL RNI  LSKASFLA++SM+V
Sbjct: 134 TIPHVLRIFFNSEK------ITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVV 187

Query: 231 IVLTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRS 290
           IV TVVIRGP LP + +G  L  S +F   ++F+SLS+ISFALVCHHNTSFIF S+RN+S
Sbjct: 188 IVFTVVIRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKS 247

Query: 291 VAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNM 350
           + KFTKLTHIS+ ISV  C LMGYSGF  F +KTKGN+LN+FP  D  IN+AR+CFGFNM
Sbjct: 248 LTKFTKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNM 307

Query: 351 LTTFPMEIFVLRDVVGNLLHECHLIKNYDEH---TQLSNKQHTIITSMLVFITMGISLTT 407
           LTTFP+EIFVLRDVV  +L ECHL+ + + +     LS K H  IT+ LVF++MGISL T
Sbjct: 308 LTTFPLEIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMT 367

Query: 408 CNLGALFELIGATTASTMAYILPPYTNLLLTSKKK--NWKAKLPYYFCICFGFMIMIVSS 465
           CNLGALFELIG+TTAS MAYILPPY NLLL  ++   ++  KLP+YFCI FGF +MI+SS
Sbjct: 368 CNLGALFELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISS 427

Query: 466 TQTILDAVNGPDGQHCQI 483
           T+TILDAV G + +HC+I
Sbjct: 428 TETILDAVFGTEQKHCEI 445

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/486 (57%), Positives = 367/486 (75%), Gaps = 22/486 (4%)

Query: 7   YSKLENKE----LRTEFELTNFPLS-GITDN-DSDDGSQGKDFPNTIYPIISDTDDQLVN 60
           YS+LE +     L  EFEL +F    G +D  + +D ++ K   +      S  D+ +V 
Sbjct: 7   YSRLEEQSERIPLELEFELVDFDAKPGASDETEENDSNEAKASSSN-----SAIDESMVI 61

Query: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120
           N+LR+NDKKS+MR AFMN+ANSILGAG++ QPFAI+N GIIGG+++YI L  +VDWTLRL
Sbjct: 62  NLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRL 121

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           IVINLTLAGK+TYQ TVE+ +G+KG++L+L +NGLFAF           DTIPH L+++F
Sbjct: 122 IVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIF 181

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
             ++    F+ RRNV+I +VT+FIS+PLSL+RNI  LSKASFLA++SM+VIV +VV++GP
Sbjct: 182 HSSN----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGP 237

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
            +    +G    L+DIFI + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF +LTHI
Sbjct: 238 RVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHI 297

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           S  IS+I C LMGYSG++ F++KTKGN+LN+FP  D  IN+ARLCFGFNMLTTFP+EIFV
Sbjct: 298 STFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFV 357

Query: 361 LRDVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCNLGALFELI 417
           LRDV+   L+     K  ++ T+   LS ++  IIT++ V  TM ISLTTCNLGALFELI
Sbjct: 358 LRDVIAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413

Query: 418 GATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPD 477
           GATTASTMAYILPPYTNL+L+ +   ++ K+P+Y CI FGFM+MIVSSTQTI++ V G D
Sbjct: 414 GATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSD 473

Query: 478 GQHCQI 483
            +HC++
Sbjct: 474 QRHCEL 479

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  509 bits (1311), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/438 (59%), Positives = 328/438 (74%), Gaps = 24/438 (5%)

Query: 53  DTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF 112
           D DD+ VN+V+REN+KKS+M+ AFMN+ANSILGAG+I QP AIKN+GI+G +I+Y+ L  
Sbjct: 72  DNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLFV 131

Query: 113 IVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 172
           +VDWTLRLIVINLTLAGK+TYQ TV + MGK+G++ +L  NGLFAF           DT+
Sbjct: 132 LVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTL 191

Query: 173 PHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIV 232
           PHV RA   QN      +L R +II +VTI IS+PL+L+RNI  LSKASFLA++SM++IV
Sbjct: 192 PHVFRAFIHQNS----VFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIV 247

Query: 233 LTVVIRGPML-----PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMR 287
            TV+IRGP +     P  W        DI +   IFR +SVISFALVCHHNTSFI+FS++
Sbjct: 248 FTVIIRGPEIHAKRDPLTWE-------DILVTPRIFRGISVISFALVCHHNTSFIYFSIK 300

Query: 288 NRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFG 347
           NRS+ KF +LTHIS  ISV+ C +MG+SGFAAF + TKGNVLN+F   D A+N+ARLCFG
Sbjct: 301 NRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFG 360

Query: 348 FNMLTTFPMEIFVLRDVVGNLL--HECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISL 405
           FNMLTTFP+EIFVLRDV+ + +  H+     N D +  LS   H IIT++LVF TM ISL
Sbjct: 361 FNMLTTFPLEIFVLRDVIASFIGGHQ----PNGDPNV-LSKSNHFIITTILVFGTMSISL 415

Query: 406 TTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSS 465
            TCNLGA+FELIGATTAS MAYILPP+ NLLLTS  K ++ KLP++ CI FGF IM++SS
Sbjct: 416 LTCNLGAIFELIGATTASMMAYILPPWVNLLLTS-DKTFRQKLPHFACIAFGFSIMLISS 474

Query: 466 TQTILDAVNGPDGQHCQI 483
            QTILD +NG D + C++
Sbjct: 475 IQTILDTMNGTDEKQCEL 492

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 332/468 (70%), Gaps = 17/468 (3%)

Query: 16  RTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKSSMRMA 75
           R E   ++F LS    N   +  +          +I  ++D+     LREN  KS++ MA
Sbjct: 19  RDELLGSSFQLSSFDRNSQRNSER----------LIDGSEDESTTAFLRENRSKSNIFMA 68

Query: 76  FMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQG 135
           FMN+ANSILGAG+I QPFAIKN G++GG+ + I L  +VDWT+RLIV+N+ + GK TYQ 
Sbjct: 69  FMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQD 128

Query: 136 TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNV 195
           +VE+ MG+KGKLLIL +NGLFAF           DTIPHVLRA F  ++   H    RN+
Sbjct: 129 SVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLFH----RNI 184

Query: 196 IIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGHTLKLSD 255
           III+VT FISFPLSL RNI  LSKAS LA++SM+ IV+ V+++GPM+   ++G +   ++
Sbjct: 185 IIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKG-SFNTTE 243

Query: 256 IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYS 315
           +F    IF+ +SVISFALVCHHNTSFI+FS++  S+ +F +LTH S  +++I C LMGY+
Sbjct: 244 LFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYT 303

Query: 316 GFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLI 375
           GF  FK++TKGN+LN+FPG+D  +NVAR CFGFNMLTTFP+EIFVLRDV+ + +      
Sbjct: 304 GFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS-- 361

Query: 376 KNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL 435
           K+ ++  +LS K H I+T++LV  TM ISLTTCNLGALFEL GATTAS MAYILPP  NL
Sbjct: 362 KDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSVNL 421

Query: 436 LLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQHCQI 483
           LL  K+   + KLP+Y CI FGF IM+VSS+QTI+  + G D +HC++
Sbjct: 422 LLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  491 bits (1263), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/465 (55%), Positives = 333/465 (71%), Gaps = 8/465 (1%)

Query: 18  EFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKSSMRMAFM 77
           +FEL++F    +    +   +  +D         +D +D LV+ ++ EN  KS++ MAFM
Sbjct: 16  QFELSSFD-QHMQPAHASGSAADEDDETKFVDTGADVEDPLVSGIVTENQTKSNIYMAFM 74

Query: 78  NLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTV 137
           N+ANSILGAGII QPFAI N G+ GG+ + + L  +VDWT+RLIV+NL L GK TYQ +V
Sbjct: 75  NMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSV 134

Query: 138 EYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVII 197
           E+ MG++GKLLIL  NGLFAF           DTIPHVLRA F  +    H    RN II
Sbjct: 135 EFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFH----RNAII 190

Query: 198 IMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGHTLKLSDIF 257
             VT+F+S+PLSL R+I  LSKAS LA+ SM++IV+ V+++GPML   ++G +L  S +F
Sbjct: 191 FFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKG-SLTASKLF 249

Query: 258 IKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGF 317
           I   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F KLTH+S ++S++ C +MGYSGF
Sbjct: 250 ITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGF 309

Query: 318 AAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKN 377
             FK+KTKGN+LN+FP  D  INVAR CFGFNMLTTFP+EIFVLRDVV +L H       
Sbjct: 310 LVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS--GE 367

Query: 378 YDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLL 437
                +LS K+H  +TS LVF+TM +SLTTCNLGALFELIGATTAS MAYILPP TNLLL
Sbjct: 368 ATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTNLLL 427

Query: 438 TSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQHCQ 482
           T + K  + KLPYY CI FGF +M++SSTQTIL A+NG + +HC+
Sbjct: 428 TGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  481 bits (1239), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 249/429 (58%), Positives = 311/429 (72%), Gaps = 10/429 (2%)

Query: 55  DDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIV 114
           +D  V+ +   N  KS+M MAFMN+ANSILGAG+I QPFAIKN G+IGG+   + L  IV
Sbjct: 75  EDPNVSQLTNPNRGKSNMYMAFMNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTIIV 134

Query: 115 DWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPH 174
           DWT+RLIVINL L GK TYQ +VE+ MG KGKLLILF NGLFAF           D+IPH
Sbjct: 135 DWTIRLIVINLKLTGKTTYQDSVEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIPH 194

Query: 175 VLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLT 234
           VL+A F  +        RRNV+I +VT+FIS+PLSL RNI  LSKAS LA++S+++IV  
Sbjct: 195 VLKAFFPSHSE----LFRRNVVISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVAL 250

Query: 235 VVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294
           V+IR P +  +++G      + FI   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F
Sbjct: 251 VIIRAPKVEDEYKGQ-FTWEEAFITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRF 309

Query: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354
             LTHIS +IS++ C + GY GF  FK+KTKGN+LN+FP  D  IN AR CFGFNMLTTF
Sbjct: 310 GNLTHISCIISMLVCLIAGYVGFLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTF 369

Query: 355 PMEIFVLRDVVGNLLHECHLIKNYD-EHTQLSNKQHTIITSMLVFITMGISLTTCNLGAL 413
           P+EIFVLRDVV +LL+     ++ D E   L+ K+H I+TS+LVFI+M ISLTTCNLGAL
Sbjct: 370 PLEIFVLRDVVRDLLY----FQSADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGAL 425

Query: 414 FELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAV 473
            EL+G+TTAS  AYILPP T L LT K K  K + PYY CI FGF IMIVSSTQTIL A+
Sbjct: 426 LELVGSTTASLTAYILPPATTLALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAI 485

Query: 474 NGPDGQHCQ 482
            G + +HC+
Sbjct: 486 YGTEIKHCE 494

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  477 bits (1227), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 248/433 (57%), Positives = 319/433 (73%), Gaps = 13/433 (3%)

Query: 53  DTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF 112
           D++D+  +  L E   KS++ MAFMN+ANSILGAGII QPFA+KN G++GG+++ + L  
Sbjct: 46  DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLSL 105

Query: 113 IVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 172
           +VDWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFAF           DTI
Sbjct: 106 LVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGDTI 165

Query: 173 PHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIV 232
           PHVLRA FS +D   H    RN++I++VT  ISFPLSL R+I  LSKAS LA+ SM+VIV
Sbjct: 166 PHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIV 221

Query: 233 LTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292
           + VVI+GP     ++G +   S++ I   IF+ LSVISFALVCHHNTSFI+FS++  S+ 
Sbjct: 222 VIVVIKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLK 280

Query: 293 KFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT 352
           +F +LTH S  I++I C LMG++GF  FK+KTKGN+LN+FPG D A+NVAR CFGFNMLT
Sbjct: 281 RFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT 340

Query: 353 TFPMEIFVLRDVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCN 409
           TFP+EIFVLRDV+ +L     +  N +  +Q   LS K H II++ LVF TM ISLTTCN
Sbjct: 341 TFPLEIFVLRDVIKDL-----MFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCN 395

Query: 410 LGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTI 469
           LGALFELIGATTAS MAYILPP+ NL L      W+ ++P+Y CI FGF IM++SSTQTI
Sbjct: 396 LGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTI 455

Query: 470 LDAVNGPDGQHCQ 482
           +  +NG D +HC+
Sbjct: 456 ISYINGGDQKHCE 468

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  468 bits (1203), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 248/434 (57%), Positives = 320/434 (73%), Gaps = 11/434 (2%)

Query: 55  DDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIV 114
            + LV  ++ EN+KKS++ MAF+N+ANSILGAGIITQP A+KNAG+   ++ YI LGFIV
Sbjct: 17  SEALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVKNAGLCASIVIYIMLGFIV 76

Query: 115 DWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPH 174
           DWTLRL++ N+TL+ K TY  TVEY MG+KGK LIL  NGLFA            DTIPH
Sbjct: 77  DWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLFALGGCIGFCIIIGDTIPH 136

Query: 175 VLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLT 234
           VLR +F  +    HF + RN +I   T+FIS+PLSL R+I  LS  SFLA++SM VIV+T
Sbjct: 137 VLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRDISALSSTSFLALISMTVIVMT 190

Query: 235 VVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294
           VV+ GP LP + +G  +  S      ++FRSLS++SFALVCHHNTSFIF S+RN+S+ KF
Sbjct: 191 VVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCHHNTSFIFHSIRNKSLTKF 250

Query: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354
           TKLTH+S+ ISVI C +MGY+GF  F  KTKGN+LN+FP    AIN+AR+CFGFNMLTT 
Sbjct: 251 TKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNGVAINIARVCFGFNMLTTL 310

Query: 355 PMEIFVLRDVVGNLLHECHLIKNYDEHTQ---LSNKQHTIITSMLVFITMGISLTTCNLG 411
           P+E+FVLRDV+  +L E   I + +E      L+ K H I+T+++VF+TM +SL TCNLG
Sbjct: 311 PLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVTTIIVFLTMSVSLLTCNLG 370

Query: 412 ALFELIGATTASTMAYILPPYTNLLLTSKKKNW--KAKLPYYFCICFGFMIMIVSSTQTI 469
           ALFEL+GATTAS MAYILPPY NLLL  +K+    K+K+P+YFCI FGF +MIVSS QTI
Sbjct: 371 ALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHYFCILFGFTVMIVSSFQTI 430

Query: 470 LDAVNGPDGQHCQI 483
           ++A+   + +HC+I
Sbjct: 431 VEALADNEQKHCEI 444

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  442 bits (1138), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/467 (51%), Positives = 321/467 (68%), Gaps = 11/467 (2%)

Query: 6   EYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRE 65
           +Y+KL   + +++ E   F L  +T  D    +        I+ +  + +D L +++   
Sbjct: 8   KYAKLALSDKQSKNEPNPFELE-LTSFDDTAKTADSAVDQNIFNV--NEEDPLTDDIYLS 64

Query: 66  NDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINL 125
           N+ KS+  MAFMN+ANSILG+G+I QPFA+KN GIIGGL + I +  +VDWT+RLIVINL
Sbjct: 65  NEAKSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINL 124

Query: 126 TLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG 185
            L GK TYQ +VE  MG+ G LLIL +NGLFAF           D+IPHVL A F  +  
Sbjct: 125 KLTGKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTD 184

Query: 186 EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYD 245
             H    RNVII +VT+FISFPLSL R+I  LSK S LA+L +I IV+ +V++ P++  +
Sbjct: 185 LFH----RNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGE 240

Query: 246 WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVIS 305
           ++G T  L  +FI   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+++S
Sbjct: 241 YKG-TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILS 299

Query: 306 VICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVV 365
            I C    YSGF  FK+KT GN+LN+FP  D  IN ARL  GFNMLTTFP+EIFVLRDV+
Sbjct: 300 CIVCLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVI 359

Query: 366 GNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTM 425
            ++++     K+  E  +L+ K H +ITS LV I M I+L+T NLGAL E+IGAT+AS M
Sbjct: 360 RDIIYYN---KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLM 416

Query: 426 AYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDA 472
           AYILPP TNL++T KKK+ K KLPY  CI FG ++M VS+ QTIL+A
Sbjct: 417 AYILPPLTNLVITGKKKSLKEKLPYCGCIVFGVILMFVSTAQTILEA 463

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  406 bits (1044), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 310/489 (63%), Gaps = 20/489 (4%)

Query: 6   EYSKLENKELRTEFELTNFPLSGITDNDS--DDGSQGKDFPNTI-YPIISDT-------- 54
           +YS+L+  E   E      P   +  N    D  S   D    I YP  S T        
Sbjct: 7   QYSRLDGDETGKEGTSVQSPFHTVQLNREWGDPSSSNGDRIELIDYPTKSSTLSSGFDLE 66

Query: 55  DDQLVNNVLRENDKKSSMRMAFMNLANSI-LGAGIITQPFAIKNAGIIGGLISYIALGFI 113
           +D ++  +++E+  K             + L          +KN G++GGL+  + L  I
Sbjct: 67  EDSVLGAIVQESKGKVQYVYGLHEHGEQVSLELVWSGSRLRLKNCGLLGGLVLTMLLTVI 126

Query: 114 VDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIP 173
           VDWT+RLI+INL L GK TYQ TVE+ MG+ GK  +LF NG+FAF           D+IP
Sbjct: 127 VDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANGMFAFGGCVGFCIIIGDSIP 186

Query: 174 HVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVL 233
           HVLRA F  N  E   +  RN+II +VTIF+S+PLSL RNI  LSKAS LA++S+++IV+
Sbjct: 187 HVLRAFF-PNYIE---YFNRNMIITIVTIFVSYPLSLNRNISKLSKASMLALVSLLLIVV 242

Query: 234 TVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 293
            +V+RGP +  D+RG +  L ++F+K  +F+ +SVISFALVC HNTSFI+FS+R  S+ +
Sbjct: 243 IIVVRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALVCLHNTSFIYFSLRKPSLRR 301

Query: 294 FTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTT 353
           F  LTHIS  IS++ C + GYSGF  FK KTKGN+LN+FP +D  IN AR CFGFNMLTT
Sbjct: 302 FNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPSSDNYINFARFCFGFNMLTT 361

Query: 354 FPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGAL 413
           FP+EIFVLRDV+ +L+          E  +LS K+H IIT+ LV  TMGISLTTCNLGAL
Sbjct: 362 FPLEIFVLRDVIRDLIST---ETPKGEPLRLSTKRHFIITTALVLSTMGISLTTCNLGAL 418

Query: 414 FELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAV 473
            EL+G+TTAS  AYILPP TNL+LT +++  K KLP+Y CI FGF IM++SSTQ I+ A+
Sbjct: 419 LELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACILFGFSIMVISSTQAIITAI 478

Query: 474 NGPDGQHCQ 482
           +      C 
Sbjct: 479 HSDKSSQCD 487

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  407 bits (1045), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/463 (48%), Positives = 302/463 (65%), Gaps = 48/463 (10%)

Query: 51  ISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIAL 110
           + + ++ L+  ++  N++KS + MAFMN+ANSILGAGII+QPFA++ AG++G  + YIAL
Sbjct: 19  LHELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIAL 78

Query: 111 GFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXD 170
           GF+VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  NGLFAF           D
Sbjct: 79  GFLVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGD 138

Query: 171 TIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV 230
           TIPHVLR V          ++ RN +II+VT+ IS PLSL + I+ L +ASFLA++SM V
Sbjct: 139 TIPHVLRTVCPPQ------YIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAV 192

Query: 231 IVLTVVIRGPMLPYDWRGH-TLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289
           IV+TV +RGP LP + +   +L     + + TIF+S+S++SFALVCHHNTSFIF S+RN+
Sbjct: 193 IVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNK 252

Query: 290 SVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349
           S+ KF +LTH S  +SV  C LMGY+GF  FKEKTKGNVLN+F G D  INVARL FGFN
Sbjct: 253 SIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFN 312

Query: 350 MLTTFPMEIFVLRDVVGNLL----HECHLIKNYDE----HT------------------- 382
           MLTTFP+EIFVLR+VV ++     H  +  + +      HT                   
Sbjct: 313 MLTTFPLEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGP 372

Query: 383 -----------QLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPP 431
                      + S + HT +T +LV  TMG++L TCNLGAL E+IG+TT +  AYILPP
Sbjct: 373 AGPHPGLPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPP 432

Query: 432 YTNLLLTSKKKN---WKAKLPYYFCICFGFMIMIVSSTQTILD 471
            T++LLT ++      + +L +  C+ FG  +M+VS+TQT+LD
Sbjct: 433 LTHVLLTRRRPQPHTARERLGHCCCVVFGCTVMLVSTTQTLLD 475

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 96/439 (21%), Positives = 188/439 (42%), Gaps = 46/439 (10%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            SS+      L ++  GAGI+  P+  K  G+  G++   ALGF     +  +++   +A
Sbjct: 2   SSSVSGGVATLLHTACGAGILAMPYGFKTLGLTFGIL---ALGFCSLCAMTGLLLQAQVA 58

Query: 129 ---GKRTYQG-TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQND 184
               +RT    ++  ++  K  ++      +  F           D IP +    F+ N 
Sbjct: 59  RYVPERTASFFSLTQLIHPKLSVVFDLAIAIKCFGVGVSYMIVVGDLIPQIF-TTFTSNK 117

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIR--GPML 242
                 L RN  I MV +F+  PL   + +  L KAS +A+ S+  +   VV+    P  
Sbjct: 118 ----ILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCCLVVVHFIWPSN 173

Query: 243 PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISI 302
             D R   + +     + T   +L +  FA  CHHN   ++   ++ S  +  K+    +
Sbjct: 174 EIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTSTRQLNKIGRYGM 233

Query: 303 VISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLR 362
            I+ +   ++G +G+  F +   GN++  +P    +  + R+     ++  FP++    R
Sbjct: 234 SIAFVLYTIIGGAGYLTFGDHIAGNIITLYP-PSLSTTIGRVAIVLLVMLAFPLQCHPAR 292

Query: 363 DVVGNLLHECHLI-KNYDEHTQLSN----------------------KQHTIITSMLVFI 399
             + N+L+    + KN    T+ SN                      K+ T+IT +++  
Sbjct: 293 SSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKRFTVITLVILIA 352

Query: 400 TMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-------KNWK-AKLPYY 451
           +  ++++  +L  L  ++G+T ++++++ILP      L   +       +N K AK    
Sbjct: 353 SYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIGSEYTPEELPRNLKFAKFAGL 412

Query: 452 FCICFGFMIMIVSSTQTIL 470
               +GF++MI S   +IL
Sbjct: 413 LLAIWGFIVMIASLAASIL 431

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/408 (20%), Positives = 172/408 (42%), Gaps = 54/408 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLTL 127
           S++R   + L ++  GAG++  PFA K  G++ GLI+    G   +    L+  +     
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYVP 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG-- 185
             +      +  ++     ++  F   +  F           D +P +++++F +ND   
Sbjct: 63  KSENASFAKLTQLINPSISVVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYRNDDNM 122

Query: 186 ----EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPM 241
               E H +L R + I ++ +F+  PL  KR++  L  AS      MI IV    + G +
Sbjct: 123 SGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYAS------MIAIVSVAYLSGLI 176

Query: 242 LPYDWRGHTLKLSDIFIKT--------TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 293
           + +    H L+   ++           +   +L +  FA  CHHN   +     ++S   
Sbjct: 177 IYHFVNRHQLERGQVYFMVPHGDSQSHSPLTTLPIFVFAYTCHHNMFSVINEQVDKSFKV 236

Query: 294 FTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTT 353
             ++   +IV++     ++G +G+  F E   GN+L  +P +  +  + RL     ++  
Sbjct: 237 IRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYPNS-ISTTIGRLAMLLLVMLA 295

Query: 354 FPMEIFVLRDVVGNL---LHECHLIKNYDEH------------------TQLSNKQH--- 389
           FP++    R  V N+   +      K YD                    TQ +N++    
Sbjct: 296 FPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFNSEDPQEAPTQQNNEEPNLR 355

Query: 390 -------TIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
                   IIT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 356 SESLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGSTSISFILP 403

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 103/455 (22%), Positives = 197/455 (43%), Gaps = 61/455 (13%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLT 126
            SS+R   + L ++  GAGI+  P+A K  G++ G +     GF  +    L+  V   T
Sbjct: 2   PSSIRSGVITLLHTACGAGILAMPYAFKPFGLVPGFLMIAICGFCALSGLILQAQVAKYT 61

Query: 127 LAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGE 186
            +G  ++  T+  ++     ++      +  F           D +P +  AVF+ +   
Sbjct: 62  ASGSASFF-TLSQLISPSLSVVFDLAIAVKCFGVGVSYMIVVGDLMPQIF-AVFTTS--- 116

Query: 187 VHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLS---MIVIVLTVVIRGPMLP 243
            H  L R+  I ++ +FI  PL   R +  L  AS +A+ +   + V+V+   I      
Sbjct: 117 -HILLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCVLVVAHFIFQTEDV 175

Query: 244 YDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRN-RSVAKFT---KLTH 299
           +D +G  + +     + +   +L +  FA  CHHN    FFS+ N +S   FT   K+  
Sbjct: 176 HDLKG-VVSIGLPKHEPSPLTTLPIFVFAYTCHHN----FFSVINEQSNIAFTHIKKIPI 230

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
           I+++++ +   L+G+SG+  F +   GN++  +P T ++  + RL   F ++  FP++  
Sbjct: 231 IAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLVMLAFPLQCH 289

Query: 360 VLRDVVGNLLH--------------------------ECHLIKN----YDEHTQLSNKQH 389
             R  + ++ H                             LI+       E   L  K+ 
Sbjct: 290 PCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPKQPEEIPLRGKRF 349

Query: 390 TIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL-LLTSKKKNWKAKL 448
            IIT  ++  +  ++++  +L  +  ++GAT ++++++ILP      L+ S+     + L
Sbjct: 350 NIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILPGIFGFKLIGSEFSATSSPL 409

Query: 449 PY---------YFCICFGFMIMIVSSTQTILDAVN 474
           P           F   +G  +MI S   T+L  V 
Sbjct: 410 PKSARFFRYLGLFLSIWGLFVMIASLAATLLLGVG 444

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 92/453 (20%), Positives = 189/453 (41%), Gaps = 65/453 (14%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            SS+    + L ++  GAGI+  P+A +  G+   L+ +  + F    +L  ++I   ++
Sbjct: 2   SSSLGSGVLTLLHTACGAGILAMPYAFRPFGV---LLGFGMIAFCGACSLAGLMIQGRVS 58

Query: 129 GKRTYQGTVEYVMGK--KGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQND 184
                +    + + +    +L ++F   +    F           D +P +  A F+ + 
Sbjct: 59  KYAAERNASFFALAQVTYPQLSVIFDLAIAVKCFGVGVSYLVVVGDLMPRIF-ATFTSHG 117

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPY 244
                 L RN+ I +V +F+  PL   + ++ L  AS +A+ S+  + + V++      Y
Sbjct: 118 ----LLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCVLVLVH-----Y 168

Query: 245 DW--------RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTK 296
            W        RGH      +     +     +  FA  CHHN   I   +R+ S+    K
Sbjct: 169 VWPSDEIRELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNELRDNSLKGIYK 228

Query: 297 LTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPM 356
           ++ IS+ +++    L+G SG+A F +   GN++  +P    A  V R+     ++  FP+
Sbjct: 229 VSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYP-QSAATTVGRVAIALLVMLAFPL 287

Query: 357 EIFVLRDVVGNLLH-----------------ECHLIKNYDEH--------------TQLS 385
           +    R  V ++LH                    LI + D                  L 
Sbjct: 288 QCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGGPRQLAVMPLE 347

Query: 386 NKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSK----- 440
            K+   IT+ ++ ++  ++++  +L  +  ++GAT ++++++ILP      L        
Sbjct: 348 GKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILPGIFGFQLIGSEDQPG 407

Query: 441 KKNWKAKLPYYFCI---CFGFMIMIVSSTQTIL 470
           + + K K   Y  +   C+G  +++   + T+L
Sbjct: 408 QSSTKTKFLKYLSLTLACWGMAVLVTCLSATLL 440

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/452 (20%), Positives = 192/452 (42%), Gaps = 68/452 (15%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLTLAGKRTYQ 134
           + L ++  GAG++  PFA K  G++ GLI+    G   +    L+  +       +    
Sbjct: 10  LTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYVPKSENASF 69

Query: 135 GTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG------EVH 188
             +  ++     ++  F   +  F           D +P +++++F  ND       E H
Sbjct: 70  AKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYHNDDSTGGLQEHH 129

Query: 189 FWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRG 248
             L R + I +V +F+  PL  KR++  L  AS +A++S+        + G ++ +    
Sbjct: 130 RLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMIAIISV------AYLSGLIIYHFLNR 183

Query: 249 HTLKLSDIFIKT--------TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           H L+   ++           +   +L +  FA  CHHN   +     +++     ++   
Sbjct: 184 HQLERGQVYFMVPHRDSSSHSPLTTLPIFVFAYTCHHNMFSVINEQTDKTFRILRRIPIF 243

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           +I  + I   ++G +G+  F E   GN+L  +P +  +  + RL     ++  FP++   
Sbjct: 244 AISFAYILYLIIGGAGYMTFGENIVGNILTLYPNS-ISTTIGRLAMLLLVMLAFPLQCHP 302

Query: 361 LRDVVGNL---------------------LHECHLIKNYDEHTQLS---------NKQHT 390
            R  + N+                     L + +  + +DE +Q S         +++HT
Sbjct: 303 CRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEEPHDELSQQSSEGPTLRSESQRHT 362

Query: 391 IITSMLVFI---TMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLTSKKKNWKA 446
            + ++ V +    + IS+T+  L  +  ++GAT ++++++ILP  +   L+ S+  N   
Sbjct: 363 NVITLCVLVFSYILAISITS--LAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNRNE 420

Query: 447 KLPYYFCI---------CFGFMIMIVSSTQTI 469
           ++P    I          +G +IMI S + T+
Sbjct: 421 RVPVSIKIFKYLGLSLFIWGLVIMIASLSATV 452

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/408 (18%), Positives = 172/408 (42%), Gaps = 54/408 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLTL 127
           S  R   + L ++  GAG++  PFA K  G++  LI+    G   +    L+  ++    
Sbjct: 3   SDPRSGVLTLLHTACGAGVLAMPFAFKPFGLLPALITLTFCGICSLCGLLLQTRIVKYVP 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG-- 185
             +      +  ++     ++  F   +  F           D +P +L ++  +ND   
Sbjct: 63  KSENASFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQILSSILYRNDDST 122

Query: 186 ----EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPM 241
               E H +L R + I +V +F+  PL  K+++  L  AS +A++S+  +   ++     
Sbjct: 123 GDSQEHHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLIIFH--- 179

Query: 242 LPYDWRGHTLKLSDIFIKT--------TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 293
             + +R   L+   ++  T        +   +L +  FA  CHHN   +     ++S   
Sbjct: 180 --FLYRSE-LERGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKI 236

Query: 294 FTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTT 353
             ++  ++I ++ +   ++G +G+  F +   GN++  +P +     + RL     +   
Sbjct: 237 LRRIPILAISLAYVLYVVIGGTGYMTFGDNIVGNIITLYPNS-IYTTIGRLAMLLLVTLA 295

Query: 354 FPMEIFVLRDVVGNLL----------------------------HECHLIKNYDEHTQL- 384
           FP++    R  + N++                             +  + +  +E + L 
Sbjct: 296 FPLQCHPCRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEEVAQQNNEQSNLP 355

Query: 385 --SNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
             S++Q  +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 356 IESSRQTNVITLCILIFSYLLAISITSLAKVLAIVGATGSTSISFILP 403

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 140/347 (40%), Gaps = 55/347 (15%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            SS+R   + L ++  GAGI+  P+A +  G+  GL       F++ +     ++ L L 
Sbjct: 2   SSSVRSGTLTLLHTACGAGILAMPYAFQPFGVFPGL-------FLIAFCGACAMLGLIL- 53

Query: 129 GKRTYQGTV-EYVMGKKGKLLIL--FTNGLFA-----------FXXXXXXXXXXXDTIPH 174
                Q TV +YV  +      L   TN  F+           F           D +P 
Sbjct: 54  -----QSTVAKYVPERNASFFALSQVTNPKFSVLFDIAIAVKCFGVGVSYMIVVGDVMPQ 108

Query: 175 VLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLT 234
           +L   F+  +    F+L RNV I +V +FI  PL   +N+  L  AS  A+ ++I +   
Sbjct: 109 IL-GTFTDTE----FFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFL 163

Query: 235 VV---------IRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFS 285
           V+         IR    P  W      L+ +        +L +  FA  CHHN   +F  
Sbjct: 164 VMFHFFIPNEEIRDTRGPVSWGFPKDGLNPL-------NTLPIFVFAYTCHHN---MFSV 213

Query: 286 MRNRSVAKFTKLTHISIVISVICCGL---MGYSGFAAFKEKTKGNVLNSFPGTDTAINVA 342
           +  +    F KL  I I   ++ C L   +G SG+  F     GN++  +     A  V 
Sbjct: 214 INEQQDIHFNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVG 272

Query: 343 RLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQH 389
           R+     ++  FP++    R  + ++LH   LI   +   Q S   H
Sbjct: 273 RIAIVILVMLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGH 319

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/405 (20%), Positives = 167/405 (41%), Gaps = 41/405 (10%)

Query: 60  NNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLR 119
           +++   N   SS+    + L ++  GAGI+  P+A K  G++ G    +  G      L 
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCGACSATGLM 75

Query: 120 LIVINLTLAGKRTYQG-TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 178
           L       A +R      +  +   +  ++      +  F           D +P +  A
Sbjct: 76  LQARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRIF-A 134

Query: 179 VFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIR 238
            F+ +       L RN  I +V   I  PL   R ++ L  AS +AV S+  + + VV+ 
Sbjct: 135 TFTSHS----LLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVH 190

Query: 239 GPMLP----YDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294
             + P     + +G+          + +     +  FA  CHHN   I   +R+ S+   
Sbjct: 191 F-LFPSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDNSLKGI 249

Query: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354
            K+  IS+ +S+    L+G SG+A F +   GN++  +P + T   + R+     ++  F
Sbjct: 250 YKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYPQSTTT-TIGRVAIALLVMLAF 308

Query: 355 PMEIFVLRDVVGNLLH--------------ECHLIKN----------YDEHTQ-----LS 385
           P++    R  + +++                 HLI +           D   Q     L 
Sbjct: 309 PLQCHPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEEDSPQQPQVVPLE 368

Query: 386 NKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
            K+   IT+ ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 369 GKRFIAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILP 413

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 105/466 (22%), Positives = 189/466 (40%), Gaps = 83/466 (17%)

Query: 71  SMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGK 130
           ++R   + L ++  GAGI+  PFA K  G++ GL      G      L L      ++  
Sbjct: 4   TVRSGVITLLHTACGAGILAMPFAFKPFGLVLGLTMITWCGLCAFAGLLL---QCRVSRY 60

Query: 131 RTYQGTVEYVMGK--KGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQNDGE 186
              +G   +V+       L ++F   +    F           D +P +  +V++ N   
Sbjct: 61  APEKGVSFFVLSSLINRNLSVVFDCAIAVKCFGVGVSYMIVVGDLLPQIW-SVWTSNK-- 117

Query: 187 VHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPML--PY 244
               L R+  I MV IFI  PL   + +  L  AS +A+ S +  +  +VI   +   P 
Sbjct: 118 --LLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAI-SAVAYLCVLVIYHFIFQDPN 174

Query: 245 DWRGHTLKLSDIFI-----KTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV-AKF---T 295
           D     LK   I I     +  I  +L +  FA  CHHN     FS+ N  V  KF   T
Sbjct: 175 DTHFQDLK-GRISIGLPRDEPPILTTLPIFVFAYTCHHN----MFSVINEQVDQKFNVIT 229

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
           K+   S+ ++ +   ++GYSG+  F +K  GN++  +P   ++  + R+     +  TFP
Sbjct: 230 KIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRIAIAILVTLTFP 288

Query: 356 MEIFVLRDVVGNLLH------------------------------------ECHLIKNYD 379
           ++    R  + +++H                                     C  +    
Sbjct: 289 LQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTDAANCAEVDTAI 348

Query: 380 EH--------TQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPP 431
           E           L  K+   IT  ++F +  ++++  +L  +  ++GAT ++++++ILP 
Sbjct: 349 EEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLAKVLAIVGATGSTSISFILPG 408

Query: 432 YTNLLLTSKKKNWKAKLPY------YFCIC---FGFMIMIVSSTQT 468
                L   +    A+LP+      Y  +C   +G ++M+ S T T
Sbjct: 409 IFGYKLIGSECETGAELPFQTKMFKYLGLCLAVWGLVVMVASLTAT 454

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 86/407 (21%), Positives = 174/407 (42%), Gaps = 56/407 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL--RLIVINLTL 127
           +S+R   + L ++  GAGI+  P+A K  G++ G+I     G     +L  +  V     
Sbjct: 3   ASIRSGALTLLHTACGAGILAMPYAFKPFGLMPGVIMIAVCGVCAMQSLFIQARVAKYVP 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILF--TNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG 185
            G+ ++      +      L I+F     +  F           D +P ++ +V+++N  
Sbjct: 63  QGRASFSALTRLI---NPNLSIVFDLAIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNA- 117

Query: 186 EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYD 245
              + L RNV I ++ +F+  PLS  + +  L  AS +A+ S+  + + V++   + P +
Sbjct: 118 ---WLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCVLVLVHY-IAPSE 173

Query: 246 WRGHTL-KLSDIFIKTT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
              H   ++S  F K +    I  +  +  FA  CHHN   I    R+       K+  I
Sbjct: 174 EILHMKGRISYFFPKQSHDLNILNTFPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLI 233

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           +I +++I    +G +G+  F +   GN++  +P T T+  V R+     ++  FP++   
Sbjct: 234 AISLALILYVAIGCAGYLTFGDNIIGNIIMLYPQT-TSSTVGRVAIVLLVMLAFPLQCHP 292

Query: 361 LRDVVGNLLHE----------------------CHLIKN---------------YDEHTQ 383
            R  +  +L                          LI++                 + T 
Sbjct: 293 ARASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLDINEVIEEESIYQPKETP 352

Query: 384 LSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
           L  K   +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 353 LKGKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSISFILP 399

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/402 (19%), Positives = 165/402 (41%), Gaps = 52/402 (12%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAG 129
           S+ R   + L ++  GAGI+  P+A +  G++  +   +  G          ++ L L  
Sbjct: 2   STARSGVVTLLHTACGAGILAIPYAFRPFGLVPAIFMLLFCGLCS-------MMGLLLQS 54

Query: 130 KRTYQG--------TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFS 181
           +    G        ++  V+     +L      +  F           D +P +   V S
Sbjct: 55  RIAKYGPLKNVSFFSLAQVVNPASSILFDAAIAIKCFGVGVSYMIVVGDLMPKIWSRVSS 114

Query: 182 QNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPM 241
                    L RNV I +V +FI  PL   R +  L  AS +A+ S+  + + V++    
Sbjct: 115 SG-----LLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILVIVHFAH 169

Query: 242 LPYDWRGHTLKLSDIFI--KTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTH 299
              + R    ++S      + T   +L +  FA  CHHN   +    +N        +  
Sbjct: 170 QTTELRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAI 229

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
           +SI+++ +   ++G +G+  F +   GN++  +P T  +  + R+     ++  FP++  
Sbjct: 230 VSILVAFVLYVVIGSTGYLTFGDNITGNIIALYPDT-LSTTIGRIAIVLLVMLAFPLQCH 288

Query: 360 VLRDVVGNLL------------HECHLI-----------------KNYDEHTQLSNKQHT 390
             R+ + N++            +E   +                  N  E   +  K+  
Sbjct: 289 PARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFM 348

Query: 391 IITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPY 432
           IIT+ ++F +  ++++  +L  +  ++GAT ++T+++ILP Y
Sbjct: 349 IITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGY 390

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 103/463 (22%), Positives = 190/463 (41%), Gaps = 76/463 (16%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            SS++   + L ++  GAGI+  P+A K  G+I GL   I  G      L L     +  
Sbjct: 2   SSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCGLCSSTGLYL----QSYV 57

Query: 129 GKRTYQGTVEY---VMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQN 183
            K    G   +       + +L ++F   +    F           D +P ++       
Sbjct: 58  SKYVPPGHASFFTLCRLTRPELSVVFDAAIAVKCFGVGVSYLVVVGDLLPQIMSTF---- 113

Query: 184 DGEVHFWL-RRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIR--GP 240
               H WL  R   I  VT+ I  PL   + ++ L   S +A+ ++  + + VV     P
Sbjct: 114 --TTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCVLVVFHFAVP 171

Query: 241 MLPYD-WRGHT--LKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKL 297
               D  RGH    K SD+   +++  S  +  FA  CHHN   I     ++S+   TKL
Sbjct: 172 NSEIDHLRGHVSIWKPSDV--DSSMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKL 229

Query: 298 THISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPME 357
             I+I +++     +G  G+  F +   GN++  +P + ++  + R+     ++  FP++
Sbjct: 230 IRIAITLAMSLYISIGALGYCTFGDHITGNIITLYPNSISS-TIGRIAIALLVILAFPLQ 288

Query: 358 IFVLRDVVGNLLH-----------------ECHLIKN----------YDEHTQL----SN 386
               R  V ++LH                 +  L+++          Y+   +L    S 
Sbjct: 289 CHPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLTYECEDELIEENSA 348

Query: 387 KQHTIIT---SMLVFITMGI-------SLTTCNLGALFELIGATTASTMAYILP------ 430
            Q  ++T      +FIT GI       +++  +L  +  ++GAT ++++++ILP      
Sbjct: 349 NQPPVVTLEGPRFIFITSGILLFSYILAMSVTSLANVLSIVGATGSTSISFILPGIFGYK 408

Query: 431 ----PYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTI 469
                Y   ++   K+     +     I +GF++MI S + TI
Sbjct: 409 LIASEYAKSVVPPAKERILRIISLLLAI-WGFIVMITSLSATI 450

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 96/480 (20%), Positives = 190/480 (39%), Gaps = 104/480 (21%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGT 136
           + L ++  GAGI+  P+A K  G++ G +  +  G      L L             QG 
Sbjct: 52  VTLLHTACGAGILAMPYAFKAYGLLPGFLVLVLCGVFSTTGLLL-------------QGQ 98

Query: 137 V-EYVMGKKG-----------KLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQ 182
           V +YV  ++            +L I+F   +                D +P +     S 
Sbjct: 99  VSKYVPRRQASFFSLAQITYPQLSIIFDLAIAVKCLGVGVSYMVVIGDLLPQIFSNFTSH 158

Query: 183 NDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPML 242
                   L RN  I +V IFI  PL   + ++ L  AS +A+ S +  +  +V+   + 
Sbjct: 159 E-----ILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIAI-SAVGYLCVLVVAHFLF 212

Query: 243 PY----DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLT 298
           P     D +G         + T++  S  +  FA  CHHNT  I   +++ SV    K+ 
Sbjct: 213 PSQEIKDLKGTVSLFRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNSVENVRKVV 272

Query: 299 HISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEI 358
             ++ ++V     +G SG+  F +   GN++  +P + T+  V R+     ++  FP++ 
Sbjct: 273 IGAMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHS-TSTTVGRIAIVLLVMLAFPLQC 331

Query: 359 FVLRDVVGNLLHECHLIKNY--------DEHTQLSNKQHT-------------------- 390
              R  + +++H  HL +          +  +  ++K  T                    
Sbjct: 332 HPARASINHIIH--HLFEERRGGAQNGEERESNAASKNRTDESACNGNSESSRLVQSTET 389

Query: 391 ---------------------------IITSMLVFITMGISLTTCNLGALFELIGATTAS 423
                                      +ITS ++  +  ++++  +L  +  ++GAT ++
Sbjct: 390 SIPVDELIEECSARQPKVVPLEGRKFVVITSCILIFSYALAVSVTSLARVLAVVGATGST 449

Query: 424 TMAYILPP-YTNLLLTSKKKN-----WKAKLPYYFCI---CFGFMIMIVSSTQTILDAVN 474
           ++++ILP  +   L+ S+ +N     WK +   Y  +   C+G ++M+   + T+L   +
Sbjct: 450 SISFILPGIFGYQLIGSEYENTSEMPWKTRWTKYIALALTCWGLVVMVTCLSATLLSGAS 509

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/409 (19%), Positives = 173/409 (42%), Gaps = 54/409 (13%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLT 126
            S++R   + L ++  GAG++  PFA K  G++ GLI+    G   +    L+  +    
Sbjct: 2   SSNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTICGICSLCGLLLQTRIAKYV 61

Query: 127 LAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG- 185
              +      +  ++     ++  F   +  F           D +P ++ ++  ++   
Sbjct: 62  PKSENVSFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQIVSSILYRDHDS 121

Query: 186 -----EVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
                E H  L R + I ++ +F+  PL  K+++  L  AS +A++S+        + G 
Sbjct: 122 TGGPQEHHGILDRRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISV------AYLSGL 175

Query: 241 MLPYDWRGHTLKLSDIFIKT--------TIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292
           ++ +    H L+   ++               +L +  FA  CHHN   +     ++   
Sbjct: 176 IIYHFLNRHQLERGQVYFMVPHRDTESHAPLTTLPIFVFAYTCHHNMFSVINEQADKGFR 235

Query: 293 KFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT 352
              ++  I+I ++ +   ++G +G+  F +   GN+L  +P +  +  + RL     ++ 
Sbjct: 236 ILKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGNILTLYPNS-VSTTIGRLAMLLLVML 294

Query: 353 TFPMEIFVLRDVVGNLL------HECHLIKNYD---------------EHTQLSNKQ--- 388
            FP++    R  + N++       +  L +N D               E  Q +N+Q   
Sbjct: 295 AFPLQCHPCRSSIKNIIIFIENFRKGKLQENRDDCIPLDVLSSVNSQEESRQQNNEQQNF 354

Query: 389 ------HT-IITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
                 HT IIT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 355 PSESSRHTNIITLCILGSSYLLAISITSLAKVLAIVGATGSTSISFILP 403

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 135/308 (43%), Gaps = 15/308 (4%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV-INLTL 127
            SS+R   + L ++  GAGI+  P+A K  G+I G I  I  G      L L   ++  +
Sbjct: 2   SSSVRSGVLTLLHTACGAGILAMPYAFKPYGLITGFIMIIICGICAMIGLLLQSRVSSYV 61

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEV 187
             +     T+  +      ++      +  F           D +P VL + F+      
Sbjct: 62  PVRNASFFTLTQITNPNLSIVFDLAIAIKCFGVGVSYMIVVGDVLPQVL-STFTN----- 115

Query: 188 HFWL-RRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDW 246
           H WL  RNV I +V +FI  PL   +N+  L  AS LA+ S+  +   V+I   ++P D 
Sbjct: 116 HEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCALVLIHF-IMPND- 173

Query: 247 RGHTLK--LSDIFIKTTI--FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISI 302
             H  K  +S    K  +    +L +  FA  CHHN   +     + +     K+  IS+
Sbjct: 174 ETHNFKGDVSWGLPKNGLNPLTTLPIYVFAYTCHHNMFSVINEQMDPTYNSVKKIAIISM 233

Query: 303 VISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLR 362
           +++     L+G +G+  F +   GN++  +P  + +  + R+   F +   FP++    R
Sbjct: 234 ILAGFLYILIGGAGYLTFGDHITGNIITLYP-QNISTTIGRIAIIFLVTLAFPLQCHPAR 292

Query: 363 DVVGNLLH 370
             + +++H
Sbjct: 293 ASINHIIH 300

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/408 (20%), Positives = 176/408 (43%), Gaps = 58/408 (14%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL--RLIVINLTL 127
           +S+R   + L ++  GAGI+  P+A K  G++ G++  +  G     +L  +  V     
Sbjct: 3   TSIRSGVLTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVA 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEV 187
            GK ++  T+  ++  +  ++      +  F           D +P ++ + ++ N    
Sbjct: 63  PGKASFS-TLTRLINPRLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIMSS-WTGNA--- 117

Query: 188 HFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYD-- 245
            + L RNV I ++ +F   PLS  + +  L  AS +A+ S+  + + V++   ++P D  
Sbjct: 118 -WLLSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHY-VVPSDEI 175

Query: 246 --WRGHTLKLSDIFIKTT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTH 299
              +G   ++S +F + +       +L +  FA  CHHN   I    ++       K+  
Sbjct: 176 LRLKG---RVSYLFPQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPL 232

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
           ISI +++     +G +G+  F +   GN++  +P T ++  V R+     ++  FP++  
Sbjct: 233 ISISLALALYIAIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCH 291

Query: 360 VLRDVVGNLLH----------------------ECHLIKN---------------YDEHT 382
             R  +  +L                          LI+N                 + T
Sbjct: 292 PARASIHQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSIDINEVIEEEPIYQPKDT 351

Query: 383 QLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
            L  K   IIT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 352 PLRGKSFIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSISFILP 399

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/405 (20%), Positives = 170/405 (41%), Gaps = 52/405 (12%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL--RLIVINLTL 127
           +S+R   + L ++  GAGI+  P+A K  G+I G+I  +  G     +L  +  V     
Sbjct: 3   ASIRSGVLTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVP 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEV 187
            G+ ++      +    G +  L    +  F           D +P ++ +V+++N    
Sbjct: 63  QGRASFSALTRLINPNLGIVFDL-AIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNA--- 117

Query: 188 HFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYD-- 245
            + L RNV I ++ +F   PLS  + +  L  AS +A+ S+  + + V++   + P D  
Sbjct: 118 -WLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLLHY-VAPSDEI 175

Query: 246 --WRGH-TLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISI 302
              +G  +  L        +  +L +  FA  CHHN   I    R+       K+  I+I
Sbjct: 176 LRLKGRISYLLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAI 235

Query: 303 VISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLR 362
            +++I    +G +G+  F +   GN++  +P   ++  + R+     ++  FP++    R
Sbjct: 236 SLALILYIAIGCAGYLTFGDNIIGNIIMLYPQAVSS-TIGRIAIVLLVMLAFPLQCHPAR 294

Query: 363 DVVGNLLHE----------------------CHLIKN---------------YDEHTQLS 385
             +  +L                          LI++                 + T L 
Sbjct: 295 ASIHQILQHFAEENVSISATSADEPTVATESSPLIRDSSLDLNEVIEEESIYQPKETPLR 354

Query: 386 NKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
            K   +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 355 GKSFIVITCSILVASYLVAISVSSLARVLAIVGATGSTSISFILP 399

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/406 (19%), Positives = 170/406 (41%), Gaps = 54/406 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL--RLIVINLTL 127
           +S++   + L ++  GAGI+  P+A K  G++ G+I  +  G     +L  +  V     
Sbjct: 3   ASIKSGVLTLLHTACGAGILAMPYAFKPFGLVPGMIMIVICGACAMQSLFIQARVAKYVP 62

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEV 187
            G+ ++  T+  ++     ++      +  F           D +P ++ +V++ N    
Sbjct: 63  QGRASFS-TLTRLINPSLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIM-SVWTNNA--- 117

Query: 188 HFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWR 247
            + L RNV I ++ +F   PL   + +  L  AS +A+ S+  +   V++       D  
Sbjct: 118 -WLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCALVLVHYIAPSEDIL 176

Query: 248 GHTLKLSDIFIKTT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIV 303
               ++S  F   +    +  +L +  FA  CHHN   I    R+       K+  I++ 
Sbjct: 177 RLRGQISYFFPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVS 236

Query: 304 ISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRD 363
           +++I    +G +G+  F +   GN++  +P T ++  V R+     ++  FP++    R 
Sbjct: 237 LALILYIAIGCTGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARA 295

Query: 364 VVGNLLHECHLIKN--------------------------------YDEHTQLSNKQHTI 391
            +  +L   HL +                                  +E +    K+ ++
Sbjct: 296 SIHQILQ--HLERENITTSTTSVSGPTFANENSPLMGDRGLDINEVIEEESIYQPKETSL 353

Query: 392 ITSMLVFITMGI-------SLTTCNLGALFELIGATTASTMAYILP 430
                VFIT GI       +++  +L  +  ++GAT ++++++ILP
Sbjct: 354 KGKSFVFITCGILLASYLVAISVSSLARVLAIVGATGSTSISFILP 399

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 85/411 (20%), Positives = 169/411 (41%), Gaps = 60/411 (14%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            SS R   + L ++  GAG++  P+  K  G+I GL+  I   F    +L  +++   +A
Sbjct: 2   ASSTRSGVITLLHTACGAGVLAMPYGFKPFGLIPGLLVII---FCALCSLGGLLLQAKVA 58

Query: 129 ----GKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQND 184
                K     T+  ++     ++      +  F           D  P +  +VF+ N 
Sbjct: 59  RYVPEKSASFFTLTQIINPNLSVIFDIAIAIKCFGVGVSYMIVVGDLTPQI-ASVFTSN- 116

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLP- 243
              H  L RNV I ++ +FI  PL   + +  L  AS +A+LS+  + + + I   + P 
Sbjct: 117 ---HLLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCVLIFIHF-VWPS 172

Query: 244 ---YDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
              +D +GH + L     +T    +L +  FA  CHHN   +    ++ S     K+   
Sbjct: 173 EEIHDLKGH-VSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSFRHIKKVAIY 231

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           ++ +++    L+G  G+  F +   GN++  +P   +   V R+     ++  FP++   
Sbjct: 232 AMFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFAST-TVGRIAIVLLVMLAFPLQCHP 290

Query: 361 LRDVVGNLL------------------------HECHLIKNYDEH--------------- 381
            R  + ++L                            LI N D+                
Sbjct: 291 ARASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMIDELIEEDSANQP 350

Query: 382 --TQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
               L  ++  IIT  L+  +  ++++  +L  +  ++G+T ++++++ILP
Sbjct: 351 PVVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTSISFILP 401

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/410 (19%), Positives = 171/410 (41%), Gaps = 55/410 (13%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
           +SS++   + L ++  GAGI+  P+A ++ G++ G +  +  GF     L L        
Sbjct: 2   RSSVQSGVLTLLHTACGAGILAMPYAFRSFGLLPGFLIIVFCGFSALTGLVLQSYVSKYV 61

Query: 129 GKRTYQGTVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQNDGE 186
             R +    E       +L I+F   +    F           D +P ++ + F+ N   
Sbjct: 62  APR-HVSFFELAQISYPELSIVFDCAIAVKCFGVGISYMVVVGDLMPQIV-STFTSN--- 116

Query: 187 VHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDW 246
             + L R + I +  +FI  PL   R ++ L  AS +A+ S+  + + VV        D 
Sbjct: 117 -QWLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCVLVVYHFLFPSSDI 175

Query: 247 RGHTLKLSDIFIK----TTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISI 302
           R     +S  F +     ++  S  +  FA  CHHN   I   +R+ S+    ++  I++
Sbjct: 176 RQAKGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAM 235

Query: 303 VISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLR 362
            ++V    ++G SG+  F +   GN++  +P + ++  +AR+     ++  FP++    R
Sbjct: 236 GLAVSLYTVIGGSGYLTFGDNITGNIVTIYPRSVSS-TLARIAIVLLVMLAFPLQCHPAR 294

Query: 363 DVVGNLL--------------HECHLIKNYDEH--------------------------- 381
             + N+                E  L+++                               
Sbjct: 295 ASINNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSISPDWSPLQTSSQPIPT 354

Query: 382 -TQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
            T +  K+  +IT+ ++  +  ++++  +   +  ++GAT ++++++ILP
Sbjct: 355 TTTIEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSISFILP 404

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 138/314 (43%), Gaps = 28/314 (8%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
            S++    + L ++  GAGI+  P+A K  G+I G++  +  G     TL   +I   +A
Sbjct: 2   SSTVGSGVLTLLHTACGAGILAMPYAFKPFGLIFGILMIMFCGLCSMMTL---LIQARVA 58

Query: 129 G-----KRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQN 183
           G     K     ++  V+ K   ++      +              D +P +  ++ ++ 
Sbjct: 59  GYAPDSKNASFFSLTQVINKNLSVIFDLAIAIKCLGVGISYLIVVGDLLPQIAGSITTKP 118

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLP 243
                  L R+  I +V IF+  PL LK+ +  L   S LA++S+  + + V+I   ++ 
Sbjct: 119 -----LLLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIH--LVS 171

Query: 244 YD-----WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLT 298
            D      +GH + +       +   +L +  FA  CHHN   +F  +  +   +F    
Sbjct: 172 SDGDIEQMKGH-VSIGLPHHGPSPLTTLPIFVFAYTCHHN---MFSVINEQKDNRFKTTK 227

Query: 299 HISIVISVICC---GLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
           +I ++ + + C    L+G  G+  F +K  GN++  +P + ++I + R+     +   FP
Sbjct: 228 YIPLISTSLACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAFP 286

Query: 356 MEIFVLRDVVGNLL 369
           ++    R  + N+L
Sbjct: 287 LQCHPARSSIHNIL 300

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 131/314 (41%), Gaps = 27/314 (8%)

Query: 66  NDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV-IN 124
           ++  +++  +  NL  +I+GAG+   PFA KN G+  GL+          + L L+   +
Sbjct: 3   DNPTATVGSSITNLVKTIVGAGLFAIPFAFKNDGVAVGLLLIFLAAVTSSFGLILLAKCS 62

Query: 125 LTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFA--FXXXXXXXXXXXDTIPHVLRAVFSQ 182
            TL   R         M     L  LF   +    F           D  P +       
Sbjct: 63  KTLINPRN-SSFFTICMLTYPSLAPLFDLAMVVQCFGVGLSYLVLVGDFFPDLF------ 115

Query: 183 NDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIR---- 238
             GE  +W+  + I+++       PL   + ++ L  +S + V++++ + L +  R    
Sbjct: 116 -GGERKYWILLSAILVV-------PLCCLKKLDNLKYSSIVGVIALLYLSLLIGFRYLTD 167

Query: 239 ---GPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
               P + ++ RG  +    ++    +  + S+I FA V   N   I   +++ S+    
Sbjct: 168 VAFAPEISFE-RGE-ISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNVR 225

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
           K+   SI+IS I    +G  G+  F   T GN+L ++     AI + + C    ++ TFP
Sbjct: 226 KVVDSSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTFP 285

Query: 356 MEIFVLRDVVGNLL 369
           +    LR  + N++
Sbjct: 286 LLFHPLRTAINNIV 299

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 129/300 (43%), Gaps = 30/300 (10%)

Query: 71  SMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALG--FIVDWTLRLIVINLTLA 128
           S+R   + L ++  GAGI+  P+A K  G+I G++  +      I+   L++ V   T  
Sbjct: 2   SLRAGTITLLHTACGAGILAVPYAFKPFGVIPGMLILLVCSSTAILGLLLQVKVTKYTPV 61

Query: 129 GKRTYQGTVEYVMGKKGKLLILF--TNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGE 186
           G++      E       +L +LF     +  F           D +P +L    S N   
Sbjct: 62  GEK--HSFFELASKIHPRLAVLFDIAIAIKCFGVATSYLIAVGDLLPTLLH---SSN--- 113

Query: 187 VHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV--IVLTVVIRGPMLPY 244
                 R ++I +V  FI  PLS  + I  L   SFLAV+S+I   I++T     P    
Sbjct: 114 ------RFLLITLVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHYADPSQEI 167

Query: 245 -DWRGHT---LKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
            D RG+        D     + F++L +  FA  CHHN   +F  +  +S  +F+KL +I
Sbjct: 168 IDLRGNVSLFFPGEDQHNSVSPFKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKLKYI 224

Query: 301 SI-VISVICCG--LMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPME 357
            +  IS+ C    ++G  G+  F      N++  +P    A  + +      +   FP++
Sbjct: 225 PLTAISIACIMYLIVGTFGYVTFGSNITSNIVAQYPTNSIATILGQTAMLTVVTLAFPLQ 284

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 379 DEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLT 438
            E TQ    QH ++T++++  +  I+++  +L  +  ++GAT ++++++ILP     +L 
Sbjct: 359 QEPTQF---QHILLTTIILLGSWLIAISVKSLAHVLAIVGATGSTSISFILPGLFGAILI 415

Query: 439 SKKKNWK 445
           S+  +++
Sbjct: 416 SRDNSFE 422

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/335 (22%), Positives = 142/335 (42%), Gaps = 31/335 (9%)

Query: 67  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI-IGGLISYIAL---GFIVDWTLRLIV 122
           D   +   + +NL  +I+GAG++  PFA +N G+ IG L++ IA    GF +     L  
Sbjct: 2   DPTGTPASSTVNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLIAAVTSGFGL---FILAK 58

Query: 123 INLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVF 180
            + TL   R         M     L  LF   +    F           D  P +     
Sbjct: 59  CSKTLINPRN-SSFFTLCMLTYPSLSPLFDLAMIVQCFGVGLSYLVLIGDLFPGLF---- 113

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMI---VIVLTVVI 237
               GE  FW+  + +II+       PL   + ++ L  +S + + ++    ++++T   
Sbjct: 114 ---GGEPRFWILLSSLIIV-------PLCCLKKLDSLRYSSIIGLFALAYLSLLIVTYFA 163

Query: 238 RGPMLPYDWRGHTLKLS--DIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
              +L +D++ +  ++    ++    +  + S+I FA     N   I   ++  S+A  T
Sbjct: 164 HDTLLTHDYKSYRGEVCWFKVYDFKGLLSTFSIIVFAYTGSMNLFSIINELKENSMANIT 223

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
            + + SI IS      +G  G+  F   T GN++ ++    T + V +LC G  ++ +FP
Sbjct: 224 SVINTSITISTAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVMLSFP 283

Query: 356 MEIFVLRDVVGNLL--HECHLIKNYDEHTQLSNKQ 388
           +     R  + NL+   E H  K+    +Q +  +
Sbjct: 284 LLFHPCRIAINNLVVWSEIHFKKDPIMPSQQAQAR 318

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 93/413 (22%), Positives = 174/413 (42%), Gaps = 69/413 (16%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF--IVDWTLRLIVINLTLAGKRTYQ 134
           + L ++  GAGI+  PFA K  G+  GL+  +  G   I    L+  +I  T     T +
Sbjct: 8   VTLLHTACGAGILAIPFAFKPFGLFPGLMVLVVCGIAAIFGLLLQAKIIKYT----PTNE 63

Query: 135 GTVEYVMGKK--GKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFW 190
               +++  K    L ILF   +    F           D +     AV   N+      
Sbjct: 64  KHSFFILATKLHPTLAILFDLAIAVKCFGVSTSYLIAIGDFL-----AVLLDNE------ 112

Query: 191 LRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGHT 250
            R N I   V +FI  PLS  R I  L   S LAV S+  + + V        Y +   +
Sbjct: 113 YRMNTIT-FVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVT-------YHYCKPS 164

Query: 251 LKLSDIFIKTTIF----------RSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
            ++S++    ++F          ++L +  FA  CHHN   +    ++    +   +  I
Sbjct: 165 EEISELRGTVSLFLPKSSGISPFKTLPIFVFAYTCHHNMFAVINEQKHTDFKRLKFIPLI 224

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT-TFPMEIF 359
           +I I+ I   ++G  G+A F      N++  +P T++ + V        ++T  +P++  
Sbjct: 225 AISIACILYLIVGCLGYATFGANITSNIVAKYP-TNSVLTVLGQTAMLTVVTLAYPLQCQ 283

Query: 360 VLRDVVGNLLH--------------ECHLIKNY----DEHTQLSNKQ----------HTI 391
             R  + N+L+              E  +   Y    +E+ Q S  +          H+I
Sbjct: 284 PARASILNILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSI 343

Query: 392 ITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNW 444
           +TS+++F +  I+++  +L  +  ++GAT ++ +++ILP    ++L  K  ++
Sbjct: 344 VTSLILFGSWCIAVSVNSLAQVLAIVGATGSTFISFILPGLFAVVLIPKDNDF 396

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 105/455 (23%), Positives = 173/455 (38%), Gaps = 80/455 (17%)

Query: 52  SDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAG--------IIGG 103
           ++ + +L          KSS   A + L  S +G G++  P A  N G        II  
Sbjct: 109 NEEEQELEPTPPSSQHNKSSTTKAILLLLKSFIGTGVLFLPKAFSNGGYVFSLVSLIICS 168

Query: 104 LISYIALGFIVDWTLRLIV-----INLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAF 158
           LISY     ++D   +L V     + LTL G          ++ K   L I+ +   FA 
Sbjct: 169 LISYYCFILLLDTKSKLNVNGYGDLGLTLYGS---------ILQKSILLSIVLSQLGFA- 218

Query: 159 XXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLS 218
                       T  H L      N  +           I++  F+  PLS  RNI  LS
Sbjct: 219 ----AAYNVFTATNLHSLSTSLITNPPD----FITIPFCILLQTFLFIPLSFTRNITKLS 270

Query: 219 KASFLAVLSMIVIVL--------TVVIRGPMLPYDWRGHT---LKLSDIFIKTTIFRSLS 267
             + +A L + + ++         +  +GP    DW+  T    K   +FI T IF    
Sbjct: 271 STALIADLFIFIGLIYLYYYPIKIIATKGP----DWQTMTPFNTKDWSLFIGTAIFTYEG 326

Query: 268 VISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGN 327
           +    L+     S        +S   F K   + +VI  +    +G  G++AF       
Sbjct: 327 I---GLLIPIQESM-------KSPHHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTV 376

Query: 328 VLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVL----------RDVVGNLLHECHLIKN 377
           +L +FP  +   ++ +L +   +L + P+++F            +D  G   H     KN
Sbjct: 377 LLQNFPQDNPCTSLVQLLYSLAILLSTPLQLFPAIKILENWIFSKDASGKYNHSIKWAKN 436

Query: 378 YDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLL 437
           Y   T +      I+TS++ +      L   +L     L+G+     + Y+ PP  +   
Sbjct: 437 YFRSTIV------ILTSLISY------LGANDLNKFVALVGSFACIPLIYVYPPLLHYKA 484

Query: 438 TSKKK--NWKAKLPYYFCICFGFMIMIVSSTQTIL 470
           T       WK  L  +  + FG + MI +S QTI+
Sbjct: 485 TQLDNTFTWKTLLADFSLLTFGIITMIYTSLQTII 519

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 129/314 (41%), Gaps = 30/314 (9%)

Query: 67  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV-INL 125
           +  +S+  + +NL  +I+GAG+   PFA KN GI+ G++  +       + L ++   + 
Sbjct: 2   EPTASVTSSTVNLVKTIVGAGLFAIPFAFKNDGILVGILLIMLAAVTSGFGLFILAKCSK 61

Query: 126 TLAGKRTYQGTVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQN 183
           TL   R         M     L  LF   +    F           D  P +        
Sbjct: 62  TLINPRN-ASFFSICMLTYPSLSPLFDLAMIVQCFGVGLSYLVLMGDIFPSLF------- 113

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMI--------VIVLTV 235
            G   +W       I+ + FI  PL   + ++ L  +S L  +++I        V V  +
Sbjct: 114 GGNRDYW-------IVASAFIVVPLCCLKKLDNLKYSSILGNIALIYLALFIFGVFVKDI 166

Query: 236 VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
           +I G       RG  +    I+    +  + S+I FA V   N   I   + N S+    
Sbjct: 167 LIEGNTFA---RGE-ISWIRIYDGKGLLSTFSIIIFAYVGAMNLFSICRELENDSMENIL 222

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
           K+ + SI IS I   L+G SG+  F    +GN++ ++      I + + C  F +L +FP
Sbjct: 223 KVINGSIGISSIFFLLVGISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCLAFMLLLSFP 282

Query: 356 MEIFVLRDVVGNLL 369
           +    LR  V NL+
Sbjct: 283 LLFHPLRIAVNNLV 296

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 96/211 (45%), Gaps = 14/211 (6%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV---IRGPM 241
           G+  +W+  + ++I+       PL L R+++ L  +S L + ++  +V  V+   + G +
Sbjct: 116 GDRDWWILGSALLII-------PLCLLRHLDSLKYSSILGLFALAYLVTLVIGTFVYGVV 168

Query: 242 LPYDW---RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLT 298
           L  D+   RG    +  ++    +  + S+I FA  C  N   I   + + SV+  TK+ 
Sbjct: 169 LHDDYKYTRGDVFWVK-VYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKVA 227

Query: 299 HISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEI 358
           + SI I+      +G +G+  F     GN++ ++        V + C G  ++ +FP+  
Sbjct: 228 NSSIGIATFLILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPLMF 287

Query: 359 FVLRDVVGNLLHECHLIKNYDEHTQLSNKQH 389
              R    N++H   +   + E  Q +N  H
Sbjct: 288 HPCRLATNNMVHWLQVNYGHCETHQTANNDH 318

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 89/465 (19%), Positives = 184/465 (39%), Gaps = 65/465 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL----------R 119
           S++R   + L ++  GAGI+  P+A K  G+I G I     G    W L          +
Sbjct: 3   STIRYGVLTLLHTACGAGILAMPYAFKPFGLIPGFIMIAICGLCSLWGLILQARVTKYSK 62

Query: 120 LIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAV 179
               + T   +     ++  ++     ++      +  F           D +P +L  +
Sbjct: 63  TDDNDDTANDRSVSFFSLTQIINPNLSVIFDLAIAIKCFGVGVSYMIVVGDLMPQILSHL 122

Query: 180 FSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRG 239
             ++       L RN  I ++ + I  PL   +N+  L  AS +A+ S++ + + VV   
Sbjct: 123 IPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVFHF 182

Query: 240 PMLPYDWRGHTLKLSDIFI--KTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKL 297
                + +    +LS      + +   +L +  FA  CHHN   +     + S     KL
Sbjct: 183 LSPSQEIKDLKGELSYWLPNNEPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSFHNIKKL 242

Query: 298 THISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPME 357
             I++ ++     ++G SG+  F +   GN++  +P + ++  + R+   F +   FP++
Sbjct: 243 AIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGRMAIVFLVTLAFPLQ 301

Query: 358 IFVLRDVVGNLL------------------------------HECHLIKNYDEHT----- 382
               R  + +++                                  LI++    T     
Sbjct: 302 CHPARASIHHIILYITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEE 361

Query: 383 --------QLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPY-- 432
                    L  KQ  +IT+ ++  +  ++++  +L  +  ++GAT ++++++ILP    
Sbjct: 362 SPLQPVTVPLEGKQFILITTSILICSYLLAISVSSLAHVLAIVGATGSTSISFILPGVFG 421

Query: 433 ----TNLLLTSKKKNWKAKLPYY---FCICFGFMIMIVSSTQTIL 470
                + +LT+++   K +L  Y       +G  IMI S   +IL
Sbjct: 422 YKLIGSEMLTTEQLPIKTRLFKYSGLLLSIWGVFIMITSLAASIL 466

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 134/316 (42%), Gaps = 32/316 (10%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV-INLTLAGKRTYQG 135
           +NL  +I+GAG++  P+A +  G+   +   +   F   + L ++   + TL   R +  
Sbjct: 12  INLIKTIVGAGLLAIPYAFRCDGVFFAVSLILMAAFTSGYGLFILAKCSKTLLNPR-HSS 70

Query: 136 TVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRR 193
                      L +LF   +F   F           D  P    A+F    G    W+  
Sbjct: 71  FFTLCSITYPNLSLLFDFAMFIQCFGVALSYLILIGDLFP----ALFG---GTRTNWILL 123

Query: 194 NVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV-----IRGPMLPYDWRG 248
           + III+       PLSL R+ + L   S + +L++  I L ++        P    DW  
Sbjct: 124 SAIIIV-------PLSLLRHFDSLKYTSVIGLLALGYIGLLIIGSYSFGNYPKPKVDW-- 174

Query: 249 HTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVIC 308
               +SD   ++ +  + S+I FA     N   I   ++  S+    K+ + SIV+S  C
Sbjct: 175 --FSISD---RSGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSAC 229

Query: 309 CGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNL 368
             ++G  G+  F ++T GNV+ ++     ++  AR   G  ++ +FP+     R    N+
Sbjct: 230 FIILGLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPLLFHPCRISANNM 289

Query: 369 LHECHLIKNYDEHTQL 384
           +H   L  NY   +++
Sbjct: 290 VHWLQL--NYGTKSEI 303

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 97/424 (22%), Positives = 169/424 (39%), Gaps = 47/424 (11%)

Query: 65  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV-I 123
           +  KK S   A + L  S +G GI+  P    N G     IS +    I  +   L++  
Sbjct: 175 DKSKKVSTTKAILLLLKSFVGTGILFLPKGFSNGGYSFSTISLLLCSVISYYCFVLLIST 234

Query: 124 NLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQN 183
             T  G   Y    +++ G+  K  IL +  L                +  +  +VF   
Sbjct: 235 KDTTHGINGYGDLGQHLFGRPMKFAILLSIVLSQIGFSAAYTVFVATNLKTLCNSVFENL 294

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV-------- 235
           D  + F+     II    +FI  PLS  RNI  L+  + +A   +++ +L +        
Sbjct: 295 DSSIKFF-----IIFQAILFI--PLSFTRNITKLTATALIADFFILIGLLYIYYYPISYI 347

Query: 236 ----VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
               + RG M+P++ +  +L     FI T IF +   I   +           SM    +
Sbjct: 348 SYNGIARGTMVPFNNKSWSL-----FIGTAIF-TFEGIGLLIPIQE-------SMAKPHL 394

Query: 292 AKFT-KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNM 350
            + +  L  + + +  +  GL+ YS F +  E     VL +FP       + +L +   +
Sbjct: 395 FRLSLSLVMVIVTLIFVSVGLLCYSAFGSDVETV---VLLNFPQDSPYTLIVQLLYSLAI 451

Query: 351 LTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLS-NKQHTIITSMLVFITMGISLTTCN 409
           L + P+++F    ++ N + +      Y+   + + N   T++     FI     +   +
Sbjct: 452 LLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNYFRTLVVIGTSFIAW---IGADD 508

Query: 410 LGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKA---KLPYYFC-ICFGFMIMIVSS 465
           L     L+G+     + YI PP   L + + K+N       L    C I FGF I+I +S
Sbjct: 509 LDKFVSLVGSFACIPLIYIYPPL--LHIKALKRNGTVTNLHLIVDSCMIIFGFTILIYTS 566

Query: 466 TQTI 469
            QTI
Sbjct: 567 CQTI 570

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/354 (20%), Positives = 146/354 (41%), Gaps = 51/354 (14%)

Query: 63  LRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIV 122
           +  N   ++   + +NL  +I+GAG++  P+A ++ G++ G++  +       + L ++ 
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 123 -INLTLAGKRTYQG-TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
             + TL   R     T+  +      L+  F+  +  +           D  P ++    
Sbjct: 61  KCSKTLTNPRASSFFTLCSITYPSLSLVFDFSMFIQCYGVGLSYLVLIGDLFPGIV---- 116

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV---- 236
               G  + W+  + +II+       PLSL + ++ L  +S L + ++  +V  +V    
Sbjct: 117 ---GGSRNMWIMASALIIV-------PLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFL 166

Query: 237 -----------IRGP---MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFI 282
                      IRG    +  YD++G             +  + +++ FA     N   I
Sbjct: 167 RDVVFTDNYTAIRGDVSWIRVYDFKG-------------LISTFTIVIFAYTGSMNMFSI 213

Query: 283 FFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVA 342
              +++ S+    K+   +I IS      +G  G+  F   T GN++ ++          
Sbjct: 214 INELKDNSMTNINKVVSTTITISSFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTG 273

Query: 343 RLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHT--QLSNKQHTIITS 394
           +LC G  ++ +FP+ +   R    N++H    I NY +    Q++  QHT +TS
Sbjct: 274 KLCLGSMVILSFPLLLHPCRIAANNMVHWT--IINYGKCADHQIARNQHTHVTS 325

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 90/418 (21%), Positives = 165/418 (39%), Gaps = 81/418 (19%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLI----SYIALGFIVDWTLRLIVINLTLAGKRT 132
           +NL  +I+GAG++  P+  +N G++ G++    + IA GF +     L   + T+   R 
Sbjct: 15  INLTKTIVGAGLLAIPYVFRNDGVLVGILMTVLAAIASGFGL---FVLAKCSKTMINPRN 71

Query: 133 YQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLR 192
                  +M       +   + L  F             I  +  AVF    G  H+W+ 
Sbjct: 72  SSFFTLCMMTNPS---LCPCSDLAMFVQCFGVGLSYLVLIGDLFPAVFG---GPRHYWII 125

Query: 193 RNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSM---IVIVLTVVIRGPMLPYDW--- 246
            + III+       PL L +N+  L  +S L + ++    ++V+ + I    L  ++   
Sbjct: 126 GSGIIII-------PLCLLKNLNSLRYSSILGLFALAYLTILVIVIYINNVFLTDNYLET 178

Query: 247 RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISV 306
           RG     S ++  T +  + S+I FA     N   I   + N S+   TK+ + SI IS 
Sbjct: 179 RGDVNWFS-VYDWTGLCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKVINRSIGIST 237

Query: 307 ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVG 366
               L+G SG+  F   T GN++ ++        + + C G  ++ +FP+    LR  V 
Sbjct: 238 FLFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLLFHPLRIAVN 297

Query: 367 NLL---------------------------------------------------HECHLI 375
           N++                                                   +E   I
Sbjct: 298 NMVIFYQINYGSNKENTSPNIRSNTSDLSPISLTINDDDIRSMPDDNVDDVLLSNEVTEI 357

Query: 376 KNYDE---HTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
           +  D     T   N +   I+ +L+ +   +SLT  +   +  ++GAT  +++++ILP
Sbjct: 358 EELDNVLCETPFPNHRFYTISLLLLLVMYSVSLTVTSFAYVLAIVGATGGTSISFILP 415

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 104/427 (24%), Positives = 159/427 (37%), Gaps = 65/427 (15%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAG--------IIGGLISYIALGFIVDWTLRL 120
           KSS   A + L  S +G G++  P A  N G        +I  LISY        W   L
Sbjct: 289 KSSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSSSVLLICALISY--------WCFVL 340

Query: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
           ++      G   Y     ++ G   KL IL++  L                +      VF
Sbjct: 341 LIDTKNHVGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATNLQVFTNNVF 400

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV----- 235
            Q  G   F      III V  F+  PL+L RNI  LS  + +A L +++ ++ V     
Sbjct: 401 KQEYGITIF------IIIQVLFFL--PLALTRNIAKLSGTALIADLFILLGLVYVYWFSI 452

Query: 236 -------VIRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFS 285
                  V    ML +   DW         +FI T IF +   I   +           S
Sbjct: 453 SHVSTHGVASETMLMFNKADW--------SLFIGTAIF-TFEGIGLLIPIQE-------S 496

Query: 286 MRNRSVAKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVAR 343
           M+ +       L+ +  V++V  I CGL+ Y  F A  E     VL +FP         +
Sbjct: 497 MK-KPEHFHASLSGVMCVVTVVFISCGLICYCAFGADVETV---VLLNFPQESIYTRAVQ 552

Query: 344 LCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQ-LSNKQHTIITSMLVFITMG 402
           L +   +L + P+++F    ++ N     H    ++   + L N     I      I   
Sbjct: 553 LLYALAILLSTPLQLFPAIKILENWTFSPHSSGKHNPKVKWLKNYFRAAIVCFSALIAWA 612

Query: 403 ISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMI 462
                 +L     L+G+     + YI PP  +     K K+        F + FG ++MI
Sbjct: 613 ---GANDLDKFVSLVGSFACIPLIYIYPPMLHFKAFKKDKSKLFMASDIFLLFFGIIVMI 669

Query: 463 VSSTQTI 469
            +S QTI
Sbjct: 670 YTSLQTI 676

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 97/463 (20%), Positives = 178/463 (38%), Gaps = 72/463 (15%)

Query: 49  PIISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI---IGGLI 105
           P++ +TD +    V      K+S   AF+ +  S +G G++  P A  N G+   I  L 
Sbjct: 278 PLLLNTDPEQQQQVPAHLRVKTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLF 337

Query: 106 SYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXX 165
            + A  +   W   ++V +    G  ++      + G   K +ILF+  L          
Sbjct: 338 FFSAYSY---WCYYILVRSKDATGVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYV 394

Query: 166 XXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSK----AS 221
                 +   L  VF+  D  V +       +++  +FI  PLS  RN+  LS     A+
Sbjct: 395 VFTAKNLIAFLDNVFNWPDIPVKY-------LLLTQLFIFIPLSFVRNVSKLSITSLFAN 447

Query: 222 FLAVLSMIVIVLTVVIR-----------GPML---PYDWRGHTLKLSDIFIKTTIFRSLS 267
           F  +  +I++V     R           G ++   P  W         +FI T IF +  
Sbjct: 448 FFIISGLIIVVYYTACRWMYDLSFKPAEGVIMVFNPNRW--------SLFIGTAIF-AFE 498

Query: 268 VISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGN 327
            I   +           SMR+    +F K+  + I+ + +    +G  G+ A+  + +  
Sbjct: 499 GIGLIIPVQE-------SMRHPE--EFPKVLGLVIITTTVLFITIGTLGYLAYGSQIQSV 549

Query: 328 VLNSFPGTDTAINVARLCFGFNMLTTFPMEI--------------FVLRDVVGNLLHECH 373
           +L + P    ++N+ +L +   +L + P+++              F   D+ G    +  
Sbjct: 550 ILLNLPQDALSVNMIQLFYSMAILLSTPLQLFPAIGIIENKFFPRFTKVDIKGQDSADFQ 609

Query: 374 LIKNYDEHTQLSNKQHTIITSMLVFITMGIS-LTTCNLGALFELIGATTASTMAYILPPY 432
           L +N             ++ S++V + + ++     NL     ++G      + YI P  
Sbjct: 610 LQQNSGRANWRVKWSKNLVRSIIVLLVIILAYFGADNLDLFVSIVGCLACIPLVYIYPSM 669

Query: 433 TNLLLTS-----KKKNWKAK---LPYYFCICFGFMIMIVSSTQ 467
            +L   S     K   WK +   L  Y  I FGF+ M  +S Q
Sbjct: 670 LHLRSCSTPDHEKSNTWKTRCSVLIDYILIIFGFVSMCYTSYQ 712

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 117/264 (44%), Gaps = 42/264 (15%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIV------------ 232
           GE +FW+  + +II+       PL L + ++ L  +S L + ++  I             
Sbjct: 115 GERNFWIIASTVIII-------PLCLVKKLDQLKYSSILGLFALAYISVLVFSHFVFELG 167

Query: 233 ---LTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289
              LT V+R  +    W+ H LK         +  + S+I FA     N   +   +++ 
Sbjct: 168 HGELTNVLRNDICW--WKIHDLK--------GLLSTFSIIIFAYTGSMNLFPMINELKDN 217

Query: 290 SVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349
           S+   T + + SI +S     ++G SG+  F  KT GN++ ++  T   I + + C G  
Sbjct: 218 SMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLGNLILNYDPTSIWIVIGKFCLGLM 277

Query: 350 MLTTFPMEIFVLRDVVGNLLHECHLI---KNYDEHTQLSNKQHTIITSMLVFITMGISLT 406
           ++ +FP+    LR  V N++    +     N +E  Q+S  ++T  +++       IS+T
Sbjct: 278 LILSFPLLFQPLRIAVNNVIIWIEITFGDANPEEDPQVS--EYTRASNL-----RPISMT 330

Query: 407 TCNLGALFELIGATTASTMAYILP 430
             +     + + AT+     ++LP
Sbjct: 331 VDDPAQPNDALDATSYDEQEHLLP 354

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/342 (20%), Positives = 135/342 (39%), Gaps = 61/342 (17%)

Query: 67  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLT 126
           +  +++  + +NL  +I+GAG++  PF  +N GI+ G++                   LT
Sbjct: 2   EAVATVNSSIVNLVKTIVGAGLLAIPFVFQNDGILFGVL-------------------LT 42

Query: 127 LAGKRTYQGTVEYVMGKKGKLLILFTNGLF----------------------AFXXXXXX 164
           L    T  G   + + K  K+++   N  F                       F      
Sbjct: 43  LLAATT-SGFGLFALAKCSKVMLNPRNASFFTVCLMTNHKLSVINDLAMIVQCFGVGVSY 101

Query: 165 XXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA 224
                D  P V         GE + W+  ++++I+       PL L R++  L  +S L 
Sbjct: 102 VVLVGDLFPIVF-------GGERNTWIIASLVVIL-------PLCLLRSMNSLKYSSILG 147

Query: 225 VLSMIVIVLTVV---IRGPMLPYDWRGHTLKLSDIFIK--TTIFRSLSVISFALVCHHNT 279
           + ++  + L V+   +   +L   +  H   ++ I I+       + ++I FA     N 
Sbjct: 148 LFALTYLTLLVISNFLDDVILTDKFMQHRGDVNWIKIRDYKGFVTTFNIIIFAFTGAMNL 207

Query: 280 SFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAI 339
             I   +   S+   + + + SI IS I    +G +G+  F   T GN++ ++       
Sbjct: 208 FSIINELEENSMKNISHVINYSIGISTILFLSVGITGYLTFGSNTVGNIMLNYDPNSVWT 267

Query: 340 NVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEH 381
           NV   C G  ++ +FP+    LRD V N++      K+ ++ 
Sbjct: 268 NVGNFCLGAMVILSFPLLFHPLRDAVNNIIVYYQYYKSNNDQ 309

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 94/418 (22%), Positives = 166/418 (39%), Gaps = 47/418 (11%)

Query: 68  KKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTL 127
           + +S   A + L  S +G G++  P A  N G +   +  +    +  +   L++   T 
Sbjct: 182 RNTSTTKAVLLLLKSFVGTGVLFLPRAFHNGGWLFSTLCLLFCATVSFYCFILLIDTKTA 241

Query: 128 AGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEV 187
            G   Y      + G K K  +L +  L                +    + VFS     +
Sbjct: 242 VGVDGYGELGSRLFGPKLKFTVLSSIVLSQIGFAAAYTVFTATNLQAFFKHVFSLEYSLI 301

Query: 188 HFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV------------ 235
            FW       IM+ +    PLSL RNI  LS  + +A L +++ ++ V            
Sbjct: 302 -FW-------IMIQLAFYLPLSLTRNIARLSATALVADLFILLGLVYVYYYSSFYIWNHG 353

Query: 236 VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
           +    M+ ++    TL     FI T IF +   I   +  H        SM   +  K  
Sbjct: 354 IASDSMVSFNKSDWTL-----FIGTAIF-TYEGIGLLIPIHE-------SMEKPAHFK-P 399

Query: 296 KLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTT 353
            L ++ +V+++  I CGL+ YS F A   K +  +L +FP      N  +L +   +L +
Sbjct: 400 ALMYVILVVTIIFISCGLICYSAFGA---KVETVILLNFPSNSIFTNAVQLIYALAILLS 456

Query: 354 FPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCN-LGA 412
            P+++F    ++ N +   +    +D   +    +     + +V I + I+    N L  
Sbjct: 457 TPLQLFPAIKILENKIFHKNASGKFDAKVKW---RKNYFRAFVVLIAVIIAWIGANDLDK 513

Query: 413 LFELIGATTASTMAYILPPYTNLLLTSKKKNWKA-KLPYYFCICFGFMIMIVSSTQTI 469
              LIG+     + YI PP  +  +    K  +A  L     + FG ++M  +S QTI
Sbjct: 514 FVSLIGSFACIPLIYIYPPLFHYKVFENNKKLQAIDLA---ILIFGALVMSYTSWQTI 568

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 173/435 (39%), Gaps = 65/435 (14%)

Query: 75  AFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQ 134
           AF+ L  S +G G++  P A  N G+   ++  +  G    W   +++    + G  ++ 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 135 GTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAV--FSQNDGEVHFWLR 192
                + G   K +ILF+                 + +      V  FS+N   ++F L 
Sbjct: 367 DIGLRLYGPWVKFIILFSLVFTQLGFSGAYVIFTAENLKAFCSNVLHFSENIPILYFMLA 426

Query: 193 RNVIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVL-----TVVIRGPMLPY 244
           +  I I        PLS  RN+  LS  S LA   V+  +VIVL      + +   M P 
Sbjct: 427 QFAIFI--------PLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKPA 478

Query: 245 DWRGHTLKLS----DIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
           +  G  L  +     +FI T IF +   I   +           SMR+    KF  +  +
Sbjct: 479 E--GVVLLFNTNRWTMFIGTAIF-AFEGIGLVIPVQD-------SMRHPE--KFPLVLGM 526

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
            I+ S +    +G  G+ A+  K K  +L + P  + ++N+ +  +   ++ + P+++F 
Sbjct: 527 VIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFP 586

Query: 361 LRDVVGNLLHECHL---IKNYDEHTQLSNKQHT-----------------IITSMLVFIT 400
              ++ N +    +   +K  D  T +  + ++                 I+ S+++   
Sbjct: 587 AIKIIENKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNWKVKWLKNFVRSLIVGSVILMAY 646

Query: 401 MGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTS------KKKNWKAKLPYYFCI 454
            G       L     LIG+     + Y+ PP  +L   S       + NW A L Y   I
Sbjct: 647 FGAD----QLDKFVALIGSFACIPLVYMYPPMLHLRSCSLPNHKGGRINWSAGLDYVL-I 701

Query: 455 CFGFMIMIVSSTQTI 469
            FG + MI +S Q++
Sbjct: 702 IFGAISMIYTSYQSV 716

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 166/425 (39%), Gaps = 51/425 (12%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
           KSS   A + L  S +G G++  P A  N G     +  +    I  W    +++     
Sbjct: 319 KSSTFKAILLLLKSFVGTGVLFLPKAFHNGGWAFSSLCLLLCAIISYWCFLTLIVTKDKI 378

Query: 129 GKRTYQGTVEYVMGKKGKLLILFTNGL----FAFXXXXXXXXXXXDTIPHVLRAVFSQND 184
               Y    E + G   KL IL++  L    F+              + +VL    + N 
Sbjct: 379 HVDGYGDMGERLYGHPMKLAILWSIVLSQIGFSAAYTVFTATNLKVFVENVLVRTATMNP 438

Query: 185 -GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV------------I 231
            G    W     II+   IFI  PLSL R I  LS  + +A L +++            I
Sbjct: 439 TGYNLVWY----IILQQLIFI--PLSLTRKIAKLSGTALIADLFILLGLIYVYYYSSYYI 492

Query: 232 VLTVVIRGPML---PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRN 288
           +   +    ML     DW         +FI T IF +   I   +           SM+N
Sbjct: 493 LSNGIASESMLWLNKADW--------SLFIGTAIF-TFEGIGLLIPIQE-------SMQN 536

Query: 289 RSV-AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFG 347
             V  K   L    + I  I CGL+ YS   AF EK +  VL +FP       + +L + 
Sbjct: 537 PQVFPKCLSLVMCIVTIIFISCGLICYS---AFGEKVETVVLLNFPQDSAFTLMVQLLYS 593

Query: 348 FNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTT 407
             +L + P+++F    ++ N     H    ++  +++  K++     M++F  M   +  
Sbjct: 594 LAILLSTPLQLFPAIKILENWTFPIHASGKHN--SRIKWKKNYFRCIMVIFTAMVAWVGA 651

Query: 408 CNLGALFELIGATTASTMAYILPP--YTNLLLTSKKKNWKAKLPYYFCI-CFGFMIMIVS 464
            +L     L+G+     + YI PP  +    L    K  + +L     +  FG +IM+ +
Sbjct: 652 NDLDKFVSLVGSFACIPLIYIYPPLLHFKAFLNDTSKTMRFRLGLDMLVFVFGIIIMVYT 711

Query: 465 STQTI 469
           S +TI
Sbjct: 712 SWETI 716

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 136/350 (38%), Gaps = 62/350 (17%)

Query: 67  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLT 126
           D  ++   + +N+  +I+GAG++  P+A K+ GI+ G                     LT
Sbjct: 2   DAGATAFFSTVNMVKTIVGAGMLAVPYAFKSDGILVG-------------------TALT 42

Query: 127 LAGKRTYQGTVEYVMGKKGKLLI--------------------LFTNGLF--AFXXXXXX 164
           + G  T  G   +V+ K  K LI                    +F   +F   +      
Sbjct: 43  IVGAVT-SGFGLFVLAKCSKTLINPRASSFFTLCSITYPSLSLIFDFAMFVQCYGVGLSY 101

Query: 165 XXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFL- 223
                D  P V+               RR  II   +   + PLSL + ++GL  +S L 
Sbjct: 102 LVLVGDLFPGVVGGT------------RRGWII--GSTLATVPLSLIKRLDGLKYSSILG 147

Query: 224 --AVLSMIVIVLTVVIRGPMLPYDWRGHTLKLS--DIFIKTTIFRSLSVISFALVCHHNT 279
             AV  ++ ++L   ++  +L  ++R     +S   ++ K  +  + ++I FA     N 
Sbjct: 148 LFAVAYLVCLILGSFLKDVVLSENYREFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNL 207

Query: 280 SFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAI 339
             I   +++ S+    K+   SI  S      +G  G+  F     GN++ ++       
Sbjct: 208 FSIINELKDNSMQNINKVITSSISTSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWT 267

Query: 340 NVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDE-HTQLSNKQ 388
            + +LC G  ++ +FP+ +   R    N++H   L     E H +  NK 
Sbjct: 268 TIGKLCLGTMVILSFPLLLHPCRIAANNMMHWILLTYGKCEVHHEARNKH 317

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/330 (21%), Positives = 139/330 (42%), Gaps = 33/330 (10%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGG----LISYIALGFIVDWTLRLIVINLTLAGKRT 132
           +NL  +I+GAG++  P+A    GI+ G    L++ +  GF +     L   + TL   R 
Sbjct: 14  INLVKTIIGAGLLAIPYAFAQDGILVGILLTLLAAVTSGFGL---FALAKCSKTLIDPRR 70

Query: 133 YQGTVEYVMGKKGKLLILFTNGLFA--FXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFW 190
                   M    +L  LF   +    F           D  P +         G+  +W
Sbjct: 71  -SSFFTLCMLTYPRLSPLFDFAMIVQCFGVGLSYLVLMGDIFPGLF-------GGDRQYW 122

Query: 191 LRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMI---VIVLTVVIRGPMLPYDW- 246
           +  + +II        PL   + ++ L  +S L + ++    V+VL++ ++  +L  ++ 
Sbjct: 123 IVASAVIIG-------PLCSLKKLDHLKYSSVLGLFALAYLAVLVLSMFVKDVILTDNYK 175

Query: 247 --RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVI 304
             RG  L   +I+    +  + S+I FA V   N   I   + + ++   +K+ + SI I
Sbjct: 176 VVRGTILWF-EIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAI 234

Query: 305 SVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDV 364
           S +    +G +G+  F   T GN++ ++      +N+ +      +L +FP+    LR  
Sbjct: 235 STVAFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIA 294

Query: 365 VGNLLHECHLIKNYDEHTQLSNKQHTIITS 394
             NL+    +  N++E    S    T + +
Sbjct: 295 CNNLVVWFEI--NFNEAQPSSYYTSTFVNA 322

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 79/396 (19%), Positives = 158/396 (39%), Gaps = 44/396 (11%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGG--LISYIALGFIVDWTLRLIVINLT 126
            SS++   + L ++  GAG++  P+A +  G++ G  +++      +V   L+  V    
Sbjct: 2   SSSVQSGVLTLLHTACGAGVLAMPYAFRAFGLLAGGAILACCGASAMVGLVLQSHVAQYV 61

Query: 127 LAGKRTYQGTVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQND 184
              + ++    +       +L ++F   +    F           D +P +   V +   
Sbjct: 62  PPRQASFFSLAQI---SNPELSVVFDCAIAVKCFGVGVSYLVVLGDLMPQLAGTVTAAP- 117

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRG----P 240
               + L RNV I   T  +  PL   R++  L  AS +AV ++  +   V  R     P
Sbjct: 118 ----WLLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSP 173

Query: 241 MLPYDWRGH-TLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTH 299
            L    RG  +L L        +  S  +  FA  CHHN   I   +R+ S+    ++  
Sbjct: 174 EL-ERLRGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVV 232

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
            +I ++V     +G +G+  F +   GN++  +P    A  + R      ++  FP++  
Sbjct: 233 AAIALAVALYATIGGAGYLTFGDHITGNIIAQYP-PAPATTLGRAAIAVLVMLAFPLQCH 291

Query: 360 VLRDVVGNLLHEC---HLIK----------------------NYDEHTQLSNKQHTIITS 394
             R  + ++ H C   H +                       N      L   +   IT+
Sbjct: 292 PARASINHIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPLGPPRFAAITA 351

Query: 395 MLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
            L+  +  ++++  +L  +  ++GAT ++ +++ILP
Sbjct: 352 ALLIASYAVAVSVTSLARVLAVVGATGSTAISFILP 387

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/336 (20%), Positives = 140/336 (41%), Gaps = 44/336 (13%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAG 129
           S+ R   + L ++  GAGI+  PFA K  G++ G        F +     L  +   L  
Sbjct: 7   SNTRSGVITLLHTACGAGILAMPFAFKPFGLVPG--------FAMLTICGLCSLLGLLLQ 58

Query: 130 KRTYQGTVE-----YVMGKK--GKLLILF--TNGLFAFXXXXXXXXXXXDTIPHVLRAVF 180
            R Y+   E     + + +K    L ++F     +  F           D +P ++  + 
Sbjct: 59  ARVYRYAPERAASFFSLTQKINPNLSVVFDLAIAIKCFGVGVSYMIVVGDLMPQIVSGL- 117

Query: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240
           ++N       L R   I ++  F++ PL L +N+  L  AS +A+ ++  + + V++   
Sbjct: 118 TKNA----LLLDRVFHITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHF- 172

Query: 241 MLPYD-----------WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289
           + P             W  H         + +   +L +  FA  CHHN   +    +  
Sbjct: 173 IFPSQEIKDLKGDFAVWFPHN--------EGSPLSTLPIFVFAYTCHHNVFAVINEQKKT 224

Query: 290 SVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349
             A    +  I+++++++   L+G +G+  F     GN++  +P + T+  + R+   F 
Sbjct: 225 RFAHVKVIAIIAMLLALVLYVLIGGAGYFTFGNHIVGNIITLYPHSITS-TIGRVAIVFL 283

Query: 350 MLTTFPMEIFVLRDVVGNLL-HECHLIKNYDEHTQL 384
           +   FP++    R  + +++ +  H  K  D++ Q+
Sbjct: 284 VTLAFPLQCHPARASIHHIICYIKHKAKKRDQNQQI 319

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 371 ECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILP 430
           E H I N  E+T L  K   IIT +L+     ++++  +L  +  ++GAT ++++++ILP
Sbjct: 382 EEHPIFN-PENTPLEGKTFKIITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFILP 440

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/441 (20%), Positives = 180/441 (40%), Gaps = 52/441 (11%)

Query: 64  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVI 123
           R     +S   AF+ +  S +G G++  P A  N G+   +      G    W    I+I
Sbjct: 310 RSAKGTTSTFKAFLLMIKSFIGTGVLFLPNAFANGGLTFSVCMLSFFGIYSYWCY-YILI 368

Query: 124 NLTLAGKRTYQGTVEY-VMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQ 182
              +A K +  G + + + G   K +ILF+  L                +   L  VF  
Sbjct: 369 QSKVATKVSSFGDIGFRLYGTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVFRW 428

Query: 183 NDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRG 239
           +D  + +     ++ + + IFI  PLS  RN+  LS  S +A   V++ ++IV+  V++ 
Sbjct: 429 HDVPIEY-----LLFLQLAIFI--PLSFIRNVSKLSLTSLIANFLVMAGLIIVVFFVLKH 481

Query: 240 PMLPYDWR-------GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 292
            +L   +        G       +FI T IF +   I   +           SM++    
Sbjct: 482 LILDLHFTPAEGVIMGFNSSSWSLFIGTAIF-AFEGIGLIIPVQD-------SMKHPE-- 531

Query: 293 KFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLT 352
           KF  +  + I  + +    +   G+ ++ + T+  +L + P  +  +N+ +  +   +L 
Sbjct: 532 KFPLVLGLVIGAATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILL 591

Query: 353 TFPMEIF----VLRDVVGNLLHECHLIKNYDEHTQL---SNK--------QHTIITSMLV 397
           + P+++F    ++ + V     + ++ KN     +L   S K        ++++ + ++ 
Sbjct: 592 STPLQLFPAIAIIENKVFPRFTKIYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVS 651

Query: 398 FITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKK-----NWKAKLPY-- 450
           F+ +     + NL     ++G      + Y+ PP  +L   SK +      W  K P   
Sbjct: 652 FVILLAYYGSENLDKFVSIVGCFACIPLVYMYPPLLHLRSCSKPQCHGVTKWWKKWPIGL 711

Query: 451 -YFCICFGFMIMIVSSTQTIL 470
            Y  I FG + MI +S Q + 
Sbjct: 712 DYLLITFGGVSMIYTSYQCVF 732

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 76/359 (21%), Positives = 137/359 (38%), Gaps = 84/359 (23%)

Query: 67  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLT 126
           +  SS   +  NL  +I+GAG +  P++ K+ G++ G+I                   LT
Sbjct: 2   EATSSALSSTANLVKTIVGAGTLAIPYSFKSDGVLVGVI-------------------LT 42

Query: 127 LAGKRTYQGTVEYVMGKKGKLLILFTNGLF----------------------AFXXXXXX 164
           L    T  G   +V+ K  K LI   N  F                       F      
Sbjct: 43  LLAAVT-SGLGLFVLSKCSKTLINPRNSSFFTLCMLTYPTLAPIFDLAMIVQCFGVGLSY 101

Query: 165 XXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA 224
                D  P +         GE ++W+  + +II+       PL L + ++ L  +S L 
Sbjct: 102 LVLIGDLFPGLF-------GGERNYWIIASAVIII-------PLCLVKKLDQLKYSSILG 147

Query: 225 VLSMIVIV---------------LTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVI 269
           + ++  I                LT ++R  +    W+ H  K         +  + S+I
Sbjct: 148 LFALAYISILVFSHFVFELGKGELTNILRNDIC--WWKIHDFK--------GLLSTFSII 197

Query: 270 SFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVL 329
            FA     N   +   +++ S+   T + + SI +S     ++G SG+  F  +T GN++
Sbjct: 198 IFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIVGLSGYLTFGNETLGNLM 257

Query: 330 NSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLI---KNYDEHTQLS 385
            ++      I + + C G  ++ +FP+    LR  V N++    +     N +E  Q+S
Sbjct: 258 LNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIWIEITYGGANPEEDPQVS 316

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 100/217 (46%), Gaps = 31/217 (14%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV-------VI 237
           G+ ++W+  + ++I+       PL L + ++ L  +S L + ++  I + +       + 
Sbjct: 115 GDRNYWIIASTVVII-------PLCLVKKLDQLKYSSILGLFALAYISIFIFSHFAFELG 167

Query: 238 RGPM---LPYD---WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
           +G +   L  D   W+ H +K         +  + S+I FA     N   +   +++ S+
Sbjct: 168 KGKLTDVLENDICWWKIHDVK--------GLLSTFSIIIFAYTGSMNLFPMINELKDNSM 219

Query: 292 AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNML 351
              T + + SI +S I   ++G SG+  F  KT GN++ ++      I + + C G  ++
Sbjct: 220 ENITLVINNSITLSTILFLIVGLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLI 279

Query: 352 TTFPMEIFVLRDVVGNLLHECHLI---KNYDEHTQLS 385
            +FP+    LR  V N++    +     + +E TQ+S
Sbjct: 280 LSFPLLFQPLRVAVNNVIIWLEITFGNADPNEDTQVS 316

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 96/425 (22%), Positives = 171/425 (40%), Gaps = 48/425 (11%)

Query: 65  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWT-LRLIVI 123
           +N+KK+S   A + L  S +G GI+  P    N G     IS +    +  +  + LI  
Sbjct: 195 DNNKKASTFKAILLLLKSFVGTGILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLIST 254

Query: 124 NLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQN 183
              + G   Y     ++ GK  KL IL +  L                +  + + +FS N
Sbjct: 255 KDQMKGINGYGDLGNHLYGKNMKLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNN 314

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV-------- 235
               HF +   V+ I+    +  PLS  RNI  L+  + +A L + + V+ +        
Sbjct: 315 Q---HFSI---VLFIIFQTLLFIPLSFTRNITKLTATALVADLFIFIGVIYIYYYPITYI 368

Query: 236 ----VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
               +    ++P++ +  +L     FI T IF +   I   +    + +        +  
Sbjct: 369 IKNGIATETIVPFNNKNWSL-----FIGTAIF-TFEGIGLLIPIQESMA--------KPH 414

Query: 292 AKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349
             F  LT + ++++V  I  GL+ Y  F +  E     VL +FP         +L +   
Sbjct: 415 QFFISLTLVMVIVTVIFISVGLLCYCAFGSSVETV---VLLNFPQDSPYTLTVQLLYCLA 471

Query: 350 MLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCN 409
           +L + P+++F    ++ N + +      Y+   + +        S++V  T  I+ +  N
Sbjct: 472 ILLSTPLQLFPAIRILENWVFKKKGSGKYNPKIKWAKNY---FRSLIVIGTTCIAWSGAN 528

Query: 410 -LGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYF----CICFGFMIMIVS 464
            L     L+G+     + YI PP   L   + K N  A L   +     I FG ++M  +
Sbjct: 529 DLDKFVSLVGSFACIPLIYIYPPL--LHYKACKINGSANLVQNYLDIILILFGVILMSYT 586

Query: 465 STQTI 469
           S QTI
Sbjct: 587 SFQTI 591

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/306 (17%), Positives = 119/306 (38%), Gaps = 67/306 (21%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSM----IVIVLTVVIRGP 240
           G+  +W+  + ++++       PL L + ++ L  +S + + ++    ++I+ T V    
Sbjct: 115 GQRDWWIVGSSLVVV-------PLCLLKKLDSLKYSSIIGLFALAYLSLLILSTFVYEYS 167

Query: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300
              Y+     +    ++    +  + S+I FA     N   I   +RN ++   T + + 
Sbjct: 168 SGRYEEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNR 227

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360
           SI I+ +    +  +G+  F   T GN++ ++  T   +++ + C G  ++ TFP+    
Sbjct: 228 SIAIATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHP 287

Query: 361 LRDVVGNLL--------------HECH------------------------LIKNY---- 378
            R  V NL                EC                         L+ +Y    
Sbjct: 288 CRIAVNNLCVWAQLQREKRAESHQECEPLNPNTPSSVRPISLSVQDSDSRSLVNSYGATQ 347

Query: 379 --------------DEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTAST 424
                           H  + + +  IIT++L+     ++L   +   +   +GAT +++
Sbjct: 348 GNEEIEDLEVAGNGSPHVNIPDGRFYIITALLLIAMYALALNVNSFATVLAFVGATGSTS 407

Query: 425 MAYILP 430
           +++ LP
Sbjct: 408 ISFTLP 413

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 98/425 (23%), Positives = 163/425 (38%), Gaps = 56/425 (13%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
           K+S   A + L  S +G G++  P A  N G     +  +    +  +   L++I     
Sbjct: 252 KTSTFKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFILLIITKDKV 311

Query: 129 GKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVH 188
           G   Y    E + G K KL IL +  L                +    +   +  DG + 
Sbjct: 312 GVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATNLQVFCQGALNLPDGSLG 371

Query: 189 FWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV------------V 236
             +    I++   IFI  PLSL RNI  LS  + LA L +++ ++ V            +
Sbjct: 372 LGI---FIVLQALIFI--PLSLTRNIAKLSVTALLADLFILLGLIYVYYYAIYYVAKNSI 426

Query: 237 IRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 293
               M+ +   DW         +FI T IF +   I   +           SMR+    K
Sbjct: 427 ATATMVWFNNSDW--------SLFIGTAIF-TFEGIGLLIPIQE-------SMRHPE--K 468

Query: 294 F-TKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNM 350
           F + L  +  ++SV  I CGL+ YS   AF    +  VL +FP       + +L +   +
Sbjct: 469 FQSSLFGVMCIVSVVFISCGLLCYS---AFGSNVQTVVLLNFPQDSPYTLLVQLFYSMAI 525

Query: 351 LTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNL 410
           L + P+++F    ++ +     +    Y+   +        I  +L  +   +  +  NL
Sbjct: 526 LLSTPLQLFPAIRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAWVGAS--NL 583

Query: 411 GALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCIC------FGFMIMIVS 464
                L+G+     + YI PP    LL  K         Y+  IC      FG  +M  +
Sbjct: 584 DKFVSLVGSLACIPLIYIHPP----LLHFKAFKDDQDTRYWSLICDILLLAFGVGVMTYT 639

Query: 465 STQTI 469
           S QT+
Sbjct: 640 SVQTL 644

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 94/439 (21%), Positives = 161/439 (36%), Gaps = 61/439 (13%)

Query: 57  QLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDW 116
           QLV      +  KSS   A + L  S +G G++  P A  N G     +  ++   +   
Sbjct: 304 QLVPREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSALCLLSCALVSYG 363

Query: 117 TLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVL 176
               ++      G   Y      + G K K  IL +  L                +    
Sbjct: 364 CFVSLISTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQVFF 423

Query: 177 RAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV- 235
              F    G ++         I   + I  PLSL RNI  LS  + +A L +++ ++ V 
Sbjct: 424 ENFFHLKPGSINL-----ATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGLVYVY 478

Query: 236 -----------VIRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSF 281
                      +    ML +   DW         +FI T IF +   I   +        
Sbjct: 479 VYSIYYISVNGIASDTMLMFNKADW--------SLFIGTAIF-TFEGIGLLIPIQE---- 525

Query: 282 IFFSMRNRSVAKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAI 339
              SMR+ +  +   L+ +  +++V  I CGL+ Y   AAF    K  VL +FP   +  
Sbjct: 526 ---SMRHPNHFR-PSLSAVMCIVAVVFISCGLLCY---AAFGADVKTVVLLNFPQNSSYT 578

Query: 340 NVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFI 399
              +L +   +L + P+++F              +++N+   +  S K +  +  +  + 
Sbjct: 579 LTVQLLYALAILLSTPLQLFP----------AIRILENWTFPSNASGKHNPKVKWLKNYF 628

Query: 400 TMGISLTTC--------NLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPY- 450
              I L T         +L     L+G+     + YI PP  +   +S     + +L   
Sbjct: 629 RCAIVLLTSILAWVGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLD 688

Query: 451 YFCICFGFMIMIVSSTQTI 469
              I FG  +M+ +S QTI
Sbjct: 689 LIVISFGVAVMVYTSWQTI 707

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 96/454 (21%), Positives = 174/454 (38%), Gaps = 53/454 (11%)

Query: 49  PIISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYI 108
           P++S  D      VL      +S R  F+ L  S +G G++  P A  N G+   +    
Sbjct: 281 PLLSRPDHM---KVLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLA 337

Query: 109 ALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXX 168
             G    W   ++V      G  ++      + G   +++ILF+  +             
Sbjct: 338 FFGLYSYWCYYILVQAKASCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFT 397

Query: 169 XDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA-VLS 227
              +   L  VF      + F     ++I    IFI  PLS  RNI  LS  S LA    
Sbjct: 398 AKNLQAFLDNVFHAGVLPLSF-----LMIFQTIIFI--PLSFIRNISKLSLPSLLANFFI 450

Query: 228 MIVIVLTVVIRGPMLPYDWR---------GHTLKLSDIFIKTTIFRSLSVISFALVCHHN 278
           M  +V+ ++     L +D +         G  +    +FI T IF +   I   +     
Sbjct: 451 MAGLVIVIIFTAKRLFFDLKASPAMGVVYGLNMDRWTLFIGTAIF-AFEGIGLIIPVQD- 508

Query: 279 TSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTA 338
                 SMRN    KF  +  + I+ + I    +   G+ A+    +  +L + P ++  
Sbjct: 509 ------SMRNPE--KFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIF 560

Query: 339 INVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNK----------- 387
           +N+ +L +   ++ + P+++F    ++ N        K Y +H  L+ +           
Sbjct: 561 VNLIQLFYSIAIMLSTPLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTRVELRPNSGKLD 619

Query: 388 ------QHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL----LL 437
                 ++ I + +++ +       + NL     +IG+     + YI P   +L    L 
Sbjct: 620 WRVKWLKNFIRSIIVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLP 679

Query: 438 TSKKKNWKAK-LPYYFCICFGFMIMIVSSTQTIL 470
            +K K W+ K +     I FG   M+ +S Q+I 
Sbjct: 680 ETKGKFWRFKPMLDIILIFFGIASMLYTSYQSIF 713

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 96/435 (22%), Positives = 165/435 (37%), Gaps = 53/435 (12%)

Query: 57  QLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDW 116
           QL++     +  KSS   A + L  S +G G++  P A  N G     I  ++   +   
Sbjct: 272 QLISREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSAICLLSCALVSYG 331

Query: 117 TLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVL 176
               ++      G   Y      + G K K  IL +  L                +    
Sbjct: 332 CFVSLITTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQVFC 391

Query: 177 RAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV------ 230
              F    G +        I   V IF+  PLSL RNI  LS  + +A L +++      
Sbjct: 392 ENFFHLKPGSISL---ATYIFAQVLIFV--PLSLTRNIAKLSGTALIADLFILLGLVYVY 446

Query: 231 ------IVLTVVIRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSF 281
                 I +  +    ML +   DW         +FI T IF +   I   +        
Sbjct: 447 VYSIYYIAVNGIASDTMLMFNKADW--------SLFIGTAIF-TFEGIGLLIPIQE---- 493

Query: 282 IFFSMRNRSVAKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAI 339
              SM++ +  +   L+ +  +++V  I CGL+ Y   AAF    K  VL +FP   +  
Sbjct: 494 ---SMKHPNHFR-PSLSAVMCIVAVVFISCGLLCY---AAFGSDVKTVVLLNFPQDTSYT 546

Query: 340 NVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQ-LSNKQH---TIITSM 395
              +L +   +L + P+++F    ++ N     +    ++   + L N       ++TS+
Sbjct: 547 LTVQLLYALAILLSTPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSV 606

Query: 396 LVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPY-YFCI 454
           L ++         +L     L+G+     + YI PP  +   +S     +A+L      I
Sbjct: 607 LAWVGAN------DLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARLLLDLIVI 660

Query: 455 CFGFMIMIVSSTQTI 469
            FG  +M+ +S QTI
Sbjct: 661 VFGVAVMVYTSWQTI 675

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 127/314 (40%), Gaps = 33/314 (10%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGG----LISYIALGFIVDWTLRLIVINL 125
           +++  + +NL  +I+GAG++  P+A ++ GI+ G    L++ I  GF       L   + 
Sbjct: 5   ATVSSSIINLVKTIVGAGLLAIPYAFRSDGILVGTLLTLLAAINSGF---GLFILAKCSK 61

Query: 126 TLAGKRTYQGTVEYVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAVFSQN 183
           TL   R         M     L  LF   +    F           D  P +        
Sbjct: 62  TLINPRN-SSFFSICMLTYPSLSPLFDLAMIIQCFGVGLSYLVLIGDIFPGLF------- 113

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASF-----LAVLSMIVIVL---TV 235
            G   +W       I+ + FI  PLS  + ++ L  +S      LA LSM + V+     
Sbjct: 114 GGHRDYW-------IISSAFIIVPLSCLKKLDSLKYSSIVGLFALAYLSMFIFVMFLHNT 166

Query: 236 VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
           V + P      RG       ++    +  + S+I FA     N   +   + + S+    
Sbjct: 167 VFKLPNEGDSTRGEVYWF-HVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNIK 225

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
            + + SI+IS     L+G SG+  F    +GN++ ++      I + + C G  ++ +FP
Sbjct: 226 NVINGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSFP 285

Query: 356 MEIFVLRDVVGNLL 369
           +    LR  V NL+
Sbjct: 286 LLFHPLRIAVNNLV 299

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 125/298 (41%), Gaps = 29/298 (9%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRG----P 240
           GEV  W  R  + I + + +  PL+L R I  LS  +  A   ++++   V + G     
Sbjct: 341 GEVFGWSHRLSVYIFLQLVVYLPLALTRRISRLSGTALAA--DVLILFGLVYVYGYSAVY 398

Query: 241 MLPYDWRGHTLKLSD-----IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
           +L Y     ++K+ +     +F+ T IF +   I   +    + S      R    A   
Sbjct: 399 VLRYGVASQSMKMFNRQDWTLFVGTAIF-TYEGIGLLVPIQESMS------RPGRFASCL 451

Query: 296 KLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFP 355
                ++    I CGL+ YS   AF  + +  +L +FP      +  +  +   ++ + P
Sbjct: 452 VWVIAAVTSIFISCGLLCYS---AFGSRVETVILLNFPKDSVLSSSVQFLYAMAIMLSTP 508

Query: 356 MEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTC-NLGALF 414
           +++F    ++ + +    +   +D   + +     +   ++VF+T+ I+     +L    
Sbjct: 509 LQLFPAIRILEHGIISSSVSGKHDPRVKWAKNWFRV---LVVFVTVSIAWVGADDLDKFV 565

Query: 415 ELIGATTASTMAYILPPYTNLLL---TSKKKNWKAKLPYYFCICFGFMIMIVSSTQTI 469
            LIG+     + YI PP  + +L   T +  N  A       + FG + M  +S+QT+
Sbjct: 566 SLIGSFACVPLIYIYPPLLHYMLFKGTGRVSN-AALFLDQLVVWFGVIGMFYTSSQTV 622

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 93/431 (21%), Positives = 174/431 (40%), Gaps = 60/431 (13%)

Query: 60  NNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLR 119
           NN  ++    S+ +  F+ L  S +G G +  P A    G++  +I  +  G    W   
Sbjct: 14  NNDTKQRTGTSNWKTYFL-LLKSFVGTGSLLLPSAFHKGGLVFSVILIVIFGLYSYWCYF 72

Query: 120 LIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAV 179
           +I+   T     T+Q     ++G+    +IL +  L              +    V   V
Sbjct: 73  IIIKLKTKVKANTFQEIGNNILGRWMSYVILGSLVLTQIGFSSAYIIFVGENFNQV---V 129

Query: 180 FSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVV 236
           ++  + E +      +  I+  +  +F +S    +E L+  + +A   ++  I++V++  
Sbjct: 130 YNMTNYECNI-----IYPILFQLGFNFAMSFISRMEVLTIPAVIANVLIICGIILVISYS 184

Query: 237 IRGPMLPYDWR---GHTLKLSD----IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNR 289
           +   +L  D +   G  L  +     +FI T I+ +   +   +  H+N S         
Sbjct: 185 LHHLILISDKKSDPGVMLFFNSNEWTLFIGTAIY-AFEGVGLLIPIHNNMS--------- 234

Query: 290 SVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSF-PGTDTAINVARLCFGF 348
           S   F K+  + ++   I   L+G  G+ ++ EK K  +L SF PG    +N+  +CF  
Sbjct: 235 SPKDFPKILLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQSFAPG--IFVNIIIVCFTI 292

Query: 349 NMLTTFPMEIFVLRDVVGNLLHECHLIKNYDE---------------HTQLSNKQH---- 389
            +L + P+++F L  ++ + L     I   DE                T+    +H    
Sbjct: 293 GILLSTPLQLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHINLR 352

Query: 390 --TIITSMLVFITMGI--SLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSK----K 441
              II   L+  T+ +   +T+  L  L  ++G+     + YI PP  NL   S     K
Sbjct: 353 VYKIILRFLIVTTVCLIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNLYECSLPGIIK 412

Query: 442 KNWKAKLPYYF 452
            NW   LP+ F
Sbjct: 413 NNWSI-LPFVF 422

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 92/485 (18%), Positives = 189/485 (38%), Gaps = 63/485 (12%)

Query: 27  SGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNN----VLRENDKKSSMRMAFMNLANS 82
           +G T ND     +  +F  +  P+++ +D + + +    + R +  K+S   AF+ +  S
Sbjct: 258 AGETFNDDFAVDEDDEFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLKS 317

Query: 83  ILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMG 142
            +G G++  P A  N G+I  ++     G    W   +++ +    G  ++      + G
Sbjct: 318 FIGTGVLFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGDIGIKLYG 377

Query: 143 KKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTI 202
              +  IL +                  T  ++L   F QN   +H     +++I+   I
Sbjct: 378 PWMRYAILAS---LILTQLGFSAAYVVFTCKNLL--AFFQNVFHLHSLRIEHLLILQTII 432

Query: 203 FISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLPYDWR-------GHTLK 252
           FI  PL+  RN+  LS  S LA    ++ ++I++  V++  ++  D +       G    
Sbjct: 433 FI--PLAFIRNVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDLDLKPEAGIIYGFNSS 490

Query: 253 LSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLM 312
              +FI T IF   +     L+     S        R   KF  +  + I+ + +    +
Sbjct: 491 KWSLFIGTAIF---AFEGIGLIIPVQDSM-------RKPEKFPLVLGLVILTATVLFISI 540

Query: 313 GYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHEC 372
              G+ AF    +  +L + P  +  +N+ +  +   +L + P+++F    ++     E 
Sbjct: 541 AALGYLAFGRYIETVILLNLPQDNIFVNLVQFFYSLAILLSTPLQLFPAIGII-----ES 595

Query: 373 HLIKNYDEHTQLSNKQHTIITS-------------------MLVFITMGISLTTCNLGAL 413
            L+  + +    +NK    ++                    +++F+       +  L   
Sbjct: 596 KLVPKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNFLRSIIVIFVICLAYFGSSKLDVF 655

Query: 414 FELIGATTASTMAYILPPYTNLLLTSK---KKNWKAKLPY-----YFCICFGFMIMIVSS 465
              IG      + Y+ PP  +L   S+   K+N   K        Y  + FG + M+ +S
Sbjct: 656 VSFIGCFACIPLVYMYPPLLHLKSCSQPAYKQNQTLKNRLMITMDYGLVIFGGVSMLYTS 715

Query: 466 TQTIL 470
            Q I+
Sbjct: 716 YQCIM 720

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 96/437 (21%), Positives = 160/437 (36%), Gaps = 64/437 (14%)

Query: 62  VLRENDK---KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL 118
           V RE D+   KSS   A + L  S +G G++  P A  N G     +S +    +     
Sbjct: 313 VSRERDRRPHKSSTAKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSGVSLLLCAIVSYGCF 372

Query: 119 RLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 178
             ++      G   Y      + G K KL IL +  L                +      
Sbjct: 373 VSLITTKDKVGVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQVFCEH 432

Query: 179 VFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA------------VL 226
            F    G ++         I   + I  PLSL RNI  LS  + +A              
Sbjct: 433 FFHLKPGSINL-----ATYIFAQVLIFVPLSLTRNIAKLSGTALIADVFILLGLVYVYYY 487

Query: 227 SMIVIVLTVVIRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIF 283
           S+  I +  +    ML +   DW         +FI T IF +   I   +          
Sbjct: 488 SIYHIAVNGIASDTMLMFNKADW--------SLFIGTAIF-TFEGIGLLIPIQE------ 532

Query: 284 FSMRNRSVAKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINV 341
            SM++ +  +   L+ +  +++V  I CGL+ Y   AAF    K  VL +FP   +    
Sbjct: 533 -SMKHPNHFQ-PSLSAVMCIVAVVFISCGLLCY---AAFGADVKTVVLLNFPQDSSYTLT 587

Query: 342 ARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITM 401
            +L +   +L + P+++F              +++N+   +  S K +  +  +  +   
Sbjct: 588 VQLLYALAILLSTPLQLF----------PAIRILENWTFPSNASGKHNPKVKWLKNYFRC 637

Query: 402 GISLTTC--------NLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFC 453
            I L T         +L     L+G+     + YI PP  +    S     +A+L     
Sbjct: 638 AIVLLTSVLAWVGANDLDKFVSLVGSFACIPLIYIYPPMLHYKAFSLSGISRARLLLDLV 697

Query: 454 I-CFGFMIMIVSSTQTI 469
           +  FG ++M  +S QTI
Sbjct: 698 VLSFGVVVMAYTSWQTI 714

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 86/430 (20%), Positives = 165/430 (38%), Gaps = 54/430 (12%)

Query: 75  AFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQ 134
           AF  L  S +G G++  P A  N G+   ++     G    W   +++    + G  ++ 
Sbjct: 304 AFFLLLKSFIGTGVLFLPNAFSNGGLSFSIVMLSFFGAYSYWCYFILIRAKKITGVTSFG 363

Query: 135 GTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRN 194
                + G   K +ILF+  L              + +    + VF  +D  + +++   
Sbjct: 364 DIGLRLFGPWMKFVILFSLVLTQIGFSGAYVIFTAENLKAFTKNVFLVSDVPISYFM--- 420

Query: 195 VIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLPYDWR---- 247
             II + +FI  PLS  RN+  LS  S LA   V++ + IVL    +  ++    R    
Sbjct: 421 --IIQLIVFI--PLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFSTKHLVIDLGMRAADG 476

Query: 248 ---GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVI 304
              G       +F+ T IF +   I   +           SMR+    KF  +  + I  
Sbjct: 477 VIVGFNQSRWSMFVGTAIF-AFEGIGLIIPVQD-------SMRHPE--KFPMVLALVIGS 526

Query: 305 SVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDV 364
           S +    +   G+ A+    +  +L + P  +  +N+ +  +   ++ + P+++F    +
Sbjct: 527 STVLFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLAIMLSTPLQLFPAIKI 586

Query: 365 VGNLLHECH---LIKNYDEHTQ----------------LSNKQHTIITSMLVFITMGISL 405
           + N +        +K  D+ T                 L N    II ++++ +      
Sbjct: 587 IENKVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSVRAIIVALVILMAY---Y 643

Query: 406 TTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYY-----FCICFGFMI 460
               L     +IG+     + Y+ PP  +L   S+ ++   K P+        I FG + 
Sbjct: 644 GADKLDKFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPWRSIVDCVLIVFGGVS 703

Query: 461 MIVSSTQTIL 470
           M  +S Q+I 
Sbjct: 704 MCYTSYQSIF 713

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 102/439 (23%), Positives = 167/439 (38%), Gaps = 61/439 (13%)

Query: 57  QLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDW 116
           QLV+     +  KSS   A + L  S +G G++  P A  N G     +  ++   I   
Sbjct: 284 QLVSREHGRHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSALCLLSCALISYG 343

Query: 117 TLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVL 176
               ++      G   Y      + G K K  IL +  L                +    
Sbjct: 344 CFVSLITTKDKVGVDGYGDMGRILYGPKMKFAILSSIALSQIGFSAAYTVFTATNL---- 399

Query: 177 RAVFSQNDGEVHFWLRRNVIIIMVTIF----ISFPLSLKRNIEGLSKASFLAVLSMIV-- 230
             VFS+N     F L+   I +   IF    I  PLSL RNI  LS  + +A L +++  
Sbjct: 400 -QVFSEN----FFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADLFILLGL 454

Query: 231 ----------IVLTVVIRGPMLPY---DWRGHTLKLSDIFIKTTIFRSLSVISFALVCHH 277
                     I +  V    ML +   DW         +FI T IF +   I   +    
Sbjct: 455 VYVYVYSIYYIAVNGVASDTMLMFNKADW--------SLFIGTAIF-TFEGIGLLIPIQE 505

Query: 278 NTSFIFFSMRNRSVAKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGT 335
                  SM++    +   L+ +  +++V  I CGL+ Y   AAF    K  VL +FP  
Sbjct: 506 -------SMKHPKHFR-PSLSAVMCIVAVIFISCGLLCY---AAFGSDVKTVVLLNFPQD 554

Query: 336 DTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQ-LSNKQH---TI 391
            +     +L +   +L + P+++F    ++ N     +    Y+   + L N       +
Sbjct: 555 TSYTLTVQLLYALAILLSTPLQLFPAIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVV 614

Query: 392 ITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPY- 450
           +TS+L ++         +L     L+G+     + YI PP  +   +      +A+L   
Sbjct: 615 LTSILAWVGAN------DLDKFVSLVGSFACIPLIYIYPPLLHYKASILSGTSRARLLLD 668

Query: 451 YFCICFGFMIMIVSSTQTI 469
              I FG  +M  +S QTI
Sbjct: 669 LIVIVFGVAVMAYTSWQTI 687

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 88/198 (44%), Gaps = 28/198 (14%)

Query: 185 GEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV-------VI 237
           GE ++W+  +  II+       PL L + ++ L  +S L + ++  I + V       + 
Sbjct: 115 GERNYWVIASTAIII-------PLCLVKKLDQLKYSSILGLFALAYISILVFSHFVFELA 167

Query: 238 RGPM---LPYD---WRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
           +G +   L  D   W+ H  K         +  + S+I FA     N   +   +++ S+
Sbjct: 168 KGELTEVLKNDVSWWKIHDFK--------GLLSTFSIIIFAYTGSMNLFPMINELKDNSM 219

Query: 292 AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNML 351
              T + + SI +S     ++G SG+  F   T GN++ ++      I + + C G  ++
Sbjct: 220 GNITLVINNSISLSTALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLI 279

Query: 352 TTFPMEIFVLRDVVGNLL 369
            +FP+    LR  V N++
Sbjct: 280 LSFPLLFQPLRVAVNNVI 297

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 99/475 (20%), Positives = 176/475 (37%), Gaps = 66/475 (13%)

Query: 40  GKDFPNTIY-----PIISDTDDQLVNNVLRENDKK---SSMRMAFMNLANSILGAGIITQ 91
           G+ F +  Y     P   D    L++   +        +S R  F  L  S +G G++  
Sbjct: 278 GESFEDDFYSVDGMPYALDESSHLLSQTTKAKGPPKGTTSTRKVFFLLLKSFIGTGVLFL 337

Query: 92  PFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILF 151
           P A  N G+   +      G        L++ +   A  R++ G    + G   K LILF
Sbjct: 338 PNAFNNGGLFFSIFMLAFFGLYSYLCYYLLISSKIAAQVRSFGGIGLKLYGPTMKYLILF 397

Query: 152 TNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLK 211
           +  +                +  +   VF   +  + F     ++I  + +FI  PLS  
Sbjct: 398 SLVITQLGFSSVYVIFTARNLKAIGEHVFKLPNVSITF-----LMISQLLLFI--PLSFV 450

Query: 212 RNIEGLSKASFLA-VLSMIVIVLTVVIRGPMLPYDWRGHTL---------KLSDIFIKTT 261
           R I  LS  S  A V  ++ +V+ V      L YD  G                +FI T 
Sbjct: 451 RKISKLSLPSLFANVFILVGLVIVVFFSMKHLFYDLSGSPADGVIFGINNSRWTLFIGTA 510

Query: 262 IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFK 321
           IF   S     LV     S        R   KF  +  + I+ + +   ++   G+ A+ 
Sbjct: 511 IF---SFEGIGLVIPVQDSM-------RKPEKFPLVLGLVIICTTVVFIIVATIGYLAYG 560

Query: 322 EKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYD-- 379
            +    +L + P  +  +++ +L +   ++ + P+++F    ++     E  L K YD  
Sbjct: 561 SEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPAIRII-----ESGLFKQYDRW 615

Query: 380 -----------EHTQLSNK--------QHTIITSMLVFITMGISLTTCNLGALFELIGAT 420
                      EH   S K        ++ + +S+++ +     +   NL     +IG+ 
Sbjct: 616 VNRSDREGHATEHNTSSGKSSWKVKWMKNAVRSSIVILVVAIACVGADNLDKFLSIIGSF 675

Query: 421 TASTMAYILPPYTNLLLTS-KKKNWKAKLPYYF----CICFGFMIMIVSSTQTIL 470
               + Y+ PP  +L  TS  + N K            I FG + M+ +S Q+I 
Sbjct: 676 ACIPLVYMYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIFGGISMVYTSYQSIF 730

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 95/447 (21%), Positives = 185/447 (41%), Gaps = 54/447 (12%)

Query: 59  VNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTL 118
           +  V  + ++K+S   +F+ L  S +G G++  P A  N G+   ++  +  G    W  
Sbjct: 261 IEQVSNDKEQKTSTLKSFLLLLKSFVGTGVLFLPSAFHNGGLFFSIVMIMFFGVYSFWCY 320

Query: 119 RLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 178
            L+V   T+ G  ++    + V G   K +IL +  L                    +  
Sbjct: 321 YLLVRVKTITGLTSFGNMGQRVFGPWMKFIILLSLILSQLGFGSTYVIFTAKNFKAFIEN 380

Query: 179 VFSQNDGEVHFWLRRNVIIIMVTIFISF-PLSLKRNIEGLSKASFLAVLSMIVIVLTVVI 237
           V +  D         N+I  ++  FI F PLS  R +  L+  S +A    I+I L++VI
Sbjct: 381 VTNIKD--------FNIIYPILLQFIIFVPLSYIRRVSKLTLPSLIAN-GFILIGLSLVI 431

Query: 238 RGPM--LPYDWRGH---------TLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSM 286
              +  L  D  G            K   +FI T IF +   I   +   +       SM
Sbjct: 432 YFSIDHLAGDLHGKPADGIISFFNTKHWTLFIGTAIF-AFEGIGLIIPLQN-------SM 483

Query: 287 RNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCF 346
           R+ S  KF  +  + ++ + +   ++   G+ ++   T+  +L +FP  +  +N+ +L +
Sbjct: 484 RDPS--KFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFY 541

Query: 347 GFNMLTTFPMEIFVLRDVVGNLLH-------ECH----LIKNYDEHT-----QLSNKQHT 390
              +L + P++IF   ++V + +        EC     +   Y+ ++     ++   ++ 
Sbjct: 542 ALAILLSTPLQIFPAIEIVEDKIFPKPGSDPECKDEIPITTIYNANSGGLDWRIKWFKNM 601

Query: 391 IITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPP------YTNLLLTSKKKNW 444
           I T ++  + +     + NL  L  +IG+     + Y+ PP      Y+  +   K+  W
Sbjct: 602 IRTMIVTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTW 661

Query: 445 KAKLPYYFCICFGFMIMIVSSTQTILD 471
                 Y  I FG + M+ ++ Q+I D
Sbjct: 662 SKSFD-YILIVFGGVSMVYTTYQSIKD 687

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 82/197 (41%), Gaps = 8/197 (4%)

Query: 198 IMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV---IRGPMLPYDW--RGHTLK 252
           I  +  +  PLS  R  + L  +S L ++++  + L +V   I G    Y    RG    
Sbjct: 121 IAASAAVVVPLSHLRRFDSLKYSSVLGLVAIAYLALMIVAAWIEGLTTGYAHYERGEVRW 180

Query: 253 LSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLM 312
           L    ++  +  + S+I FA     N   I   + + S+    ++ + SI  S     L+
Sbjct: 181 LRPASLREMV-STFSIIVFAFTGSMNMFSIINELGDNSMRNIQRIVYYSIAASTALFILV 239

Query: 313 GYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHEC 372
           G +G+  F      NV+ +F     +  V  L  G  +L +FP+     R    N++H  
Sbjct: 240 GMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSFPLLFHPGRIAFNNMVHWA 299

Query: 373 HLIKNYDEHTQLSNKQH 389
           H+   Y  +  L +++ 
Sbjct: 300 HV--TYCGYRPLKSEEQ 314

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 102/445 (22%), Positives = 166/445 (37%), Gaps = 69/445 (15%)

Query: 53  DTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGF 112
           D   Q      R+  K S+ + A + L  S +G G++  P A  N G        +A G 
Sbjct: 206 DGSRQRKRAAHRQAHKSSTFK-AVLLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLACG- 263

Query: 113 IVDWTLRLIVINLTLAGKRTYQGTV-EYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDT 171
           +V +   L++IN     K    G +   V G K +  IL +  L                
Sbjct: 264 VVSYYCFLLLINAKTKQKVNGYGDLGASVFGSKMEKAILGSIVLSQVGFVAAYSVFTATN 323

Query: 172 IPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVI 231
           +      VF +    + FWL       ++ + +  PLSL RNI  LS  + +A   ++  
Sbjct: 324 LQVFFANVF-KFKASMAFWL-------LIQLPVYLPLSLTRNIAKLSGTALIADAFILFG 375

Query: 232 VLTV------------VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNT 279
           +L V            V    ML ++    TL     FI T IF +   I   +      
Sbjct: 376 LLYVYYYCSHYVVDHGVASDSMLLFNKNDWTL-----FIGTAIF-TYEGIGLLIPIQE-- 427

Query: 280 SFIFFSMRNRSVAKFTKL---THISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTD 336
                SM++    KF+K       S+ ++ I CGL+ YS   AF +  K  +L +FP   
Sbjct: 428 -----SMKHPE--KFSKCLFGVMASVSVAFIVCGLLCYS---AFGDSVKIVILLNFPRDS 477

Query: 337 TAINVARLCFGFNMLTTFPMEIFVL----------RDVVGNLLHECHLIKNYDEHTQLSN 386
                 +L +   +L + P+++F +          +D  G        +KNY        
Sbjct: 478 AMTATVQLLYALAILLSTPLQLFPIIRILETSIFPKDASGKYNPRVKWMKNY-------- 529

Query: 387 KQHTIITSMLVFITMGISLTTCN-LGALFELIGATTASTMAYILPPYTNLLLTSKKKNWK 445
                    +V + M I+    N L     L+G+     + YI PP  +    ++    K
Sbjct: 530 -----FRVAIVLLNMLIAWLGANDLDKFVSLVGSFACIPLIYIYPPMLHYKTFAQGGASK 584

Query: 446 -AKLPYYFCICFGFMIMIVSSTQTI 469
            A L       FG  +MI ++ Q +
Sbjct: 585 LALLGDQLIAFFGVAVMIYTTYQAV 609

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/331 (21%), Positives = 133/331 (40%), Gaps = 65/331 (19%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAG 129
           +S+  + +NL  +I+GAG++  PFA +N GI+ G++                   LTL  
Sbjct: 6   ASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGIL-------------------LTLLA 46

Query: 130 KRTYQGTVEYVMGKKGKLLILFTNGLF----------------------AFXXXXXXXXX 167
             T  G   +V+ K  K LI   N  F                       F         
Sbjct: 47  AIT-SGFGLFVLAKCSKTLINPRNSSFFQLTMIAFPNLSPLSDISMIVQCFGVGLSYIVL 105

Query: 168 XXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIE--------GLSK 219
             D  P +       N G  +F++  + I+I+       PL L + ++        GL  
Sbjct: 106 IGDLFPTIF-----NNYGSRNFYILTSTIVIV-------PLCLLKRLDHLKYSSIVGLFA 153

Query: 220 ASFLAVLSMIVIVLTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNT 279
            S+L+ L + V +  +++   + P++ RG ++    I+    +  + ++I FA     N 
Sbjct: 154 LSYLSFLIVFVFIKDIILTNNLPPFE-RG-SINWVSIYDFNGLLSTFTIIIFAYTGSMNL 211

Query: 280 SFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTA- 338
             I   +    +     + + SI IS I   ++   G+  F   T GN++ ++  +++  
Sbjct: 212 FTIINELNYNDIDSIKIVINHSIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLY 271

Query: 339 INVARLCFGFNMLTTFPMEIFVLRDVVGNLL 369
           I + +L  G  ++ TFP+    LR    N++
Sbjct: 272 IILGKLALGIMVILTFPLLFHPLRIACNNII 302

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 98/483 (20%), Positives = 193/483 (39%), Gaps = 71/483 (14%)

Query: 30  TDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKK--SSMRMAFMNLANSILGAG 87
           TD +S++  Q  D      P+++  +      +L     K  +S   AF+ +  S +G G
Sbjct: 264 TDQESEE--QAVD---ETSPLLARAEAGTGKKILVPKSAKGTTSTTKAFLLMIKSFVGTG 318

Query: 88  IITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVM-GKKGK 146
           ++  P A  N G+   L   +  G    W    I+    +A K +  G +   + G   K
Sbjct: 319 VLFLPGAFSNGGLFFSLAMLVFFGIYSYWCY-YILTKSKIATKVSSFGDIGLTLYGPWMK 377

Query: 147 LLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISF 206
            +ILF+                  T  ++L   F +N   V +W    ++ ++    + F
Sbjct: 378 FIILFS---LVMTQLGFSGAYVVFTAKNLL--AFVEN---VFYWPGVTIVHLLALQLVVF 429

Query: 207 -PLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLPYDWR-------GHTLKLSD 255
            PLS  RNI  LS +S +A   V+  IVIV+    +      + +       G   +   
Sbjct: 430 IPLSFIRNIAKLSFSSLVANFLVMGGIVIVIGFTAKHLFFDLNCKPAEGIVTGFNSQSWT 489

Query: 256 IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYS 315
           +F+ T IF   +     L+    +S        +   KF  +  + I+ + +    +   
Sbjct: 490 LFVGTAIF---AFEGIGLIIPIQSSM-------KHPEKFPLVMALVIITATVLFVSVATL 539

Query: 316 GFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHE--CH 373
           G+ ++  +T+  +L + P     +N+ +  +   +L + P+++F    ++ N +      
Sbjct: 540 GYLSYGAETQTVILLNLPQDSILVNLIQFFYSSAILLSTPLQLFPAIAIIENKVFPKFTK 599

Query: 374 LIKNYDEHTQLSNKQHT-----------------IITSMLVFITMGISLTTCNLGALFEL 416
           +     +HT++  K ++                 I++S+++    G +    +L A   +
Sbjct: 600 IYVKRSDHTKIQYKPNSGKLDWRIKWLKNFVRSLIVSSVVIAAYFGAN----HLDAFVAI 655

Query: 417 IGATTASTMAYILPPYTNLLLTSK------KKNWKAKLPY---YFCICFGFMIMIVSSTQ 467
           +G+     + YI PP  +L   SK      K  W+ K P    Y  + FG + M+ +S Q
Sbjct: 656 VGSLACIPLVYIYPPMLHLRSCSKPRFAGEKSVWR-KWPILLDYVLVVFGAIGMVYTSYQ 714

Query: 468 TIL 470
           +I 
Sbjct: 715 SIF 717

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 94/425 (22%), Positives = 155/425 (36%), Gaps = 45/425 (10%)

Query: 64  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVI 123
            +N  KSS   A + L  S +G G++  P A  N G     +S      I       ++ 
Sbjct: 265 HKNKHKSSTFRAILLLLKSFVGTGVLFLPKAFHNGGYGFSSLSLFFCALISYGCFLTLIQ 324

Query: 124 NLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQN 183
                    Y    + + GKK K  IL++  L                +      VF  +
Sbjct: 325 TKDKVKVDGYGDMGQIIYGKKMKFAILWSIVLSQIGFSAAYTVFTATNLQVFCENVFFSS 384

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIV------------I 231
                       I++   +F+  PLSL RNI  LS  + +A L +++            I
Sbjct: 385 SSPSSSSSLAPYILLQQLVFV--PLSLTRNIAKLSGTALIADLFILLGLVYVYFYSTSYI 442

Query: 232 VLTVVIRGPML---PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRN 288
           +   +    ML     DW         +FI T IF +   I   +    + S        
Sbjct: 443 IKNGISSKTMLWLNKSDW--------SLFIGTAIF-TFEGIGLLIPIQESMS------HP 487

Query: 289 RSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGF 348
           +  +K   +    + +  I CGL+ YS   AF  K +  VL +FP       + +L +  
Sbjct: 488 QHFSKCLSMVMCIVTVIFISCGLLCYS---AFGSKVETVVLLNFPHDSPYTLMVQLLYAL 544

Query: 349 NMLTTFPMEIFVLRDVVGNLLHECHLI----KNYDEHTQLSNKQHTIITSMLVFITMGIS 404
            +L + P+++F    ++ N    C  I    KN  +   L N    II  +  FI     
Sbjct: 545 AILLSTPLQLFPAIKILENW---CFPISASGKNNPKVKWLKNYFRCIIVLLTAFIAY--- 598

Query: 405 LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVS 464
           +   +L     L+G+     + YI PP  +L     ++     +     + FG  +M  +
Sbjct: 599 VGANDLDKFVSLVGSFACIPLIYIYPPLLHLKAYWGEQTILRMVLDSLVLIFGVAVMGYT 658

Query: 465 STQTI 469
           S QTI
Sbjct: 659 SWQTI 663

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 142/335 (42%), Gaps = 41/335 (12%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVI---NLT 126
           S+   + +NL  +I+GAG++  P+A KN G++ GL  ++ L   V     L V+   + T
Sbjct: 5   STAHSSTINLVKTIVGAGLLAIPYAFKNDGVLVGL--FLTLLAAVTSGFGLFVLAKCSKT 62

Query: 127 LAGKRTYQG-TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDG 185
           L   R     T+  +       L  FT  +  F           D  P +         G
Sbjct: 63  LINPRNSSFFTLCMLTYPSLSPLFDFTMIIQCFGVGLSYLILIGDIFPGLF-------GG 115

Query: 186 EVHFWLRRNVIIIMVTIFISFPLSLK-RNIEGLSKASFLAVLSMIVIVLTVV-------I 237
             + W+  + ++I+   F+     LK  +I GL    +L +L + + + TV+       +
Sbjct: 116 SRNLWIYLSGLLIVPLCFLKKLDHLKYSSIMGLIALGYLTLLVLGMFLHTVIFTDNYMIV 175

Query: 238 RGPM---LPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 294
           RG +     YD++G             +  + S+I FA     N   I   ++N S+   
Sbjct: 176 RGQVNWFTVYDFKG-------------LLSTFSIIIFAYTGAMNLFSIINELKNNSMENV 222

Query: 295 TKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTF 354
           + + + SI IS I    +G +G+  F   T GN+L ++      +++A+ C    ++ +F
Sbjct: 223 SSIINHSISISTILFLTVGIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCLAIMLVLSF 282

Query: 355 PMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQH 389
           P+    LR  V NL+    +  NY    Q S  QH
Sbjct: 283 PLLFHPLRIAVNNLVVWLEI--NYGTPQQRS--QH 313

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 89/430 (20%), Positives = 170/430 (39%), Gaps = 59/430 (13%)

Query: 65  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVIN 124
           E  K ++++ A + L  S +G G++  P A  N G     +  +    +  +   L++I 
Sbjct: 242 ERHKTTTVK-AVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFCAILSYYCFVLLIIT 300

Query: 125 LTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQND 184
               G + Y      + G K KL IL +  L                +   +  VF+ ++
Sbjct: 301 KDKVGVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTATNLKLFMDNVFNLSE 360

Query: 185 GEVHF-WLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTV-------- 235
             +   W     I +   IFI  PLSL RNI  LS  + +A L +++ ++ V        
Sbjct: 361 DVLGLGWF----IWLQAAIFI--PLSLTRNIAKLSGTALVADLFILLGLIYVYYYATYYV 414

Query: 236 ----VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
               V    M+ ++    TL     FI T IF +   I   +           SM++  V
Sbjct: 415 ISNGVATSTMVWFNKSDWTL-----FIGTAIF-TFEGIGLLIPIQE-------SMKHPEV 461

Query: 292 AKFTKLTHISIVISV--ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFN 349
            +   L+ + ++++V  I CGL+ YS F +  +     VL +FP       + +L +   
Sbjct: 462 FR-KSLSGVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIVQLLYALA 517

Query: 350 MLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQHTIIT--------SMLVFITM 401
           +L + P+++F              +++ +  ++  S K +  +          +++F T+
Sbjct: 518 ILLSTPLQLF----------PAIRILEQWTFNSNASGKHNPRVKWLKNYFRCGVVIFTTV 567

Query: 402 GISLTTCNLGALFELIGATTASTMAYILPP--YTNLLLTSKKKNWKAKLPYYFCICFGFM 459
              +   +L     L+G+     + YI PP  +     +    +    +       FGF 
Sbjct: 568 LAWVGASDLDKFVSLVGSLACIPLIYIHPPLLHHRASRSDGTSSRGILILDLLICIFGFS 627

Query: 460 IMIVSSTQTI 469
           +M+ +S Q I
Sbjct: 628 VMVYTSWQAI 637

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 82/432 (18%), Positives = 172/432 (39%), Gaps = 58/432 (13%)

Query: 75  AFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQ 134
           AF  L  S +G GI+  P A  N G+I  +   +  G    W   +++ +  +    ++ 
Sbjct: 356 AFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFG 415

Query: 135 GTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRN 194
                + G+  K +ILF+  L                +   +  VF   D ++ +     
Sbjct: 416 DIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRVPDFDLKY----- 470

Query: 195 VIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIR------------G 239
             +++  +FI  PLS  RN+  LS  S +A   ++S + IV+   ++            G
Sbjct: 471 --LMIFQLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVIVFTMKHLFYDLNMRPEEG 528

Query: 240 PMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTH 299
            +  ++  G TL     FI T IF +   I   +           SM++     F  +  
Sbjct: 529 VIYGFNSNGWTL-----FIGTAIF-AFEGIGLIIPIQD-------SMKHPE--HFPLVLG 573

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
           + I+ + +    +   G+ A+ +  +  +L + P ++  +N+ +L +   ++ + P+++F
Sbjct: 574 LVIMTATVLFVTIATIGYLAYGKLIETVILLNLPKSNIFVNLIQLFYSMAIMLSTPLQLF 633

Query: 360 VLRDVVGNLL---------------HECHLIKNYDEHTQLSNKQHTIITSMLVFITMGIS 404
               ++ N +                   L +N  +       +   + S++V I + ++
Sbjct: 634 PAIKIIENKVFPKFTKYYVKIDQTREGVRLRQNSGKLDWRVKWRKNFLRSVIVLIVILMA 693

Query: 405 LTTC-NLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPY-----YFCICFGF 458
                +L     +IG+     + Y+ PP  +L   S   +   K+ Y     Y  I FG 
Sbjct: 694 YYGYDDLDRFVSIIGSFACIPLVYMYPPMLHLRSYSIPSSEGLKIKYRVILDYILIAFGG 753

Query: 459 MIMIVSSTQTIL 470
           + M+ +S Q+++
Sbjct: 754 VSMLYTSYQSLM 765

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 88/473 (18%), Positives = 184/473 (38%), Gaps = 54/473 (11%)

Query: 31  DNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKK--SSMRMAFMNLANSILGAGI 88
           ++ SD+G   +       P+++ T  +    +      K  +S   AF+ +  S +G G+
Sbjct: 268 ESTSDEGIDERS------PLLARTQAETGKRIYVPKSAKGTTSTMKAFLLMIKSFIGTGV 321

Query: 89  ITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLL 148
           +  P A  N G++  LI  I  G    W   ++  +       ++      + G   K +
Sbjct: 322 LFLPGAFSNGGLVFSLIMLIFFGTYSFWCYYILTQSKVATRVASFGDIGLTLYGPWMKFI 381

Query: 149 ILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVI-IIMVTIFISFP 207
           IL +  +                +   +  VF        +W    ++ ++ + + I  P
Sbjct: 382 ILLSLVMTQLGFSGAYVVFTAKNLLAFVNNVF--------YWPGVTIVHLLALQLVIFIP 433

Query: 208 LSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLPYDWRGHTLKLSDIFIKTTIFR 264
           LS  RNI  LS +S +A   V+  IVIV+    +      +++       DI +     R
Sbjct: 434 LSFIRNIAKLSLSSLVANFLVMGGIVIVIGFTAKHLFFDLNFK----PAEDIVMGFNSSR 489

Query: 265 SLSVISFALVCHHNTSFIF---FSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFK 321
               +  A+        I     SM++    KF  +  + I+ + +    +G  G+ ++ 
Sbjct: 490 WTLYVGTAIFAFEGIGLIIPIQGSMKHPE--KFPLVLALVIISATVLFVTVGTLGYLSYG 547

Query: 322 EKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHE--CHLIKNYD 379
            KT+  +L + P  +  +N+ +  +   +L + P+++F    ++ N +      +     
Sbjct: 548 AKTETVILLNLPQGNILVNLIQFFYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRS 607

Query: 380 EHTQLSNKQHT------------IITSMLV-FITMGISLTTCNLGALFELIGATTASTMA 426
           +HT++  K ++             + S++V  + +       +L     ++G+     + 
Sbjct: 608 DHTKVHYKPNSGKLDWRVKWLKNFVRSLIVSLVVIAAYFGADHLDTFVSIVGSFACIPLV 667

Query: 427 YILPPYTNLLLTSKK---------KNWKAKLPYYFCICFGFMIMIVSSTQTIL 470
           YI PP  +L   S+          K W   +  Y  I FG + M+ +S Q+I 
Sbjct: 668 YIYPPMLHLESCSRPACQNETSIWKKWPMAVD-YVLIIFGAIGMVYTSYQSIF 719

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 86/432 (19%), Positives = 173/432 (40%), Gaps = 48/432 (11%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLA 128
           K+    AF+ L  S +G GI+  P A    G++  +   +  G    W   +++ +  + 
Sbjct: 338 KTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFILIRSKQIT 397

Query: 129 GKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVH 188
              ++      + G+  K +IL +  L                +   +  VF+  D  + 
Sbjct: 398 KVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKNLRAFIINVFNFPDFNIS 457

Query: 189 FWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLPYD 245
           +     ++I  + +FI  PLS  RN+  LS  S +A   ++  ++IVL   I+   +   
Sbjct: 458 Y-----LMIFQLIVFI--PLSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLFIDLQ 510

Query: 246 WR-------GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLT 298
            +       G    L  +FI T IF +   I   +           SM++     F  + 
Sbjct: 511 MKPEAGVIYGFNPDLWSVFIGTAIF-AFEGIGLIIPVQD-------SMKHPE--HFPFVL 560

Query: 299 HISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEI 358
            + I+ + +   L+G  G+ A+ +  +  +L +   ++  +N+ +L +   +L + P+++
Sbjct: 561 FLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQL 620

Query: 359 FVLRDVVGNLLHECHLIKNYDEHTQLSNKQ-------------HTIITSMLVFITMGISL 405
           F    ++ N +       +      LSN                +II S ++ I     L
Sbjct: 621 FPAIKIIENRMFTSFRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAY---L 677

Query: 406 TTCNLGALFELIGATTASTMAYILPPYTNLLLTS----KKKNWKAKLPYYFC-ICFGFMI 460
              NL     LIG+     + Y+ PP  +L   S    K+  +   + + F  I  G + 
Sbjct: 678 GYNNLDKFVSLIGSFACIPLVYMYPPMLHLKSYSIPSLKQHKFNFTVIFDFSLIVLGGIS 737

Query: 461 MIVSSTQTILDA 472
           M+ +S ++I+D+
Sbjct: 738 MLYTSYRSIMDS 749

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 27  SGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKSSMRMAFMNL-ANSILG 85
           S + D+DS+  S+G D     Y I+  TD + V+N       KSS  +A  ++ AN  + 
Sbjct: 142 SVLLDHDSNMHSEGGDITRDFYNIVKKTDPESVHNSHVLQRTKSSPNIAPSSIAANEKIS 201

Query: 86  AGIITQPFAIKNAGIIGGLIS 106
           A  I  P   +   I+  L S
Sbjct: 202 ASGINIPGGFRREYIVNKLRS 222

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 89/441 (20%), Positives = 168/441 (38%), Gaps = 50/441 (11%)

Query: 62  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLI 121
           VL      +S R  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 289 VLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGVYSYWCYYIL 348

Query: 122 VINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFS 181
           V   +  G  ++      + G   +++ILF+  +                +   L  VF 
Sbjct: 349 VQAKSSCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVF- 407

Query: 182 QNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA-VLSMIVIVLTVVIRGP 240
                V       +++    +FI  PLS  RNI  LS  S LA    M  +V+ ++    
Sbjct: 408 ----HVGVLPLSYLMVFQTIVFI--PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAK 461

Query: 241 MLPYDWR---------GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
            L +D +         G       +FI T IF +   I   +           SMRN   
Sbjct: 462 RLFFDLKATPAAGVIYGLNTDRWTLFIGTAIF-AFEGIGLIIPVQD-------SMRNPE- 512

Query: 292 AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNML 351
            KF  +  + I+ + +    +   G+ A+    +  +L + P ++  +N+ +L +   ++
Sbjct: 513 -KFPLVLGLVILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIM 571

Query: 352 TTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNK-----------------QHTIITS 394
            + P+++F    ++ N        K Y +H  L+ +                 ++ I + 
Sbjct: 572 LSTPLQLFPAIKIIENKFFP-KFTKIYVKHNDLTTRVELRPNSGKLNWKIKWLKNFIRSI 630

Query: 395 MLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL----LLTSKKKNWKAK-LP 449
           +++ +       + NL     +IG+     + YI P   +L    L  +K + W+ K + 
Sbjct: 631 IVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPVL 690

Query: 450 YYFCICFGFMIMIVSSTQTIL 470
               I FG   M+ +S Q+I 
Sbjct: 691 DSILIFFGIASMLYTSYQSIF 711

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 87/441 (19%), Positives = 167/441 (37%), Gaps = 50/441 (11%)

Query: 62  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLI 121
           VL      +S R  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 292 VLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLTFFGIYSYWCYYIL 351

Query: 122 VINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFS 181
           V   +  G  ++      + G   K++ILF+  +                +   L  VF 
Sbjct: 352 VQAKSSCGVSSFGDIGLKLYGPWMKIIILFSLVITQVGFSGAYMIFTAKNLQAFLENVFH 411

Query: 182 QNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA-VLSMIVIVLTVVIRGP 240
                + + +    +I +       PLS  RNI  LS  S LA    M  +++ ++    
Sbjct: 412 VGALPLSYLMAFQTVIFI-------PLSFIRNISKLSLPSLLANFFIMAGLIIVIIFTAK 464

Query: 241 MLPYDWR---------GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
            L +D +         G       +FI T IF +   I   +           SM++   
Sbjct: 465 RLFFDLKAVPAMGVVYGLNSDRWTLFIGTAIF-AFEGIGLIIPVQD-------SMKHPE- 515

Query: 292 AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNML 351
            KF  +  + I+ + +    +   G+ A+    K  +L + P ++  +N+ +L +   ++
Sbjct: 516 -KFPLVLGLVILTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAIM 574

Query: 352 TTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNK-----------------QHTIITS 394
            + P+++F    ++ N        K Y +H  L+ +                 ++ I + 
Sbjct: 575 LSTPLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTRVELRPNSGKLDWKVKWLKNFIRSI 633

Query: 395 MLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL----LLTSKKKNWKAK-LP 449
           +++ +       + NL     +IG+     + YI P   +L    L  +K + WK K + 
Sbjct: 634 IVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWKFKPIL 693

Query: 450 YYFCICFGFMIMIVSSTQTIL 470
               I FG   M+ +S Q+I 
Sbjct: 694 DTILILFGITSMLYTSYQSIF 714

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 91/441 (20%), Positives = 169/441 (38%), Gaps = 50/441 (11%)

Query: 62  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLI 121
           VL      +S +  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 289 VLPSAKGTTSTKKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYIL 348

Query: 122 VINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFS 181
           V   +  G  ++      + G   +++ILF+  +                +   L  VF 
Sbjct: 349 VQAKSSCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVF- 407

Query: 182 QNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA-VLSMIVIVLTVVIRGP 240
                V       +++    IFI  PLS  RNI  LS  S LA    M  +V+ ++    
Sbjct: 408 ----HVGVLPLSYLMVFQTIIFI--PLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAK 461

Query: 241 MLPYDWRG-------HTLKLSD--IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
            L +D  G       + L      +FI T IF +   I   +           SMRN   
Sbjct: 462 RLFFDLMGTPAMGVVYGLNADRWTLFIGTAIF-AFEGIGLIIPVQD-------SMRNPE- 512

Query: 292 AKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNML 351
            KF  +  + I+ + I    +   G+ A+    +  +L + P ++  +N+ +L +   ++
Sbjct: 513 -KFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIM 571

Query: 352 TTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNK-----------------QHTIITS 394
            + P+++F    ++ N        K Y +H  L+ +                 ++ I + 
Sbjct: 572 LSTPLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTRVELRPNSGKLNWKIKWLKNFIRSI 630

Query: 395 MLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL----LLTSKKKNWKAK-LP 449
           +++ +       + NL     +IG+     + YI P   +L    L  +K + W+ K + 
Sbjct: 631 IVIIVVSIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGEFWRFKPML 690

Query: 450 YYFCICFGFMIMIVSSTQTIL 470
               I FG   M+ +S Q+I 
Sbjct: 691 DTILIFFGIASMLYTSYQSIF 711

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 124/303 (40%), Gaps = 25/303 (8%)

Query: 77  MNLANSILGAGIITQPFAIKNAGIIGGLI----SYIALGFIVDWTLRLIVINLTLAGKRT 132
           +NL  +I+GAG++  P+A +  G+   +I    + I  GF     L  +     L  +++
Sbjct: 12  VNLVKTIVGAGLLAIPYAFRADGVTVAIILLLFAAITSGF--GLYLLSLSSKALLNPRQS 69

Query: 133 YQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLR 192
              T+  V   K   L  F   +  +           D    +L        G  ++W+ 
Sbjct: 70  SFFTLCSVTYPKLSFLFDFAMFIQCYGVGLSYLVLVGDLFSSLL-------GGRRNWWIL 122

Query: 193 RNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV---IRGPMLPYDWRGH 249
            + II++       PL+  R ++ L  +S + +LS+  +VL V    ++G M    +  H
Sbjct: 123 GSTIIVV-------PLAHLRQLDSLKYSSLVGLLSITYLVLLVTGTFLQGVMFGNKYVEH 175

Query: 250 TLKLSDIFIKTT--IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVI 307
              +S + I +   +  + S+I  A     N   +   +++ S A   ++ + S+ IS +
Sbjct: 176 RGDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGISTL 235

Query: 308 CCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGN 367
               +G  G+  F      NV+ ++  +     +     G  ++ +FP+     R    N
Sbjct: 236 IFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPLLFHPGRIAFNN 295

Query: 368 LLH 370
           ++H
Sbjct: 296 MVH 298

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 100/445 (22%), Positives = 164/445 (36%), Gaps = 59/445 (13%)

Query: 51  ISDTDDQLVNNVLR-----ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLI 105
           I D +  LV    R         KSS   A + L  S +G G++  P A  N G      
Sbjct: 185 IEDEETALVGRRARHRISHRQPHKSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTT 244

Query: 106 SYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXX 165
             +A G I  +   L++          Y      V G+  +L IL +  L          
Sbjct: 245 CLLACGVISYYCFVLLINTKLKKNVNGYGDLGAAVYGRNMELAILGSIVLSQIGFVAAY- 303

Query: 166 XXXXDTIPHVLRAVFSQNDGEVHF-----WLRRNVIIIMVTIFISFPLSLKRNIEGLSKA 220
                       AVF+  + +V F     W    V  + V + +  PLSL RNI  LS  
Sbjct: 304 ------------AVFTATNLQVFFSSVFHWEASMVFWLAVQLLLYLPLSLTRNIAKLSGT 351

Query: 221 SFLAVLSMIVIVLTV------------VIRGPMLPYDWRGHTLKLSDIFIKTTIFRSLSV 268
           + LA L ++  +L V            V    ML ++    TL     FI T IF +   
Sbjct: 352 ALLADLFIMFGLLYVYYYCSRYVAHNGVASDSMLVFNKNDWTL-----FIGTAIF-TYEG 405

Query: 269 ISFALVCHHNTSFIFFSMRNRSVAKFTKL---THISIVISVICCGLMGYSGFAAFKEKTK 325
           I   +           SM++    KF K      +S+ I+ I CGL+ YS F +  E   
Sbjct: 406 IGLLIPIQE-------SMKHPE--KFNKCLLGVMVSVSIAFILCGLLCYSAFGSSVETV- 455

Query: 326 GNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLS 385
             +L +FP         +L +   ++ + P+++F +  ++   +   +    Y+   +  
Sbjct: 456 --ILLNFPRKSAMTASVQLLYALAIMLSTPLQLFPIIRILETSIFPKNASGKYNPRVKWM 513

Query: 386 NKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWK 445
                I   +++  T+   L   +L     ++G+     + YI PP  +    S     K
Sbjct: 514 KNYFRI--GIVLANTLIAWLGANDLDKFVSIVGSFACIPLIYIYPPMLHYKAFSNGGGSK 571

Query: 446 AKLPYYFCIC-FGFMIMIVSSTQTI 469
             L     I  FG  +M  ++ Q +
Sbjct: 572 LSLGCDVAIASFGVAVMTYTTYQAV 596

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 85/430 (19%), Positives = 164/430 (38%), Gaps = 58/430 (13%)

Query: 76  FMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQG 135
           F+ L  S +G G++  P A  N G+   +   +  G    W   ++     + G  ++  
Sbjct: 295 FLLLLKSFIGTGVLFLPGAFHNGGLTFSICMLLFFGIYSYWCYIILTKAKVVTGVSSFGD 354

Query: 136 TVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHFWLRRNV 195
               + G   K +ILF+  +                +   +       D ++ + +   +
Sbjct: 355 IGLKLYGPWMKAIILFSLVVTQIGFSAAYMIFTAKNLSPFVENFLRIPDLDLAYLMGLQL 414

Query: 196 IIIMVTIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVV-----IRGPMLPYDW- 246
           ++ +       PLS  R +  LS  S LA   ++  ++IVL  V     I   M P D  
Sbjct: 415 LVFI-------PLSFVRKVSKLSFPSLLANSFIMFGLLIVLFFVNKHLFIDLGMRPADGV 467

Query: 247 -RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVIS 305
             G   +   +F+ T IF S   I   +           SM+N    KF  +  + ++ +
Sbjct: 468 ILGVNYERWTLFVGTAIF-SFEGIGLIIPIQD-------SMKNPE--KFPLVLGLVLITA 517

Query: 306 VICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVV 365
            I    +   G+ ++       +L + P ++  +N+ +L +   ++ + P+++F    ++
Sbjct: 518 TILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQLFYSLAIMLSTPLQMFPAIKII 577

Query: 366 GNLLHECHLIKNYDEHTQ--------------------LSNKQHTIITSMLVFITMGISL 405
            + L     IK Y +                       L N   +II +++V I     L
Sbjct: 578 ESKLFP-KFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLKNFVRSIIVTLVVLIAY---L 633

Query: 406 TTCNLGALFELIGATTASTMAYILPPYTNL------LLTSKKKNWKAKLPYYFCICFGFM 459
              NL  +  +IG+     + YI PP  +L         ++K  W+  L  Y  + FG +
Sbjct: 634 EVENLDKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKVKWRV-LFDYLLVGFGTV 692

Query: 460 IMIVSSTQTI 469
            M  +S Q+I
Sbjct: 693 SMFYTSYQSI 702

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 128/323 (39%), Gaps = 37/323 (11%)

Query: 62  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLI 121
           +L     K+S + AF  L  S +G GI+  P A    G+I   +  I  GF   +   L+
Sbjct: 345 ILNRAKGKTSTKKAFFLLLKSFIGTGILFLPNAFSKGGLIFSNVLIIIFGFYSYYCYMLL 404

Query: 122 VINLTLAGKRTYQGTVEYVMGKK--GKLL---ILFTNGLFAFXXXXXXXXXXXDTIPHVL 176
           +       KR  Q +    MG K  G L+   ILF+  +                + +  
Sbjct: 405 I-----KCKRYSQVSSFGEMGNKLYGPLMQKIILFSIMISQIGFSCAYIIFTSTNLNYFF 459

Query: 177 RAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVV 236
           +        + +F+L     I  + +FI  PLS  RNI  LS  S +A L MI+I L +V
Sbjct: 460 QQYPLTEKLDFNFFL-----IFQLILFI--PLSFVRNISKLSVPSLVANL-MIIIGLMIV 511

Query: 237 IRGPMLPY--DWRGHTLKLSDIFIKT---TIFRSLSVISFALVCHHNTSFIFFSMRNRSV 291
           I   +  +  D   H     +IF      +IF   ++ +F  +               S+
Sbjct: 512 IYYCVKQFTVDMGFHMANGVEIFFNRQDWSIFVGTAIFAFEGIG-------LLIPIEESM 564

Query: 292 AKFTKLTHISIVISVICCG-----LMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCF 346
           AK  +     ++  VI C      L+G  G+  + E     +L + P     +   +L +
Sbjct: 565 AKPEEFGK--VLGGVIGCVTSLFILIGSMGYVTYGEDINTVILINLPNDKVTVQSIQLLY 622

Query: 347 GFNMLTTFPMEIFVLRDVVGNLL 369
              ++ + P++IF    ++ N +
Sbjct: 623 SIAIMLSIPLQIFPAIKIIENFI 645

>SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]
           {ON} similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 602

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 77/195 (39%), Gaps = 22/195 (11%)

Query: 53  DTDDQLVNNVLRENDK-------KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLI 105
           DT   +V  V  ++ K       +S+      N  N ++G G++  P  +K AG + G+ 
Sbjct: 185 DTHSIIVKQVETKDGKTVTVLAGQSTAPQTIFNSINVLIGIGLLALPLGMKYAGWVLGVP 244

Query: 106 SYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYV-MGKKGKLLILFTNGLFAFXXXXXX 164
             +   F    +  L+   L         G + Y   G KG+  I F   L         
Sbjct: 245 MLLTFAFATFCSAELLSRCLDTDPTLISYGDLGYAAFGPKGRAFISFLFALDLLGSGVAL 304

Query: 165 XXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA 224
                D+    L A+F Q    V F+      ++   IF+  PLS+      LS  S L 
Sbjct: 305 IILFGDS----LNALFPQY--SVTFFKIIGFFVVTPQIFM--PLSI------LSNVSLLG 350

Query: 225 VLSMIVIVLTVVIRG 239
           ++S I IVLTVV  G
Sbjct: 351 IISTISIVLTVVFCG 365

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 19/128 (14%)

Query: 2   SELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIIS--------- 52
           S+  E S   N +  T ++  NF +  I  NDS D S  K  PN+    ++         
Sbjct: 10  SKRNEDSTESNDDSTTSYD--NFEIIEIQHNDSKDNSIKKKIPNSELASLTHAYSRSRVE 67

Query: 53  ---DTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGI---ITQPFAIKNAGIIGGLIS 106
              D D +  +   ++  ++   R   M      +G G+   I  P A  +AG +G LI+
Sbjct: 68  PEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLA--DAGPVGALIA 125

Query: 107 YIALGFIV 114
           YI +G IV
Sbjct: 126 YIFMGSIV 133

>TDEL0E03740 Chr5 (707081..708922) [1842 bp, 613 aa] {ON} Anc_5.252
           YKL146W
          Length = 613

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 67/166 (40%), Gaps = 8/166 (4%)

Query: 307 ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVG 366
           I  GL+ YS   AF  K +  VL +FP        A+L +   +L + P+++F    ++ 
Sbjct: 450 ITSGLICYS---AFGSKVETVVLLNFPQDSPFTKSAQLLYVLAILLSTPLQLFPAIRILE 506

Query: 367 NLLHECHLIKNYDEHTQ-LSNKQHTIITSMLVFITMGISLTTCNLGALFELIGATTASTM 425
           N          ++ H + L N   + I      I  G      +L     L+G+     +
Sbjct: 507 NWTFPVDASGKHNPHIKWLKNYFRSAIVIATSLIAWG---GANDLDKFVSLVGSFACVPL 563

Query: 426 AYILPPYTNLLLTSKKKNWKAKLPYYFCIC-FGFMIMIVSSTQTIL 470
            YI PP  +      K   K  L     I   G +IM+ ++ Q+IL
Sbjct: 564 IYIYPPALHFKAFKDKNASKISLVTDVVIASVGVIIMLYNTYQSIL 609

>Skud_15.291 Chr15 complement(523091..525793) [2703 bp, 900 aa] {ON}
           YOR129C (REAL)
          Length = 900

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 14/102 (13%)

Query: 13  KELRTEFEL--TNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLRENDKKS 70
           K+ R  F L   + P S + D+   D     +  N  Y I+ D DD+L +  +++N K S
Sbjct: 111 KDPRFNFNLHHRDQPDSNVGDSIHFDAENNHNVQNNRYTIVLDDDDELESQEVQDNQKVS 170

Query: 71  SMR-MAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALG 111
               + F+N+AN+IL A               G +I  IA+G
Sbjct: 171 DDEPLFFINVANTILDA-----------TNDRGAVIKSIAIG 201

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 92/221 (41%), Gaps = 35/221 (15%)

Query: 285 SMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARL 344
           SMRN    KF  +  + +++      L+G  G+  F +     +L+SF   +  +++A+L
Sbjct: 343 SMRNPE--KFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQL 400

Query: 345 CFGFNMLTTFPMEIFVLRDVVGNLL--------------HECHLIKNYDEHTQLSNK--- 387
           C+   +L + P+++F +  +V   +               E     N +    L+ K   
Sbjct: 401 CYSIAILLSTPIQLFPVYKMVEEAIFKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIIL 460

Query: 388 -----------QHTIITSMLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLL 436
                      ++   T++++ +T+     + +L     ++G+     + YI PP+ +L 
Sbjct: 461 SGRDSNKIKWLKNLSRTTIVLLVTIISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHLK 520

Query: 437 LTSKKKNWKAKLPYYFCI-----CFGFMIMIVSSTQTILDA 472
             S   +   K  +   I      FG + ++ +S Q+I ++
Sbjct: 521 THSLPNSLNLKFKWRVIIDITLLIFGLLAVLYTSYQSIFNS 561

>ZYRO0A10538g Chr1 (852296..854122) [1827 bp, 608 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 608

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 93/427 (21%), Positives = 155/427 (36%), Gaps = 50/427 (11%)

Query: 64  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVI 123
           ++  +K++   A + L  S +G G++  P A  N G        +           L++ 
Sbjct: 208 KKQQRKATTFKAILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLFCAIASSLAFVLLIK 267

Query: 124 NLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQN 183
                G   Y    + + G K +  ILF+  L                +       F+  
Sbjct: 268 TKDKVGVSGYGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVFTATNLKVFFENAFNFP 327

Query: 184 DGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLP 243
              V        II+   IFI  PLSL RNI  LS  + +A L  I++ L  V   P L 
Sbjct: 328 ADSVPL---SAYIILQALIFI--PLSLTRNITKLSGTALIADL-FILLGLLYVYYYPALY 381

Query: 244 YDWRGHT------LKLSD--IFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT 295
               G           SD  +FI T IF +   I   +           SM+ +    + 
Sbjct: 382 IAKHGIATDSVLFFNRSDWSLFIGTAIF-TFEGIGLLIPIQE-------SMK-KPEHFYP 432

Query: 296 KLTHISIVISVI--CCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTT 353
            L  +  +++ I    GL+ Y  F A   K +  VL +FP    A    +L +   +L +
Sbjct: 433 SLGFVMSIVTFIFVSSGLLCYLAFGA---KVETVVLLNFPQDSIATISVQLIYSLAILLS 489

Query: 354 FPMEIF-VLR---------DVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGI 403
            P+++F  +R         +  G   H    +KNY              T +++F  +  
Sbjct: 490 TPLQLFPAIRIFETWTFPSNASGKHNHRVKWLKNY------------FRTGVVIFTALLA 537

Query: 404 SLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIV 463
            +   +L     L+G+     + YI PP  +L  +  + +    L       FG  +M  
Sbjct: 538 WVGANDLDKFVSLVGSFACIPLIYIYPPLLHLKSSDTQTSKFIILGDLLIFFFGVGVMAY 597

Query: 464 SSTQTIL 470
           +S Q I+
Sbjct: 598 TSYQNIV 604

>SAKL0G11462g Chr7 (980180..982030) [1851 bp, 616 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 616

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 68/174 (39%), Gaps = 10/174 (5%)

Query: 300 ISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIF 359
           + I +  I CG + YS F A     K  +L +FP         +  +   +L + P+++F
Sbjct: 446 LGITVIFISCGCLCYSAFGA---DVKTVILLNFPQDSIFTGGVQFSYALAILLSTPLQLF 502

Query: 360 VLRDVVGNLLHECHLIKNYDEHTQ-LSNKQHTIITSMLVFITMGISLTTCN-LGALFELI 417
               ++ N +   H    ++   + L N         +V  ++ I+    N L     L+
Sbjct: 503 PAIRILENAVFPSHASGKHNPKVKWLKN----YFRCFVVIASVAIAWVGANDLDKFVSLV 558

Query: 418 GATTASTMAYILPPYTNLLLTSKKKNWKAKLPY-YFCICFGFMIMIVSSTQTIL 470
           G+     + YI PP  +          +  L      + FG  IM+  S QT+L
Sbjct: 559 GSLACIPLIYIYPPMLHYKAFRGTNISRHDLVLDQVVLWFGIAIMVYISLQTVL 612

>KLTH0F02926g Chr6 complement(252354..253478) [1125 bp, 374 aa] {ON}
           some similarities with uniprot|P53850 Saccharomyces
           cerevisiae YNL254C Hypothetical ORF
          Length = 374

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 4/88 (4%)

Query: 9   KLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTI----YPIISDTDDQLVNNVLR 64
           +LE   LR +    +   +G  D DS++     D P  +      I  D D+Q +  + R
Sbjct: 74  ELEPGRLRVQETTPSLDSAGTDDQDSENAESDGDLPIEVICDLEVIPQDVDEQELQRLRR 133

Query: 65  ENDKKSSMRMAFMNLANSILGAGIITQP 92
           END+ SS   A   + +   G   ++ P
Sbjct: 134 ENDRSSSPAGANEGIDDEEAGEEKVSFP 161

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 62/155 (40%), Gaps = 7/155 (4%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAG 129
           +S R AF+ L  S +G G++  P A  N G+   +I    +G    W   ++V       
Sbjct: 299 TSTRKAFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGLYSYWCYYILVQTKVKVK 358

Query: 130 KRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHF 189
             ++      + GK  K +IL    +                +   L+ +F   D  + +
Sbjct: 359 ACSFGDIGSQLYGKWMKSVILVAIFVSQLGFSAAYMIFTAKNLGAFLQNIFHLKDFNLGY 418

Query: 190 WLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA 224
                ++II +  F+  PLS  RNI  LS  S +A
Sbjct: 419 -----IMIIQLIFFV--PLSFIRNISKLSLPSLIA 446

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 57/115 (49%), Gaps = 17/115 (14%)

Query: 6   EYSKLENKELRTE-FELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVNNVLR 64
           +   L+N ++++  +EL ++PL   T++     SQ           I   ++++ N  +R
Sbjct: 5   QEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQIT---------IESQEEEIANGQIR 55

Query: 65  ENDKKSSMRMAFMNLA--NSILGAGI---ITQPFAIKNAGIIGGLISYIALGFIV 114
           E + K  ++   + +      +G G+   ++ P  + NAG +G LI+Y+ +G +V
Sbjct: 56  EAEVKRELKQRHIGMIALGGTIGTGLFIGLSTP--LTNAGPVGALIAYLFMGTLV 108

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 71/173 (41%), Gaps = 15/173 (8%)

Query: 193 RNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLS-MIVIVLTVVIR-----GPMLPYDW 246
           R + I++V   ++ PLS    I GLS   +  +LS  +  VL V +      G + P+D 
Sbjct: 120 RWLCILLVAACLALPLSC---IHGLSVLGYSPILSSTLTAVLAVCMPLFYLFGGVSPFDA 176

Query: 247 RGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTK--LTHISIVI 304
              T   S+          L ++ F   CH N        R R +    +  LT+++   
Sbjct: 177 GTVTRATSN---GAPRLLGLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYA 233

Query: 305 SV-ICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPM 356
           +V + CG+ GY  F         NVL  +P       + R+    ++  +FP+
Sbjct: 234 AVCLICGITGYLTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPL 286

>CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some
           similarities with uniprot|P50944 Saccharomyces
           cerevisiae YNL101w or uniprot|P36062 Saccharomyces
           cerevisiae YKL146w
          Length = 605

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 23/152 (15%)

Query: 75  AFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWT---LRLIVINLTLA--- 128
           A++ L  S +G G++  P A KN G++  +I +I +G    W    L ++ ++  L+   
Sbjct: 156 AYILLLKSFVGTGVLLLPNAFKNGGMLFSIILFIFIGIYSFWCYYILSVVKVSTKLSCFG 215

Query: 129 --GKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGE 186
             GKR Y        G   K++ILF+  L              + +   L A+F   D +
Sbjct: 216 EIGKRIY--------GTPMKVVILFSLILTQLGFASTGIIFVANNMKPSLEALFHWKDIK 267

Query: 187 VHFWLRRNVIIIMVTIFISFPLSLKRNIEGLS 218
            +F+L      I   + +  PL L  +I+  S
Sbjct: 268 -YFYL------IFCQLILYIPLGLITDIKKFS 292

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 64/334 (19%), Positives = 125/334 (37%), Gaps = 40/334 (11%)

Query: 49  PIISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYI 108
           P++S   ++L    +R    K+S   AF+ L  S +G G++  P A  N G+   +I   
Sbjct: 280 PLLSGDTERLHPITVR---VKTSTFKAFLLLIKSFVGTGVLFLPNAFSNGGLAFSIIMLF 336

Query: 109 ALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXX 168
                  W   ++V      G  ++      + G   K +ILF+                
Sbjct: 337 IFSGYSYWCYYILVRTKVSTGVSSFGDIGAMLYGPWMKYIILFSLVFAQLGFSSAYVVFT 396

Query: 169 XDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNI----EGLSKASFLA 224
              +   ++ VF   D  + + L   +II +       PLS  RN+         A+FL 
Sbjct: 397 SKNLIAFIQNVFHYPDIPMAYMLLLQLIIFI-------PLSFVRNVSKLSLSSLLANFLI 449

Query: 225 VLSMIVIVLTVVI-----------RGPMLPYDWRGHTLKLSDIFIKTTIFRSLSVISFAL 273
           +  + ++VL                G +  ++ +  TL     F+ T IF    +    L
Sbjct: 450 ICGLFIVVLYSAKHLIVDLSFKPEEGVIFLFNSKKWTL-----FVGTAIFAYEGI---GL 501

Query: 274 VCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFP 333
           +     S            KF  +    I+ +     L+G  G+ A+ +  +  +L + P
Sbjct: 502 IIPVQDSM-------AHPEKFPMVLGWVIITTTALFVLVGSLGYLAYGKYIQSVILLNLP 554

Query: 334 GTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGN 367
               ++N+ +  +   +L + P+++F    ++ N
Sbjct: 555 QKSLSVNLIQFFYSMAILLSTPLQLFPAIAIIEN 588

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 89/441 (20%), Positives = 158/441 (35%), Gaps = 65/441 (14%)

Query: 70  SSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAG 129
           +S    F+ L  S +G GI+  P A  N G++  +I     G    W   ++       G
Sbjct: 293 TSTAKTFLLLLKSFMGTGILFLPAAFHNGGLLFSIIMLFFFGIYSYWCYYILTKAKVATG 352

Query: 130 KRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQNDGEVHF 189
           + ++      + G   K +ILF+  L                +       F QN     F
Sbjct: 353 QSSFGDIGLKLYGPSMKFIILFSLVLTQLGFSAAYMIFTAKNL-----NAFCQN-----F 402

Query: 190 WLRRNVIIIMV---TIFISFPLSLKRNIEGLSKASFLA---VLSMIVIVLTVVIRGPMLP 243
           +L  ++  I +    +F S    L R +  LS  S +A   V++ + IVL  ++R   L 
Sbjct: 403 FLLEDINFIYLMGFQLFFSSHYHLSRKVSKLSLPSLIANVFVMTGLAIVLFFLVRHLFLE 462

Query: 244 YDWR-------GHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTK 296
                      G       +FI T IF +   I   +           SM+N    KF  
Sbjct: 463 LHLHPAAGVIPGLNSDRWTMFIGTAIF-AFEGIGLIIPIQD-------SMKNPE--KFPL 512

Query: 297 LTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPM 356
           +    ++ +      +   G+ ++   T+  +L + P     +   +L +   ++ + P+
Sbjct: 513 VLGFVLIAATFLFITIASIGYLSYGSSTEVVILLNLPQDSIFVISIQLFYSLAIMLSTPL 572

Query: 357 EIFVLRDVVGNLLHECHLIKNYDEH--------------------TQLSNKQHTIITSML 396
           ++F    ++ N +      K Y E                       L N   +II S  
Sbjct: 573 QMFPAIKIIENKVFP-RFTKIYVEGDGDRCDVEFRLNSGKANWKVKWLKNFVRSIIVS-- 629

Query: 397 VFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL-------LLTSKKKNWKAKLP 449
            F+ +       NL  +  LIG+     + YI PP  +L         +     WK  L 
Sbjct: 630 -FVIIFAYYEVDNLDKVVSLIGSFACIPLVYIYPPLLHLRSRSRSQSPSGDPSKWKLVLD 688

Query: 450 YYFCICFGFMIMIVSSTQTIL 470
            +  + FG + MI +S Q++ 
Sbjct: 689 -HILVVFGGISMIYTSYQSMF 708

>NDAI0I02030 Chr9 (472696..474546) [1851 bp, 616 aa] {ON} Anc_5.220
           YJR001W
          Length = 616

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

Query: 50  IISDTDDQLVNNVLRENDK-------KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIG 102
           II+DTD   +  V  ++ K       +S+      N  N ++G G++  P  +K AG + 
Sbjct: 195 IINDTDSITLKRVEGKDGKIVTLIAGQSTGPQTIFNSINVLIGIGLLALPLGLKYAGWVI 254

Query: 103 GLISYIALGFIVDWTLRLIVINL-TLAGKRTYQGTVEYVMGKKGKLLI--LFTNGLFA 157
           GLI  +   F    T  L+   L T     +Y        G KG+ LI  LFT  L  
Sbjct: 255 GLILLMTFAFGTFCTAELLSRCLDTDPTLMSYADLGYAAFGTKGRALISCLFTTDLLG 312

>KNAG0I01970 Chr9 complement(379931..382141) [2211 bp, 736 aa] {ON}
           Anc_2.177 YNL101W
          Length = 736

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 85/463 (18%), Positives = 171/463 (36%), Gaps = 64/463 (13%)

Query: 45  NTIYPIISDTDDQLVNNVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGL 104
           N + P+ S      V  ++ E    +S    F+ L  S +G G++  P    N G++  +
Sbjct: 299 NPLLPVAS------VKALVSEVRGTASTGKVFLLLLKSFIGTGVLFLPSGFANGGLLFSI 352

Query: 105 ISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFXXXXXX 164
              +  G    W   +++ +      +++      + G   K +ILF             
Sbjct: 353 AMLVFFGVYSYWCYYILIESKIATKVKSFGDIGLKLYGPWLKFVILFAIVSTQVGFSGAY 412

Query: 165 XXXXXDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLA 224
                  +   +  VF  +D  +        +I++  + +  PLS  RNI  LS  S +A
Sbjct: 413 MIFTAKNLSAFVENVFHVSDINLP-------MIMLFQLVVYVPLSFVRNISKLSLPSLVA 465

Query: 225 ---VLSMIVIVLTVVIRGPMLPYDWR-------GHTLKLSDIFIKTTIFRSLS---VISF 271
              +++ +VIVL    +   +    +       G   +   +FI T IF       +I  
Sbjct: 466 NFFIMAGLVIVLFFTAKQLFIDSGMKVAEGIIFGVNHERWSLFIGTAIFAFEGIGLIIPV 525

Query: 272 ALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKEKTKGNVLNS 331
                H   F         V K   LT   + ISV   G + Y          +  +L +
Sbjct: 526 QDTMRHPEKFPL-------VLKLVILTATCLFISVATIGYLAYG------SSVQTVILLN 572

Query: 332 FPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLHECHLIKNYDEHTQLSNKQ--- 388
            P  +  + + +L +   ++ + P++++    ++ N +     IK Y+  +Q    +   
Sbjct: 573 LPQGNVFVLLIQLFYSMAIMLSTPLQLYPAIKIIENKVFP-QFIKIYERDSQAQTTRVRY 631

Query: 389 --------------HTIITSMLVFITMGISLTTCN-LGALFELIGATTASTMAYILPPYT 433
                           ++ S +VF+ +  +    + L  +  +IG+     + Y++PP  
Sbjct: 632 RPNSGKLSWRVKWLKNLVRSAIVFLVVLFAYCGIDYLDKVVAVIGSLCCLPLVYVIPPML 691

Query: 434 NLLLTSK---KKNWKAKLPYYF---CICFGFMIMIVSSTQTIL 470
           +L   ++   K      L   F    I FG +  + +S Q+I+
Sbjct: 692 HLKCCTRGSTKPQGSMMLLATFDKLLIVFGTLATVYTSYQSIV 734

>CAGL0D03036g Chr4 complement(314724..316592) [1869 bp, 622 aa] {ON}
           similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001w
          Length = 622

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 104/268 (38%), Gaps = 28/268 (10%)

Query: 69  KSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLI--SYIALGFIVDWTL--RLIVIN 124
           +S+      N  N ++G G++  P  +K AG I GLI  S  A G      L  R +  +
Sbjct: 225 QSTAPQTIFNSINVLIGIGLLALPLGMKYAGWIPGLIMLSIFAFGTFCTAELLSRCLDTD 284

Query: 125 LTLAGKRTYQGTVEYVMGKKGKLLI--LFTNGLFAFXXXXXXXXXXXDTIPHVLRAVFSQ 182
            TL    +Y        G +G+  I  LFT  L +                  L A+F Q
Sbjct: 285 PTLI---SYADLGYAAFGSRGRAFISALFTVDLLSCGVSLVILFG------DSLNALFPQ 335

Query: 183 NDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPML 242
               V F+  + V   +VT  +  PLS+  NI      S L +LS    VL + I G + 
Sbjct: 336 Y--SVTFF--KIVCFFVVTPPVFIPLSILSNI------SLLGILSTTGTVLVIFICG-LF 384

Query: 243 PYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRN--RSVAKFTKLTHI 300
             D  G  ++     +  T F+SL +    L        +F ++++  R   KF K    
Sbjct: 385 KRDAPGSLIEPMPTHLWPTDFKSLCLSIGLLSASWGGHAVFPNLKSDMRHPQKFKKCLKT 444

Query: 301 SIVISVICCGLMGYSGFAAFKEKTKGNV 328
           +  I+ +        GF  F +  K  +
Sbjct: 445 TYQITSVTDIGTAVIGFLMFGDLVKDEI 472

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,897,866
Number of extensions: 1931173
Number of successful extensions: 7615
Number of sequences better than 10.0: 128
Number of HSP's gapped: 7633
Number of HSP's successfully gapped: 163
Length of query: 483
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 370
Effective length of database: 40,524,141
Effective search space: 14993932170
Effective search space used: 14993932170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)