Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.2na 1ON62762730490.0
Skud_5.24na 1ON62762727910.0
Smik_5.22na 1ON62862727730.0
YEL065W (SIT1)na 1ON62862827060.0
NDAI0I02650na 1ON63858421410.0
NCAS0D02350na 1ON63455421200.0
TPHA0M00120singletonON61956020910.0
Kpol_358.4na 1ON61755920790.0
SAKL0C12122gna 2ON61157720510.0
Kwal_23.5241na 2ON59156119540.0
TDEL0G04740singletonON60155619510.0
KLTH0A01562gna 2ON61557018780.0
Kwal_23.4853na 3ON60355317860.0
KLTH0G09504gna 3ON62458117740.0
Kpol_416.6singletonON59755416580.0
Kpol_416.5singletonON60755315470.0
NCAS0A11500singletonON61456515400.0
TPHA0G03780singletonON61256214780.0
Kpol_513.33singletonON62656814640.0
TDEL0B00140singletonON63256614520.0
NDAI0A02050singletonON61756214340.0
TPHA0B00180singletonON63356813960.0
KAFR0D00930singletonON61456213820.0
SAKL0G06600gsingletonON62955613620.0
Suva_8.12na 4ON63358613561e-180
KAFR0C02660singletonON59155113381e-178
CAGL0E04092gna 4ON64555813381e-177
KNAG0J02980singletonON63657713351e-177
Skud_8.3na 4ON63158513301e-176
Smik_8.1na 4ON62758513151e-174
YHL040C (ARN1)na 4ON62758513081e-173
NDAI0H00140na 4ON63258312871e-170
KAFR0I01560singletonON63255812851e-170
TBLA0C01040singletonON66955812741e-167
KLTH0D00506gsingletonON61658112291e-161
TPHA0K02330singletonON63157412221e-160
SAKL0G03300gsingletonON61656012201e-160
KLLA0C19272gsingletonON62355912201e-160
ZYRO0G07414gsingletonON70753812191e-159
KLLA0A10439gsingletonON63455911961e-156
Kwal_56.22298singletonON61057811701e-153
KLTH0D18150gsingletonON60757511651e-152
TDEL0H00130singletonON62155711491e-149
SAKL0F00792gsingletonON61754911451e-149
Kwal_23.2794singletonON61957611301e-146
KLLA0C00220gsingletonON62457810971e-141
SAKL0F00110gsingletonON62055510961e-141
Kwal_34.15711na 4ON61857610931e-141
KLTH0A07964gsingletonON61955210911e-141
YHL047C (ARN2)singletonON62055510911e-140
KLTH0D00110gsingletonON62055510901e-140
KLTH0B10450gsingletonON62055510901e-140
SAKL0E00132gsingletonON62057610891e-140
TBLA0F00470singletonON73256310401e-132
Skud_18.6singletonON61057510211e-130
NCAS0I00110na 4ON4524139901e-128
KLLA0E14609gsingletonON6395759711e-122
Kwal_14.722singletonON6115449611e-121
YKR106W (GEX2)singletonON6155799511e-120
YCL073C (GEX1)singletonON6155799481e-119
KLTH0B00110gsingletonON6275529431e-118
KLLA0D19945gsingletonON6445788941e-111
KLTH0G00198gna 4ON4584397784e-96
Smik_11.370singletonON4404317261e-88
YOL158C (ENB1)singletonON6065536649e-78
Smik_21.4singletonON6055175818e-66
TDEL0H01600singletonON6045225493e-61
Suva_26.1singletonON5344835443e-61
Suva_10.9singletonON6375764706e-50
Skud_6.14singletonON6365694671e-49
Smik_6.22singletonON6365724634e-49
TDEL0A03210singletonON5845003442e-33
NCAS0I00100singletonON1631472716e-27
Smik_11.369singletonON1681252551e-24
Smik_17.11singletonON5443431742e-12
YPR198W (SGE1)singletonON5433561545e-10
Skud_16.503singletonON5433731546e-10
KLTH0C10120gsingletonON6513741412e-08
Skud_7.560na 5ON6423811413e-08
NCAS0C03460na 5ON6303831385e-08
Smik_16.81na 5ON6253851378e-08
KLTH0B00132gsingletonON5683651261e-06
KLTH0C10142gsingletonON5733781261e-06
Kwal_56.237548.272ON5892011242e-06
SAKL0A00726gsingletonON5982481233e-06
KNAG0K01020singletonON5993771181e-05
SAKL0A08228gsingletonON5693821153e-05
Kwal_26.9616singletonON5623761144e-05
ZYRO0C01430g8.272ON5902931135e-05
KLTH0D16962gsingletonON5712111136e-05
SAKL0F00198gsingletonON5373631126e-05
Kpol_543.448.272ON6432871082e-04
TDEL0F039908.272ON6312181073e-04
SAKL0B12716gsingletonON6323521073e-04
KLTH0G13464g8.272ON5933601046e-04
Skud_14.406na 6ON5642221010.001
YNR072W (HXT17)singletonON5641831010.002
YEL069C (HXT13)na 7ON5641831000.002
TBLA0D032708.843ON55074990.002
KLLA0A04631g8.272ON579120990.002
TBLA0D03280singletonON58074980.003
YGR224W (AZR1)na 5ON613333970.004
YDL245C (HXT15)singletonON567183970.004
YJR158W (HXT16)singletonON567183970.004
Smik_14.401na 6ON636183960.006
Suva_15.2915.396ON592139960.006
TDEL0G03260singletonON612400950.007
Smik_5.19na 7ON567183950.007
Smik_13.2722.473ON561125950.008
TBLA0F030408.272ON906224950.008
Skud_4.5singletonON573219940.009
Kpol_541.168.843ON52872940.010
Skud_13.2442.473ON562125930.013
NCAS0B002908.843ON542143930.014
KLTH0B10142gsingletonON568361930.014
AGR076C8.272ON686130920.016
TPHA0A017508.272ON636296920.016
Ecym_42988.272ON678108920.017
TBLA0A03450singletonON573165910.022
Smik_25.4singletonON315172900.023
Smik_6.20singletonON569172910.023
KLLA0E09879gsingletonON630211910.025
KAFR0F02800singletonON551189900.026
KAFR0F04080singletonON549189900.029
Skud_18.3singletonON590375900.029
SAKL0H16808g8.272ON657208900.029
KAFR0E02030singletonON548189900.030
Smik_10.8singletonON569172890.037
NDAI0E002108.858ON613147880.048
Ecym_13888.858ON572171880.050
TBLA0B029408.858ON661170880.051
AFL207C5.394ON539184880.056
Skud_6.12singletonON470214870.067
YMR088C (VBA1)2.473ON562125870.070
TBLA0E01970singletonON578163870.071
CAGL0J01375g2.473ON564329860.080
TBLA0B00840singletonON637147860.093
TBLA0A03460singletonON568229860.094
Suva_13.2652.473ON561137860.097
Skud_7.620singletonON468171850.11
ZYRO0G21868gna 8ON620108850.11
SAKL0C05588gsingletonON677364850.13
TBLA0A03480singletonON574121840.14
Skud_8.1575.395ON592139840.14
SAKL0D00814g8.858ON570192840.14
Kwal_14.1585na 8ON570121830.18
Kwal_27.102458.843ON51573830.19
YJL214W (HXT8)singletonON569132830.21
TBLA0D05800singletonON574214830.23
NDAI0D05020singletonON573121820.24
Suva_13.208.858ON58497820.26
Ecym_5319singletonON530223820.27
Ecym_73992.473ON563236820.29
Skud_13.188.858ON58597820.29
Skud_18.5singletonOFF5351720.31
Suva_13.278.843ON55380810.31
KLTH0E02750g5.395ON567125810.35
NDAI0G015203.23ON53089810.36
KNAG0J002608.843ON550134810.37
CAGL0B02079gna 5ON624386810.39
TBLA0A03470singletonON578126810.40
TBLA0A063704.260ON24246780.49
ABL040W2.473ON567104800.52
NDAI0D05010singletonON574121790.56
ZYRO0G21890gsingletonON576109790.60
TPHA0L015708.521ON45564790.63
KAFR0G00160singletonON636213790.65
NCAS0A078102.473ON568234790.69
SAKL0C00154gsingletonON571132790.69
TBLA0A033905.394ON57438780.72
Kwal_26.6669singletonON590156780.74
AFL205C5.395ON54675780.78
Suva_13.4678.843ON543135780.87
TBLA0A03430singletonON56491780.87
NDAI0F01940singletonON55191780.87
KLLA0E09021gna 9ON56677780.89
NCAS0C002708.858ON570145770.94
CAGL0B02475g8.858ON580100770.96
KAFR0B039408.843ON54774771.0
Kwal_26.6686singletonON56968771.1
TPHA0G031502.473ON600234771.1
Kwal_55.19582singletonON56768771.1
KLTH0H05456gna 8ON568142771.1
TDEL0E02290singletonON571175771.2
Smik_13.118.858ON58697761.3
KLLA0D19941gsingletonON611371761.3
KAFR0D00750singletonON557104761.4
NCAS0F031005.395ON570104761.4
TDEL0H04480na 9ON57031761.4
TBLA0A03500singletonON573126761.5
TPHA0I003808.858ON578102761.5
CAGL0A01826g5.396ON58875761.5
KLTH0D05434g2.473ON576231761.5
NCAS0B002208.858ON62597751.8
ZYRO0B00990g4.30ON592113751.9
TBLA0B10150singletonON571212751.9
CAGL0D02640gsingletonON56497752.0
CAGL0D02662gsingletonON56497752.0
TBLA0A01240singletonON56989752.0
YML123C (PHO84)8.858ON58795742.1
ZYRO0C00374gna 9ON56460742.2
Kwal_56.22285singletonON56767742.2
TBLA0A01250singletonON50366742.2
Suva_4.2singletonON57044742.3
Suva_15.419singletonON588222742.3
KAFR0G037303.500ON14429702.5
KLLA0E20945g3.23ON528223742.5
AFR343C3.84ON571107742.5
KNAG0C051905.395ON564128742.7
TBLA0F01600singletonON567218742.7
NDAI0C017405.396ON60788732.8
Kwal_56.227243.84ON57865733.2
NDAI0K004008.843ON55364723.6
Skud_13.4518.843ON53963723.8
Suva_12.263singletonON487200724.0
TDEL0E00200singletonON568106724.1
Kwal_55.200645.396ON23892714.3
ZYRO0G00286gsingletonON589162724.4
NDAI0K002808.858ON57197724.5
NDAI0D048404.30ON639117724.6
TBLA0A03400singletonON57468724.6
KNAG0M02690singletonON55970715.0
NCAS0C057804.30ON567133715.5
KLLA0F17776gna 10ON553186716.0
KAFR0D00740singletonON56875716.1
NCAS0I03160singletonON575119716.2
NCAS0A02540singletonON53970706.2
TBLA0A03700singletonON57234706.3
Smik_13.4928.843ON543134706.4
KAFR0A029108.858ON58698707.0
YDR497C (ITR1)3.84ON584141708.3
KNAG0C052505.394ON564128698.5
CAGL0E03674g4.30ON577117698.7
ZYRO0G03234g2.473ON562120698.8
Kpol_1014.213.23ON53285699.5
TDEL0B002708.858ON58197699.5
Kwal_47.189193.503ON640315699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.2
         (627 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)     1179   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)  1079   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)  1072   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...  1046   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              829   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              821   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               810   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   805   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   794   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   757   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   756   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   728   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   692   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   687   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   643   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   600   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   597   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   573   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   568   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                563   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   556   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      542   0.0  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   536   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   529   0.0  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   526   e-180
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              520   e-178
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   520   e-177
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             518   e-177
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   516   e-176
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   511   e-174
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   508   e-173
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      500   e-170
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     499   e-170
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              495   e-167
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   478   e-161
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             475   e-160
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   474   e-160
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   474   e-160
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   474   e-159
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   465   e-156
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   455   e-153
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   453   e-152
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      447   e-149
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   445   e-149
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   439   e-146
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   427   e-141
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   426   e-141
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   425   e-141
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   424   e-141
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   424   e-140
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   424   e-140
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   424   e-140
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   424   e-140
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              405   e-132
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   397   e-130
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        385   e-128
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   378   e-122
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   374   e-121
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   370   e-120
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   369   e-119
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   367   e-118
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   348   e-111
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   304   4e-96
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   284   1e-88
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   260   9e-78
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    228   8e-66
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   216   3e-61
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       214   3e-61
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   185   6e-50
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   184   1e-49
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   182   4e-49
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              137   2e-33
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         108   6e-27
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...   102   1e-24
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    72   2e-12
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    64   5e-10
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    64   6e-10
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    59   2e-08
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    59   3e-08
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    58   5e-08
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    57   8e-08
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    53   1e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    53   1e-06
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    52   2e-06
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    52   3e-06
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    50   1e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    49   3e-05
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    49   4e-05
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    48   5e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    48   6e-05
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    48   6e-05
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    46   2e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    46   3e-04
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    46   3e-04
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    45   6e-04
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    44   0.001
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    44   0.002
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    43   0.002
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    43   0.002
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    43   0.002
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    42   0.003
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    42   0.004
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    42   0.004
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    42   0.004
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    42   0.006
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    42   0.006
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               41   0.007
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    41   0.007
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    41   0.008
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    41   0.008
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    41   0.009
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    41   0.010
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    40   0.013
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       40   0.014
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    40   0.014
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    40   0.016
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    40   0.016
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.017
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    40   0.022
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      39   0.023
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    40   0.023
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    40   0.025
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               39   0.026
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    39   0.029
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    39   0.029
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    39   0.029
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               39   0.030
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    39   0.037
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    39   0.048
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    39   0.050
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    39   0.051
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    39   0.056
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    38   0.067
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    38   0.070
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    38   0.071
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    38   0.080
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    38   0.093
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     38   0.094
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    38   0.097
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    37   0.11 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    37   0.11 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    37   0.13 
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               37   0.14 
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    37   0.14 
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    37   0.14 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    37   0.18 
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    37   0.19 
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    37   0.21 
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    37   0.23 
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    36   0.24 
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    36   0.26 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    36   0.27 
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    36   0.29 
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    36   0.29 
Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp...    32   0.31 
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    36   0.31 
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    36   0.35 
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    36   0.36 
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    36   0.37 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    36   0.39 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     36   0.40 
TBLA0A06370 Chr1 complement(1565642..1566370) [729 bp, 242 aa] {...    35   0.49 
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    35   0.52 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    35   0.56 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    35   0.60 
TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {...    35   0.63 
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 35   0.65 
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    35   0.69 
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    35   0.69 
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    35   0.72 
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    35   0.74 
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    35   0.78 
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    35   0.87 
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    35   0.87 
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               35   0.87 
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    35   0.89 
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    34   0.94 
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    34   0.96 
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    34   1.0  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    34   1.1  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    34   1.1  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    34   1.1  
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    34   1.1  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    34   1.2  
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    34   1.3  
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    34   1.3  
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    34   1.4  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    34   1.4  
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    34   1.4  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    34   1.5  
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    34   1.5  
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    34   1.5  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    34   1.5  
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    33   1.8  
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    33   1.9  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             33   1.9  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    33   2.0  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    33   2.0  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    33   2.0  
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    33   2.1  
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    33   2.2  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    33   2.2  
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               33   2.2  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       33   2.3  
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    33   2.3  
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    32   2.5  
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    33   2.5  
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    33   2.5  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             33   2.7  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    33   2.7  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               33   2.8  
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    33   3.2  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                32   3.6  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    32   3.8  
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    32   4.0  
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       32   4.1  
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    32   4.3  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    32   4.4  
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    32   4.5  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    32   4.6  
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    32   4.6  
KNAG0M02690 Chr13 (502232..503911) [1680 bp, 559 aa] {ON}              32   5.0  
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    32   5.5  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   6.0  
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    32   6.1  
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               32   6.2  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    32   6.2  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               32   6.3  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    32   6.4  
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    32   7.0  
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    32   8.3  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             31   8.5  
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    31   8.7  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    31   8.8  
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    31   9.5  
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    31   9.5  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    31   9.6  

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/627 (93%), Positives = 584/627 (93%)

Query: 1   MDPATANRALPEEFTEVVVPEILEKEVXXXXXXXXXXXXXXXXXXYIELIDPGVRNIEIY 60
           MDPATANRALPEEFTEVVVPEILEKEV                  YIELIDPGVRNIEIY
Sbjct: 1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELIDPGVRNIEIY 60

Query: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180
           VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180

Query: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300
           GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXX 360
           PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV     
Sbjct: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALF 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480
           PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540
           RMAIVTSLYLATYNI            WTNILPKEISKRISDPTLAAEAYGSPFTFITTY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627
           DNEIVEKEETSLRTRFLAQFTSKEKKN
Sbjct: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/627 (83%), Positives = 558/627 (88%)

Query: 1   MDPATANRALPEEFTEVVVPEILEKEVXXXXXXXXXXXXXXXXXXYIELIDPGVRNIEIY 60
           MDP+TA+RALPEEFTE +VPEI EKE                   YIELIDPGV NIEIY
Sbjct: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y+RPLYR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180
           VGQIFFARLSDIFGRFSILVISVIFY +GT+IESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISG+VTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300
           GLCMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+TAFFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXX 360
           PFTLAGGLKEEW+ AHIIVPEVIGWVVALPLYM+WE+KYSRHPLTPWDLIKDRG+     
Sbjct: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480
           PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540
           RMAIVTSLYLATYNI            WTNILP+EISKRISDPTLAA+AYGSPFTFI TY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEG+D+LESK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600

Query: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627
             E  EKEET L+++FL+QFT K K+N
Sbjct: 601 AFEPKEKEETFLKSKFLSQFTGKNKEN 627

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/627 (82%), Positives = 553/627 (88%)

Query: 1   MDPATANRALPEEFTEVVVPEILEKEVXXXXXXXXXXXXXXXXXXYIELIDPGVRNIEIY 60
           MDPATAN ALPE+FTE VVP+ILEKEV                  YIELIDPGV NIEIY
Sbjct: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60

Query: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE YSRPLYR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180
           VGQIFFARLSDIFGRFSI+++SVIFYSVGTIIESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300
           G+CMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+T FFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXX 360
           PFTLAGGLKEEWK+AHIIVPEVIGWVV LPLYM+WE+KYSRHPLTPWDLIKDRG+     
Sbjct: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILPKEISKRISDPTLAA+AY +PFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNH+LTDSIALEGNDHL+SK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600

Query: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627
             E  EK+E+ L++    +FT  E K 
Sbjct: 601 SFETEEKQESFLKSMIFTRFTRSEDKR 627

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/628 (82%), Positives = 553/628 (88%), Gaps = 1/628 (0%)

Query: 1   MDPATANRALPEEFTEVVVPEILEKEVXXXXXXXXXXXXXXXXXXYIELIDPGVRNIEIY 60
           MDP  AN  LPEEF EVVVPE+LEKEV                  YIELIDPGV NIEIY
Sbjct: 1   MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y+RP+YR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180
           VGQIFFARLSDIFGRFSI+++S+IFYS+GTIIESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISG+VTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240

Query: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300
           G+CMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+T FFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXX 360
           PFTLAGGLKEEWK AHIIVPEVIGWVV LPLYM+WE+KYSRHPLTPWDLI+DRG+     
Sbjct: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILPKEISKRISDPTLAA+AYGSPFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEGNDHLESKN
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 DNEIVEKEETSLRTRFLAQFT-SKEKKN 627
             EI EKEE+ L+ +F   FT SK++K+
Sbjct: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/584 (68%), Positives = 466/584 (79%), Gaps = 12/584 (2%)

Query: 47  IELIDPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHS 106
           I + D GV+NIE+YAEQY +P YR  LFFS+FL+AYAYGLDG IRYT+QAYATSSYSQHS
Sbjct: 34  ISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHS 93

Query: 107 LLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGG 166
           LLSTVNCIKTVIAA GQI+FAR SDIFGR ++L+I+++FY VGTIIESQA  + RF  GG
Sbjct: 94  LLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGG 153

Query: 167 CFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGI 226
           CFYQ+G TG +LI+EVIA+DFSNLNWRLLALFVPALPFI+NTWISGDVTSA+G +WKWGI
Sbjct: 154 CFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGI 213

Query: 227 GMWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKS-FSIDIVFWKLDL 285
           GMWAFI PLACIPLG CMLHMRYLA K++KDKL        + +WK  F ID++FWKLD+
Sbjct: 214 GMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDM 273

Query: 286 IGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLT 345
           IGLLL+  FFGCVLVPFTLAGG+  EWK AHIIVPEVIGWVV LPLY++WE+K+S+HPLT
Sbjct: 274 IGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLT 333

Query: 346 PWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIV 405
           PW L+KDRGV             WYMQGDYMYTVLVVAVHES+KSATRIT+LYSFVSV+ 
Sbjct: 334 PWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLT 393

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
           GT LG +LIKVRRTKPFI+FGIS W V+FGLL+ YRGDS +HAGIIGSLCLLGFGAG FT
Sbjct: 394 GTGLGLVLIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFT 453

Query: 466 YVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
           Y TQASIQA+  +H ++A++T+LYLA YNI            WTN+LP  ISK I++ TL
Sbjct: 454 YTTQASIQATTRSHQKLAVITALYLAAYNIGSGLGSAVSGAVWTNVLPDRISKAIANQTL 513

Query: 526 AAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLT 585
           AAEAYGSPFTFI T TWGTP+R+A+V +YR VQKILCIIGL FC PLL  A  LRNH+L 
Sbjct: 514 AAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLE 573

Query: 586 DSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQF--TSKEKKN 627
           D +AL   D    K D+ +V+         FLA+F  + + KKN
Sbjct: 574 DVVALNELDEKNVKEDDPVVD---------FLAKFIPSLRNKKN 608

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/554 (69%), Positives = 449/554 (81%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYAEQY  P  RA LFFS+FL+AYAYGLDG IRYTFQA ATSSYS+HSLLST
Sbjct: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VNCIKTVIAA GQI+FAR SDIFGR +IL +S+IFY +GT+IESQA  + RF  GGCFYQ
Sbjct: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG TG +LI+E+IA+DFSNLNWRLLALF+PALPFI+NTWISGDVT+A+  NWKWGIGMWA
Sbjct: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FI PLACIPL  CMLHMRYLA K+AKD+L P F    ++  K + ID+ FW+LD+IGLLL
Sbjct: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           +  FFGCVL+PFTLAGG+KE+W+ AHIIVPEVIGW VALPLY++WE+K+SRHPLTPW+L+
Sbjct: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRGV             WYMQGDYMYTVL+VAVHES+K+ATRIT+LYSFVSVI GTILG
Sbjct: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             L+K+RRTKPFILFGI  W +SFGLL+HYRGDSGAHAGIIGSLCLLGF AG FTY TQ 
Sbjct: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQT 466

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           SIQA+  +HA+MA++T+LYLA YNI            WTN+LP  IS+ IS+ TLAAEAY
Sbjct: 467 SIQATTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAY 526

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSPFTFI TYTW T ER A+V +YR  QKILCIIGLVFC PLL  A MLR+HKL D +AL
Sbjct: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586

Query: 591 EGNDHLESKNDNEI 604
           +       ++D+ I
Sbjct: 587 DQMSEKVVEDDDPI 600

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/560 (67%), Positives = 458/560 (81%), Gaps = 1/560 (0%)

Query: 50  IDPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLS 109
           +D GV NIE+YAEQYS P++R  LFFSIFL+AYAYGLDG +RYT+Q+YATSSY+QHSLLS
Sbjct: 50  VDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAYAYGLDGQVRYTYQSYATSSYAQHSLLS 109

Query: 110 TVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFY 169
           TVNCI TVIAA GQI +AR SDIFGR +ILVI VIFYS+GTIIESQA  ++RFA G CFY
Sbjct: 110 TVNCITTVIAAAGQICYARASDIFGRMTILVIGVIFYSMGTIIESQATNVSRFAAGSCFY 169

Query: 170 QLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMW 229
           QLG TG++L LEVIA+DFSNLNWRLLA FVPALPFI+NTWISG+VTSA+  NWKWGIGMW
Sbjct: 170 QLGYTGIVLTLEVIAADFSNLNWRLLASFVPALPFIINTWISGNVTSAVNGNWKWGIGMW 229

Query: 230 AFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLL 289
           AFILPL+ IPLG C+LHMRYLA+K+A D+L  E   +  L WK F ++I+FW+LD IGLL
Sbjct: 230 AFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKEASLIGTLGWKKFIVEILFWRLDFIGLL 289

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDL 349
           ++   FGC+L+PFTLAGGL+ EW+ AHIIVPEVIGW +ALPL+++WE+K+SRHPLTPW L
Sbjct: 290 MLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWAL 349

Query: 350 IKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTIL 409
           IKDRG+             WYMQGDYMYTVL+V+VHES+KSATRIT+LYSFVSVI GTIL
Sbjct: 350 IKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSATRITSLYSFVSVITGTIL 409

Query: 410 GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQ 469
           G  + K+RRTKPFI+FG+ CW ++FGLLVHYRGD+ +H+GIIGSLCLLGFGAG FTY TQ
Sbjct: 410 GMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRGDNNSHSGIIGSLCLLGFGAGFFTYTTQ 469

Query: 470 ASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEA 529
           ASIQASA +H++MA++T+LYLATYNI            WTNILPKEISKR+++ TLAA A
Sbjct: 470 ASIQASAKSHSKMAVITALYLATYNIGSSVGAAVSGAIWTNILPKEISKRLNNETLAALA 529

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
           Y SP++FI  YTWGTPER A+V++YRY Q+ILCI+GL FC  LL  A  LRNHKL  S++
Sbjct: 530 YSSPYSFIIDYTWGTPERDAVVLAYRYTQRILCIVGLCFCTTLLISALFLRNHKLVSSVS 589

Query: 590 LEGNDHLESKNDNEIVEKEE 609
           ++  +  + +  ++I  KE+
Sbjct: 590 ID-KEQTKVEEVSDITSKEK 608

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/559 (67%), Positives = 453/559 (81%), Gaps = 6/559 (1%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YAEQYS P+YR  LFFS+FL+AYAYGLDG +RYT+QA ATSSYSQHSLLST
Sbjct: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLST 114

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VN I TVIAA GQI +AR SDIFGR +IL+I ++FY+VGTIIESQA  +TRFAVG CFYQ
Sbjct: 115 VNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG TGVIL LE+IA DFSNLNWRL A FVPALPFI+NTWISG+V+ A+G +WKWGIGMWA
Sbjct: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FI+PL+ IPLG C+LHMR+LA K+AKD+L+ EF T  ++ W ++ +D+  WKLD IGLLL
Sbjct: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           + A FGC+LVPFTLAGGL+++WK AHIIVPEVIGW VALP++++WE+K+S+ PLTPW LI
Sbjct: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRG+             WYMQGDYMYTVL+V+V+ESIKSATRIT+LYSFVSVI GT+LG
Sbjct: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            ++IKVRRTKPFI+FG+SCW ++FGLLVHYRG S +H+GI+GSLCLLGFGAG FTY TQA
Sbjct: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQA 474

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           SIQAS   H++MA++T+LYLA YNI            WTN+LPK+ISKRI++ TLAAEAY
Sbjct: 475 SIQASVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAY 534

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSPFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNHKL   +AL
Sbjct: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594

Query: 591 E------GNDHLESKNDNE 603
                   +D   S  DN+
Sbjct: 595 SELENTPNSDEQGSFADND 613

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/577 (67%), Positives = 456/577 (79%), Gaps = 9/577 (1%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYA+QY  P YR  LFFSIFL+AYAYGLDG IRYTFQAYATSSYSQHSL+ST
Sbjct: 32  DAGVHNIEIYADQYKSPYYRVALFFSIFLVAYAYGLDGNIRYTFQAYATSSYSQHSLIST 91

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VNCIKTVIAA GQI FAR SD+FGR SIL+I+V+FY VGT+IESQA  ++RFA G CFYQ
Sbjct: 92  VNCIKTVIAAAGQICFARASDVFGRLSILIIAVLFYVVGTVIESQATNVSRFAAGACFYQ 151

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LGLTG+ILILEVI  DFSNLNWRL+A FVPALPFI+NTWISGDVTSAIGTNW+WGI MWA
Sbjct: 152 LGLTGIILILEVIVMDFSNLNWRLVASFVPALPFIINTWISGDVTSAIGTNWEWGIAMWA 211

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FILPL+CIPL  CMLHMRYLA K+A + L  EF+    + W  + ++I FWKLD +GLLL
Sbjct: 212 FILPLSCIPLVCCMLHMRYLAHKNAPENLMSEFKLYKQMPWSEYLVEIFFWKLDFLGLLL 271

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           +   FG VL+PFTLAGGL+ +WK+A IIVPEV+GW +ALPL+++WE KY+R+PLTPWDLI
Sbjct: 272 LCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLI 331

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRG+             WYMQGDYMYTVL+VAVHESIKSATRI +LYSFVSVI GT+LG
Sbjct: 332 KDRGIFSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSFVSVITGTLLG 391

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F+++KVRRTKPFILFG+ CW +SFGLLVHYRGDSGAHAGI+GSLCLLGFGAG FTY TQA
Sbjct: 392 FVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGDSGAHAGIVGSLCLLGFGAGFFTYTTQA 451

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           SIQAS G+H  MA++T+LYLATYNI            WTN+LP+++SKR+SDP +A+ AY
Sbjct: 452 SIQASTGSHQNMAVITALYLATYNIGSAVGNAVSGAIWTNVLPQQLSKRLSDPEMASAAY 511

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSPFTFI TYTW T ER A+V +YR+VQKILC +G+ FC PL+  A +LRNHKL   +AL
Sbjct: 512 GSPFTFIITYTWETLERQAVVHAYRHVQKILCTVGVCFCVPLVLAALLLRNHKLESVVAL 571

Query: 591 EGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
           +  D     +DNE            FL +F    + N
Sbjct: 572 DDLDEKNRVDDNE---------NGNFLTKFFPSSRSN 599

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/561 (61%), Positives = 438/561 (78%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA+QYS   YR  LFFS+FL+AYAYGLDG +RY FQAYAT+SY  HSLLST
Sbjct: 24  DAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLST 83

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VNCIK VIAA GQ+ FAR +DIFGR SI+++S++FY VGTII+SQA T++++A G C YQ
Sbjct: 84  VNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIYQ 143

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG TG+ILILE+IA DFSNLNWRLLA FVPA+PFI+NTWISGDV SA+G NWKWGIGMWA
Sbjct: 144 LGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMWA 203

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FI PL+ +PL  CM HMRYLAR+ A D+L  E     ++ W ++  ++ FW+LD +GL++
Sbjct: 204 FIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLIM 263

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           V   FGC+L+PFTLAG LK++W+ A IIVPEVIGW VALPL+++WE+K+++HPL PW++I
Sbjct: 264 VCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVI 323

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRG+             WYMQG +MYTVL++AV+ES+KSATRIT+LYSFVSV+ G  LG
Sbjct: 324 KDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGLG 383

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F++  +R+TK FI+FGI CW+VSFGLL+HYRGDS +H+GIIG+ CLLGFGAG FTY TQ 
Sbjct: 384 FVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTTQT 443

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           SIQASA TH  MA++T+LYL+ YNI            WTNILP+E+ KRI+DPT  A AY
Sbjct: 444 SIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALAY 503

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSPFTFI TY WGTPER A+V SY+YVQK+LC++G+ FC  L+  A  LR+H+L DS+AL
Sbjct: 504 GSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSVAL 563

Query: 591 EGNDHLESKNDNEIVEKEETS 611
           E  D   S N +   E ++++
Sbjct: 564 EDEDEKFSINSDAEGELQDST 584

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/556 (65%), Positives = 434/556 (78%)

Query: 48  ELIDPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSL 107
           E  D GV NIE++  QY    YR  LFFSIFLI+YAYGLD  IRYT Q YAT+SYSQHSL
Sbjct: 29  EEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSL 88

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGC 167
           L+TVNCI  VIAA GQ+ FAR +DIFGRF++L+++VIFY +GTIIESQA  ++RFA G C
Sbjct: 89  LATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRFAAGAC 148

Query: 168 FYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG 227
           FY+LG+TG++L++EVIA DFSNLNWRLLA FVPALPFI+NTWISG+V +AIGTNWKWGIG
Sbjct: 149 FYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIINTWISGNVLTAIGTNWKWGIG 208

Query: 228 MWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIG 287
           MWAFILPL+CIPLG CMLHMRYLA K+AKD+LR EF+    + W  + +++ FW+LD  G
Sbjct: 209 MWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPG 268

Query: 288 LLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPW 347
           L+L+   FGC+L+PFTL GGL E+WK A IIVPEVIGWVVALPLYM+WE KY+RHPLTPW
Sbjct: 269 LILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPW 328

Query: 348 DLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGT 407
            LIKDRG+             WYMQGDYM+TVL VAV+ES  SA RIT+LYSFVSVI GT
Sbjct: 329 KLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGT 388

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
           +LG +++KVRRTK FILFGI CW +SFGLLVH+RGDS +H+GIIGSLCL+GFGAG FTY 
Sbjct: 389 LLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYT 448

Query: 468 TQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
           TQASIQAS   H  +A++TSLYLATYNI            WTN+LPKEI KR++D TL  
Sbjct: 449 TQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQ 508

Query: 528 EAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDS 587
           +AY  P TFI TYTW T ER A+V++YRY QK+LCI+GL FC PLL  A +LR+H+L D 
Sbjct: 509 QAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDV 568

Query: 588 IALEGNDHLESKNDNE 603
           IALE  D      D E
Sbjct: 569 IALEDLDEKNLAEDEE 584

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/570 (60%), Positives = 430/570 (75%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA QYS   YR  LFFS+FL+AYAYGLDG +R + QAYATSSY  HSLL+T
Sbjct: 44  DAGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLAT 103

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           +NC+K VIAA GQI FAR SDIFGR +IL ++V+ Y+VGTII+SQA  ITR+A G C YQ
Sbjct: 104 INCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ 163

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG TG+ILILE+IA DFSNLNWRL+A FVPALPFI+NTWISG+   A+G NWKWGIGMWA
Sbjct: 164 LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMWA 223

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FI+PL+C+PL  C+LHMR+LA K+AKD+L  E     ++ W  + +++ FW+LDL+GLLL
Sbjct: 224 FIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLL 283

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           V   FGC+LVPFTLAG L+ +WK A IIVPEVIGW VALPL+++WE KYSRHPL PW L+
Sbjct: 284 VCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLV 343

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRG+             WYMQGDYMYTVL+VAV+E+ KSA RIT+LYSFVSVI G +LG
Sbjct: 344 KDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLG 403

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            +++  RRTK FILFGI+CW V+FGLLVHYRGDS +H+GI+GSLCLLGFGAG FTY TQ 
Sbjct: 404 GVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQT 463

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           SIQAS  +H  MA++T+LYL+ YNI            WTNILP+E+ KRI+D      AY
Sbjct: 464 SIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVATYTLAY 523

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSPF FI  Y WGTPER+ +V +YR VQ+IL I+GL FC  LL  A  LR+H+L +++AL
Sbjct: 524 GSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVAL 583

Query: 591 EGNDHLESKNDNEIVEKEETSLRTRFLAQF 620
           E  D   S+  +E+  + E +  T+   ++
Sbjct: 584 EDVDEKSSRKSDELEARIEDNTETKGFERY 613

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/553 (57%), Positives = 414/553 (74%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV+NI++YA+QY+   YR  LFFS+FL+AY+Y LDG +R   + YAT SY  HSLLST
Sbjct: 27  DAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLST 86

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VNCIKTVI A G I +AR SDIFGR ++L I+V+ Y VGTI+E Q+ T+++FA G   +Q
Sbjct: 87  VNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIFQ 146

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG  G++L+L+VIA DFS LNWR++AL+VPALP I+NTW+SGD+  AI  NWKWGIGMWA
Sbjct: 147 LGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMWA 206

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FILPLAC+PL  C++HMRYLA K+ KD+L  E+E   N  W ++  ++ FW+LD++GL+L
Sbjct: 207 FILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLDILGLIL 266

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           +TA  GCVL+PFTLAGGL ++WK+AHIIVPEVIGW VA PL+++WE KY+RHPLTPW L+
Sbjct: 267 ITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLL 326

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRGV              YMQ DYMYTVLVVAV+ES+KSA RIT L++FV++I GT+LG
Sbjct: 327 KDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTLLG 386

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F++  V+RTK FILFGI  W V+FGLL+ YRGDS +H+GI+G+LCLLGFG G F Y TQ 
Sbjct: 387 FVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYATQV 446

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           S+ AS  +H  MA++TSLYLA+YN+            WTN+LPK++ KRISD ++A  AY
Sbjct: 447 SLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANIAY 506

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
            SPF FI  Y WG+PERIA++ +Y+ VQKILC +GL FC  LL  A  LR+ KL   +AL
Sbjct: 507 SSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVVAL 566

Query: 591 EGNDHLESKNDNE 603
           E  +  E   +++
Sbjct: 567 EDAEEKEPSINSQ 579

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/581 (55%), Positives = 417/581 (71%), Gaps = 16/581 (2%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YA QY    YR  LFFS+FLIAYAY LDG +R   +AYAT SY  HSLLST
Sbjct: 36  DVGVKNIEVYAAQYDHVAYRVALFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLST 95

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           VNCIKTV+AA G + +AR SD+FGR  +L IS++   VGTI+E Q+ T+++FA G C YQ
Sbjct: 96  VNCIKTVMAAGGMVAYARASDMFGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQ 155

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG  G+ LIL+VIA DFSNLNWR++AL+VPALP I+NTW+SGDV SAIG++W+WGIGMWA
Sbjct: 156 LGKAGLALILQVIAVDFSNLNWRMVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWA 215

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           FI+PL+CIPL  C++HMRYLA KHA ++L  + +  +   W  + I++ FW+LD +GL+L
Sbjct: 216 FIIPLSCIPLFCCLVHMRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLIL 275

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           V    GCVLVPFTLAGGL ++W+ A IIVPEVIGW VALPL+++WE K++R PLTP  ++
Sbjct: 276 VVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVL 335

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRGV              YMQ DYMYTVLV+AVHES+K+A RIT L++FVS+I GT+LG
Sbjct: 336 KDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLLG 395

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
           F+++ V+RTK FILFG+  W V+FGLLVH+RGD  +H+GIIG+LCLLGFG G F Y  Q 
Sbjct: 396 FVIVYVKRTKKFILFGVCVWFVAFGLLVHFRGDESSHSGIIGALCLLGFGGGFFNYSAQV 455

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           S+QAS   H  +A+VTSLYLA YNI            WTN+LPKE++KRI++  +A  AY
Sbjct: 456 SMQASTAAHQDLAVVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLAY 515

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
            SPF FI  Y WGTP+R+A+V +Y+ VQ+ILCI+ L FC  LL  A +LR+ KL++ +AL
Sbjct: 516 SSPFKFIIKYKWGTPQRVAVVHAYQKVQRILCIVPLCFCVTLLIAAFLLRDKKLSEVVAL 575

Query: 591 ----------------EGNDHLESKNDNEIVEKEETSLRTR 615
                            G  H  S  +NE+  + E S  TR
Sbjct: 576 GELEHGHSESASSTGDAGASHELSSTENELHNESEKSSNTR 616

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/554 (54%), Positives = 403/554 (72%), Gaps = 4/554 (0%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV N E+YA+ YS P  R+ +F  +F I YAYGLD  +R  +Q  ATSSY QHSLLSTVN
Sbjct: 47  GVYNSEVYAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVN 106

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
            IK+VI+A GQI+FAR SD+FGR +IL+++V+FY VGTI+ESQAV +++FA G C +QLG
Sbjct: 107 AIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLG 166

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
             GV+++++++ SDFSNLNWR+ A+  P LP ++NTW+SGD+ SA+  NWKWGIGMWAFI
Sbjct: 167 YDGVVMMVQILVSDFSNLNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFI 226

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
            PL+CIP G+ +LHM+YLARK+  D L+  F+   ++ WK +  +I  WKLD IGLLL  
Sbjct: 227 FPLSCIPFGILLLHMKYLARKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAV 285

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           AFFG VLVPFTLAGGL ++WK A IIVPEV+GWVVA P ++ WE+K++++PLTPW  +KD
Sbjct: 286 AFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKD 345

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RGV             +YMQ  YMYT+L+VAV+++ KSATRI +L++FV+ + GT+LG +
Sbjct: 346 RGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLV 405

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FI FGI+ W +SFGLL  Y G + A+AGII +LCLLGFG G   Y T+AS+
Sbjct: 406 IVKVRRTKEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASM 465

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QASA TH  MAI+TSL++A   I            WTN+LP +I K +++ TLA  AY S
Sbjct: 466 QASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNS 525

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P  FI  Y W +PER  +V +Y++V+KIL I+GL F  PLLG A +LRN +L D++AL  
Sbjct: 526 PTKFILQYNWESPERQIVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVAL-- 583

Query: 593 NDHLESKNDNEIVE 606
            D +E KN+ + +E
Sbjct: 584 -DKVEPKNEKKEME 596

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/553 (52%), Positives = 394/553 (71%), Gaps = 1/553 (0%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV N+EIYA+ YS P+ R  +FFS+F IAYAYGLD  +R T+Q  ATSSY+QHSLLSTV+
Sbjct: 43  GVHNVEIYAKYYSTPVKRFLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVS 102

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           CIK VI+A  QI+FAR +D+FGR +IL+IS++FY VGT++ESQAV +++FA G C Y +G
Sbjct: 103 CIKAVISAAAQIWFARSADMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVG 162

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
            + ++L  EV  +DFSNLNWR+ A   P LP ++NTWISGD+T+AI  NWKWGIGMWAFI
Sbjct: 163 HSAIVLFSEVYVADFSNLNWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFI 222

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
            PL+CIP+G C+LHM+YLA+K+ KD L+  F+   +  W  + +D+ FWKLDL+GLLL+ 
Sbjct: 223 FPLSCIPMGACILHMKYLAKKN-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLV 281

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           A FG +L+PFTLAGG ++ W  A IIVPEV+GW  ALPL++VWE+K++R+PLTP D +K+
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RG+             + MQ  Y+YTVL+VAV ES KSATRI  L+SFVSVI G + GF+
Sbjct: 342 RGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFV 401

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           + KVRRTK FI FGI  W +SFGL++ Y G   +H GII + C+LGFG G   +  +ASI
Sbjct: 402 VAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASI 461

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QASA +H  MA++TSL+LA  +I            WTN+LP +IS+ I++ TLA  AYGS
Sbjct: 462 QASAYSHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGS 521

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P  FI  Y W TPER A+V +Y+ + ++L I+G+    PLL  A  L+N +L D ++ + 
Sbjct: 522 PTKFILKYKWDTPERQAVVEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDK 581

Query: 593 NDHLESKNDNEIV 605
            D + S+N  + V
Sbjct: 582 FDKMNSENAEDSV 594

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/565 (52%), Positives = 391/565 (69%), Gaps = 9/565 (1%)

Query: 46  YIELIDPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQH 105
           YIE  + GV N EIY + YS P+ R  +F S+FLIA+AYGLD  +R T+Q  ATSSYSQH
Sbjct: 52  YIE--NSGVHNAEIYCKYYSHPIKRIMVFSSLFLIAFAYGLDNSVRTTYQTMATSSYSQH 109

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVG 165
           SLLSTV CIK VI+A  Q++FAR +D+FGR +IL IS+IFY +GTIIE +A  ++R+A G
Sbjct: 110 SLLSTVTCIKKVISAAAQLWFARSADMFGRPTILTISIIFYVIGTIIECRAFDVSRYAAG 169

Query: 166 GCFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWG 225
            C + LG  G++L+ E+  +DFSNLNWR+ A     LP ++ TWISG++T AI  NW+WG
Sbjct: 170 ACIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPNVITTWISGNITGAIDKNWEWG 229

Query: 226 IGMWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDL 285
           IGMWAFI PL+C+PL +C++HMRYLARK+  + L+  F+  N + WK + IDI FWKLD+
Sbjct: 230 IGMWAFIFPLSCVPLIICIIHMRYLARKN-NENLKVVFQKPNYMTWKEYCIDIFFWKLDI 288

Query: 286 IGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLT 345
           IGL+L+ AFF  +LVPFTLAG L   WK+  IIVPEV+GWV+A+PLY++WE+KY+R+PLT
Sbjct: 289 IGLILLVAFFSLILVPFTLAGSLT--WKSPKIIVPEVLGWVLAIPLYLIWELKYARYPLT 346

Query: 346 PWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIV 405
           PW+ IKDRG+             +YMQ  YM TVL+VAV +S KSATRI   YSFV V+ 
Sbjct: 347 PWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAVGQSKKSATRIIKFYSFVGVLT 406

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
              LGF++ KVRRTK FI  GI  W V+FGLL HY G  GA AGII ++C+LGFG G   
Sbjct: 407 AFFLGFVVAKVRRTKEFIALGIGIWFVAFGLLEHYEGGLGARAGIIAAICILGFGNGFLK 466

Query: 466 YVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPT 524
           +  +ASIQA+A +HA M I TSL+ A  +I            W+N+LP EI+KRI+ + T
Sbjct: 467 FPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAGGIWSNVLPGEINKRITNNST 526

Query: 525 LAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKL 584
           LA  AYGSP  FI  Y W T ER A+V +Y+ V++++ I+GL    P+L  +  LRN +L
Sbjct: 527 LATYAYGSPTKFIKQYGWETTERQAVVSAYKVVERLMAIVGLCLLVPMLVASIFLRNRRL 586

Query: 585 TDSIALEGNDHL---ESKNDNEIVE 606
            D ++ +  D     +S +D E+V 
Sbjct: 587 EDVVSFDKLDETFDEKSTDDEEVVR 611

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/562 (49%), Positives = 382/562 (67%), Gaps = 1/562 (0%)

Query: 48  ELIDPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSL 107
           E++ PGV N +IY + Y+ P  R  +FFS+FLI YAYGLD   R T+   ATSSY +HSL
Sbjct: 43  EVLSPGVHNAKIYGKYYTEPYQRIMIFFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSL 102

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGC 167
           +STV CI  VI+A GQI+FAR SDIFGR  I  +SVIFY +GT+IESQA  I+R+A G C
Sbjct: 103 MSTVTCITKVISAAGQIWFARASDIFGRKLIFGLSVIFYVIGTVIESQATEISRYAGGEC 162

Query: 168 FYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG 227
            Y LG  G++L  E+ A+DFSNLNWR++A   P LP I+NTW+SG++T+ +  NWKWGIG
Sbjct: 163 LYGLGHAGIVLTTELYAADFSNLNWRVVAAAAPMLPNIINTWVSGNITADVDENWKWGIG 222

Query: 228 MWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIG 287
           MWAFI P++C+PL  C+LHMRY A+K+  ++L+P F   +N+ +K + +D+ FWK D+IG
Sbjct: 223 MWAFIFPISCLPLIGCLLHMRYKAQKN-NEELKPVFVKPSNMSYKEYLVDVFFWKSDIIG 281

Query: 288 LLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPW 347
           L+L+   FG VLVP TLAGGL ++W  A IIVPEV+GW +ALPLY+ WE K++++P+   
Sbjct: 282 LILLVGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFAKYPIIKL 341

Query: 348 DLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGT 407
           + ++D G+             +YM   Y+ T L+VAV+ES KSATRI +L +FV+VI G 
Sbjct: 342 ETVRDSGIWSALSISLFIDFCFYMHETYLVTFLLVAVNESKKSATRINSLSTFVTVITGF 401

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
            LG  ++++RRTK  I+FG   W V+ GL + Y G   +H+G+IG++CLLGFG G   + 
Sbjct: 402 FLGLAIVRIRRTKISIVFGTLVWFVAHGLFIEYNGGLRSHSGLIGAICLLGFGNGFIRFP 461

Query: 468 TQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
            +ASIQ S GTH ++AIVTSL+LA  +I            W+N+LP +I  RIS+ T+AA
Sbjct: 462 VRASIQVSVGTHEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNVLPGQIESRISNATIAA 521

Query: 528 EAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDS 587
            AY SP TFI  Y WGT  R A+V +Y YV KIL I GLV   PLL  A  LR+ KL   
Sbjct: 522 SAYSSPTTFIKKYKWGTEYRTAVVSAYGYVWKILNITGLVLVLPLLISALFLRDRKLESV 581

Query: 588 IALEGNDHLESKNDNEIVEKEE 609
           +A +     E  ++NE V++++
Sbjct: 582 LAFDEVTDTEGYSENEKVQQKK 603

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/568 (49%), Positives = 379/568 (66%), Gaps = 10/568 (1%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
              N  IY + YS PL    L+FS+FL+AYAY L   +R T+Q  ATSSYS+HSLL+TV 
Sbjct: 38  AAHNARIYVKYYSTPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQ 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           CI  VI+A GQI++AR SDIFGR  IL++S++FY +GT+IESQA  I+++A G C Y LG
Sbjct: 98  CINQVISAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALG 157

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
             G +L+ +V+ SD+S L WRL++  V  LP I+NTW+ G++T  +G  W+WG GMWAFI
Sbjct: 158 YAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFI 217

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
            PLA IPL  C+ HM+YLA K+ +D ++       ++ W     DI FWKLD++GL+L+ 
Sbjct: 218 FPLASIPLLCCLAHMKYLAIKNKED-VKLTISKPRSISWARHLYDIFFWKLDMLGLILLV 276

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           AFF  +LVP TLA GL E W +A  IVPEV+GW +ALPL++ WE+K++ +P+TP DLIKD
Sbjct: 277 AFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKD 336

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RG+             + +   Y+YTVLVVAV+ES KSATRIT+L++FVSV+    LGF+
Sbjct: 337 RGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFV 396

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FI+FGI+ W +++GL  HYRG + +HAGII ++C+ GFG G   +  + S 
Sbjct: 397 VVKVRRTKEFIIFGIAMWYIAYGLFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVST 456

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QASA TH R+AI TSLYLA  +I            WTNILP +I   I + TLA  AY S
Sbjct: 457 QASAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYES 516

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P  FI T+ W +PER ALV++YRY+Q++L I+ L    PLL  +  LRN  LTD++A E 
Sbjct: 517 PIKFIRTHKWDSPERQALVVAYRYIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

Query: 593 ND--------HLE-SKNDNEIVEKEETS 611
            D         LE SK DN   + EE S
Sbjct: 577 TDIPKESDSSDLENSKIDNLEEDSEEDS 604

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/566 (49%), Positives = 387/566 (68%), Gaps = 4/566 (0%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV NIE+Y +QY +P+Y+  L+FSIFL+AY Y LD  +R+T+Q   TS +   + L TVN
Sbjct: 61  GVINIELYKQQYHKPIYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVN 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           CIKTV+   GQ  FAR SDIFGR ++L  S+I Y +GTII+ +A  I++F+ G   YQLG
Sbjct: 121 CIKTVMGTAGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLG 180

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
           L G+ ++L VIASDFS+LNWRL A FVPALPF++N WI G +T  IG  W+WGIGM+AFI
Sbjct: 181 LIGIQIMLGVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFI 240

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
           +P ACIPL  C+LHMRYLA K+ + K++ EF     L ++ + +DI FW+LDL+G  L+ 
Sbjct: 241 MPCACIPLAFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLC 300

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           A FGC+L+P  LAGG    W+   IIVPEV+GWVV LP+++ WE K ++HPL  WD I+D
Sbjct: 301 ALFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIED 360

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RG+             +++ GDY++TVL++ + +S+ ++TRIT+ YSFV +I GT++G +
Sbjct: 361 RGILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLV 420

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           +I+ RRTKPFI+FGI CW ++ GLLVH+ G+     G+ GSLCLLG GAG FTY TQASI
Sbjct: 421 IIRARRTKPFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASI 480

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QA+  THA+MA+VT+LYL+ Y+I            WTN+LP++I  R  + + A  AY S
Sbjct: 481 QAAIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIWTNLLPRKIF-RTMNHSDATAAYDS 539

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P  FI    WG+P R  L  +Y YVQK+LC++ L FC PLL  A  LRNHKL  ++ALE 
Sbjct: 540 PQLFILNNPWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALEN 599

Query: 593 NDHLESKND---NEIVEKEETSLRTR 615
            D  + K D   ++++ K +   R +
Sbjct: 600 VDEKQVKEDERRHDLICKIQDRRRAK 625

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/562 (50%), Positives = 374/562 (66%), Gaps = 7/562 (1%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+Y+E YS    R   FFSIFL  Y Y LD  +R TFQ  ATSSY  HSL+ST
Sbjct: 39  DTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMST 98

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           V CI TVI+A GQI +AR +DIFGR S++  ++ FY +GT++ESQA  ITR+AVG CFY 
Sbjct: 99  VTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYVIGTVVESQATNITRYAVGACFYS 158

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG   ++L LEV+A+DFSNLN+R+LA   P LP ++NTWISG++TS IG +W+WGIGMWA
Sbjct: 159 LGHAAIVLALEVLAADFSNLNYRILASAAPMLPNVINTWISGNITSDIGDHWQWGIGMWA 218

Query: 231 FILPLACIPLGLCMLHMRYLAR-KHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLL 289
            I P+ CIPL  C+ HMRYLA+ KH + +LR       N+    + ID+ FW+LD++GLL
Sbjct: 219 IIFPVCCIPLLFCLFHMRYLAQYKHNRRELRSFSTIPPNMTRMEYFIDVFFWRLDILGLL 278

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDL 349
           L   FF CVL+PFTLA    ++WK+A IIVPEVIGW+VALPLY+ WE K+++ PLTPW+L
Sbjct: 279 LGVIFFACVLIPFTLAAKATDKWKSASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNL 338

Query: 350 IKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTIL 409
           +KDRGV             +Y+Q  Y YTVL+V+   ++ +ATR   +++FV VI   +L
Sbjct: 339 VKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLVSFDTTVLAATRTNNMFTFVGVITANLL 398

Query: 410 G-FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVT 468
           G F+  K+RRTK FI FGIS +IVS GLL  YR  + A  G I + CLLGFG G   +  
Sbjct: 399 GIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYRIGAHAKVGTIVACCLLGFGNGFLKFPA 458

Query: 469 QASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAE 528
           +ASIQA+A TH  +AI+TSL+LA  +I            W+N +  E+SK IS+ T  + 
Sbjct: 459 RASIQAAAYTHKNLAIITSLFLALGSIGEGFGSSVAGAIWSNRMEVELSKYISNQTAVSL 518

Query: 529 AYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSI 588
           AY SP  FI +Y W +PERI LV +Y +V  IL I+ +  C PL   A +LR+ +L D +
Sbjct: 519 AYESPTKFIKSYKWESPERIGLVQAYSHVTNILYIVTICLCIPLYVFALLLRDRELADVV 578

Query: 589 ALEGNDHLESKNDNEIVEKEET 610
           A E  D       +EI+++++T
Sbjct: 579 AFEQLD-----GQDEIIQEKKT 595

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/568 (47%), Positives = 374/568 (65%), Gaps = 1/568 (0%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV N+EIYA+ Y+ P  +  ++FS+F+I YAYGLDG +R T+Q  ATSS+++HSL STV 
Sbjct: 58  GVYNMEIYAKYYANPFQKFLIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVT 117

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           CI  V ++ GQI+FAR SDIF R   +VIS++FY VGTII SQA ++ ++AVG C Y +G
Sbjct: 118 CINRVTSSAGQIWFARASDIFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIG 177

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
             G++L+ E+  +DFSNLNWR++A   P LP I+NTW+SG++TS +G+ W+WG+GMWA I
Sbjct: 178 HAGIVLLCEIYMADFSNLNWRVVAENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAII 237

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
            P +CIPL +C+ HMRY+A+K+  +K+R  FE  + + WK + IDI  WKLD IGL+L+ 
Sbjct: 238 FPASCIPLFVCIYHMRYMAKKN-NEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLV 296

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           A F  +LVPFT +GGL  EW +A+ IVPEV+GWVVALP++ VWE K+SR+P+   DLI D
Sbjct: 297 AVFALILVPFTTSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISD 356

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RG+              Y+   Y+YT L+VAV ++ KS TRI +L SFV+VI    LG  
Sbjct: 357 RGIYSALSISFFIQFCLYVNDTYLYTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLF 416

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           ++K+RRT+ FI+ G   W V +GL VHY G  G+ +GII + CL GFG G      +AS+
Sbjct: 417 IVKIRRTQIFIVIGCVSWFVVYGLYVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASL 476

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QAS+ +H  +AIVT+L+LA  NI            W+N+LP  + K I + TLA  A+ S
Sbjct: 477 QASSNSHQNLAIVTALFLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDS 536

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P  FI  Y W T  R  LV SY  V +IL I+ LV   P+L  + +LR+ KL++S+A + 
Sbjct: 537 PIKFIKQYKWHTAVRQHLVSSYGSVWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQ 596

Query: 593 NDHLESKNDNEIVEKEETSLRTRFLAQF 620
            D   +  + E + ++  S      A+F
Sbjct: 597 RDFSPTDCEEENIGQDRRSYIGDRYAKF 624

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/562 (47%), Positives = 376/562 (66%), Gaps = 8/562 (1%)

Query: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110
           D GVRNIEIYAE Y+    R   FF +FL+AYAYGLD  +R TF   ATSSY +H+L+ST
Sbjct: 47  DAGVRNIEIYAEYYTSKFSRFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170
           V CIKT+I+A GQI FAR  DIFGR SI V S+I Y+VGTI+ESQA TI+++A G   Y 
Sbjct: 107 VTCIKTIISAAGQIGFARSCDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYS 166

Query: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230
           LG +G++L+ EV+ +DFSNLNWR++A   P LP ++NTWISG++ + +G +WKWGIG+WA
Sbjct: 167 LGHSGIVLVSEVLIADFSNLNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWA 226

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETL----NNLDWKSFSIDIVFWKLDLI 286
            + P+ CIPL   +LHM+YLA+   KDK RPE + +      +    + I+ +FW++D++
Sbjct: 227 IVFPVCCIPLLFILLHMKYLAQY--KDK-RPELKRIWTLPKGMTKVQYLIETLFWRVDVV 283

Query: 287 GLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTP 346
           GL+L+ A FG +L+PFTLA     +WK A  IVPEV+GW V+LPLY +WE  ++R PLTP
Sbjct: 284 GLILLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTP 343

Query: 347 WDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVG 406
              +KDRG+             +YMQ  Y+YTVL VA + +  +ATRI  LYSFV VI  
Sbjct: 344 LATVKDRGIYGALLVSLFIDFVYYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITS 403

Query: 407 TILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTY 466
             LGF+++++++ K FILFGI+ WI+++GL + YR    ++ G I ++C+LGFG G    
Sbjct: 404 FFLGFVVVRLKKVKKFILFGIAVWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKI 463

Query: 467 VTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLA 526
             +ASIQAS G+H +MA++TSL+LA  +I            W N +  EI KR+S+ T A
Sbjct: 464 PARASIQASVGSHQKMAVITSLFLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAA 523

Query: 527 AEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTD 586
           A AY SP  F+  Y WGT  R+ +V +YR V  IL ++G+  C PLL C+ +LR+ KL +
Sbjct: 524 ALAYDSPTKFVKKYKWGTATRMEVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEE 583

Query: 587 SIALEGNDHLESKNDNEIVEKE 608
            I+ +      S++ +EI+EKE
Sbjct: 584 VISYDMMGS-NSESKDEIIEKE 604

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 367/556 (66%), Gaps = 10/556 (1%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV+ +EI  +QY+    ++ +FFS+FL+ + + LD  +R +  AYAT+SY QHSLLSTVN
Sbjct: 57  GVQKVEILNKQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVN 116

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
            +++V AA G   ++RLSD+FGR  ++V+SV+ Y  GTII +QA  +TR+A G   YQ G
Sbjct: 117 VVRSVAAACGLPLYSRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFG 176

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKW-GIGMWAF 231
           L G+ ++ +VIA+DFSNLNWR+    + A PFI+NTW+SGD+  AIG NW W GIG+WA 
Sbjct: 177 LCGLAILFKVIAADFSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAI 236

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
            LP+A IPL LC +HM+YLA+K    ++LR        L +K F +++ FWKLD+ G+L 
Sbjct: 237 CLPVATIPLVLCFIHMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLS 296

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           +    G +L P TLAGG   EW+ A +IVP ++G+   +P++  WE + + HP+ P D+ 
Sbjct: 297 LMIILGLILTPLTLAGGETAEWRTAKVIVPLILGF-CWIPVFAFWENRIATHPIAPTDMF 355

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           +DRGV             WYMQGDY+YT+LVVA+HES+KSATRI +LYSF ++I G  +G
Sbjct: 356 RDRGVYCALGIGILIDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVG 415

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             + KVR+ K FI+FG+  W+V+FG+++ YRG S +H G+I S  LLGFG   FT+  QA
Sbjct: 416 LAISKVRKMKCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQA 475

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           S+QA    H RMA +T+LY  +Y I            WT +LP EI KR ++ TLA  AY
Sbjct: 476 SLQAYV-NHERMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAY 534

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
            +P +FI  YTWGTP R+ LV +YR+VQK+L I+G+ FC P+LG A  LR     D + +
Sbjct: 535 SAPLSFIKKYTWGTPLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLR-----DPVLI 589

Query: 591 EGNDHLESKNDNEIVE 606
              + ++++ D E+ E
Sbjct: 590 SAQNIVDAE-DKEVKE 604

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  526 bits (1356), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 276/586 (47%), Positives = 382/586 (65%), Gaps = 28/586 (4%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI  E Y +  ++A L  S F+  Y YGLDG IRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IKQTEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 123 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILIL +I SDFS+L WRLL  F P  PFI+NTWI+G++TS      NW W IGMWAF
Sbjct: 183 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAF 242

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSF--------SIDIVFWKL 283
           I PL+CIP+ LCMLHM+++ARK       PE+  L   D KS+         ++ +FWKL
Sbjct: 243 IFPLSCIPIVLCMLHMQWIARK------TPEWHALK--DEKSYYQEHGFVKVLEQLFWKL 294

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D+IG+LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  VWE + +R P
Sbjct: 295 DVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYRVARDP 353

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           + P+ L+KDRGV             +YM  DY+YTV++VAV+ESIKSATRI+ L SFVSV
Sbjct: 354 IIPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSV 413

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +     G I+ +  R KPFI+FG   W+++ GLL  YRG   +H+GIIG+LC+ G G   
Sbjct: 414 VASPFFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTL 473

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D 
Sbjct: 474 FTYPVTVSVQ-SAVSHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDV 532

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
           TLA  AY SP+TFI TYTWGTP+R+ALV +Y+YVQ++  I+ LVFC PL+  +  LR+ K
Sbjct: 533 TLATAAYTSPYTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPK 592

Query: 584 LTDSIALEG---NDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKK 626
           LTD++A+E     +++++K+++ I++  +     +F ++F+S +K+
Sbjct: 593 LTDTVAVENIEEGEYVDTKDNDPILDWFK-----KFTSKFSSSKKE 633

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  520 bits (1338), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 250/551 (45%), Positives = 365/551 (66%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV NIEIY+E Y+ P+ R  LF SIFL+ Y+Y LD  +R TF+  AT+S+S+HSL+S VN
Sbjct: 38  GVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSFVN 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           C   +++A+G++FFAR +DIFGR SI  I ++FY VGTII + +  I++FA G C Y  G
Sbjct: 98  CFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYSFG 157

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFI 232
            +G+ ++++++ SDFS+LNWRL+A  +P LP ++N W SG + S    NW+WGIGM+A I
Sbjct: 158 ESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPNVINAWASGTIVSDFSDNWQWGIGMFAII 217

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVT 292
           +P+ACIPL +C+ HMRY+A+K+ K++L+  + + N L W  F  + +FW+LDL+GL+ + 
Sbjct: 218 VPVACIPLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLITLG 277

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           A  GC+LVPFTL     ++W  A  IVPEVIGW V LPLY+VWE  Y+++PLTP  LI+D
Sbjct: 278 ASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLRLIRD 337

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFI 412
           RGV             + M+ +YM TVL VA + +  +ATRI   Y FVSV+   ILGF 
Sbjct: 338 RGVYAALVAVFLYEFIYVMEANYMVTVLQVAFNNTSAAATRINNSYEFVSVLTAFILGFF 397

Query: 413 LIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASI 472
           ++ +R+TK  ILFG + + VS+GL + YRG  G +AG I +LC+ GF  G   Y T+ S+
Sbjct: 398 VVFIRKTKRLILFGGTLFFVSYGLFIRYRGGHGCYAGSIAALCVFGFANGFIKYPTRTSL 457

Query: 473 QASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGS 532
           QASAG+H RMA++T+L+ A  ++            W+ ++P  +S RIS+  +AA+AY S
Sbjct: 458 QASAGSHKRMAMITALFTAIGSVGKAMAAAIAGAIWSGLMPGALSSRISNSKVAAKAYSS 517

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEG 592
           P T I TY W +  R  ++ +YRYV K+L I+ +  C PLL  + +LR+ +L + +A + 
Sbjct: 518 PLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIVAICLCVPLLIASFLLRDRRLENKVAYDS 577

Query: 593 NDHLESKNDNE 603
           +    S  D E
Sbjct: 578 DSDDPSVLDEE 588

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  520 bits (1338), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 264/558 (47%), Positives = 365/558 (65%), Gaps = 7/558 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI AE Y +  Y A L F+ F+  Y YGLDG  RY +  YATSSY+QHSLLST+N 
Sbjct: 75  IRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSLLSTINV 134

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARLSD++GRF++  +S++ YSVGTII+SQA  + R+A G  FY  G 
Sbjct: 135 INAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGY 194

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVIL+L +I SDFS+L WRL+  FVP  PFI+NTWISG+VTS      NW W IGMWAF
Sbjct: 195 VGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWDIGMWAF 254

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+C+PL   M+HM +LARK  + +   + +T         +I  +FWK+D +G+ ++
Sbjct: 255 IFPLSCVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVELFWKIDAMGVFIM 314

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           T   GC+LVP TLAGG K +W  +H+I P V+G+V+ +P+ ++WE K++R P+ P+ L+K
Sbjct: 315 TISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVL-IPILVLWEYKFARDPIIPYKLVK 373

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRGV             +YM  DY+YTVL+V V+ES+KSATRI++L +FVS +   I   
Sbjct: 374 DRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTVGSPIFSL 433

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KPFI+ G   W+++ GLL HYRG + +H+GIIG+LC+ G G   FTY    S
Sbjct: 434 LITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVS 493

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +QA A +H  MA VT+L    Y I            WT  L K++ KR+ D  LA EAY 
Sbjct: 494 VQA-ATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAALATEAYA 552

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
           SP+ FI TYTW TPER A+V +YRYVQ++  I+ LVFC PLL  +  LR+ +LTD +A +
Sbjct: 553 SPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARLTDKVAHD 612

Query: 592 G---NDHLESKNDNEIVE 606
                +++++K+D+ I E
Sbjct: 613 NIAEGEYVDAKDDDPIYE 630

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  518 bits (1335), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 268/577 (46%), Positives = 368/577 (63%), Gaps = 12/577 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ ++ Y +   +A L FS F+  Y YGLDG IRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IRKTELLSKSYDKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSDI+GR S+LV++++ Y+VGTII+ QA  + R+A G  FY  G 
Sbjct: 123 INAVVSAASQIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILIL +I SDFS+L WRL   FVP  PFI+NTWISG++T       +W W IGMWAF
Sbjct: 183 VGVILILLLILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAF 242

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           I PL+C+P+  CM+HM +  R   +  +L+ E        WK  ++  +FWKLD++G+LL
Sbjct: 243 IFPLSCVPILCCMIHMHWRVRNDPEWKELQGEKTYFQIHGWK-VTLKTLFWKLDVVGVLL 301

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           + A  GC+LVP TLAGG+  +W  ++II P V+G+V+ +P++  WE +++ +PL P+ L+
Sbjct: 302 MVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVL-IPIFSYWEARWATNPLVPYKLV 360

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRGV             +YM  DY+YTVL+VAVHES+KSATRI++L SFVS +   I+ 
Sbjct: 361 KDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVA 420

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
             L +V R KP I+ G S W+++ GLL H+RG   +H+GIIG+LC+ G G   FTY    
Sbjct: 421 LALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYPVTV 480

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAY 530
           S+QA A  H  MA VT+L    Y I            WT  L K++ KRI +  LA +AY
Sbjct: 481 SVQA-ATNHDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSELATKAY 539

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
            SP+TFITTYTWGTPER A+V +YRYVQ++  I+ +VFC PL+  +  LR+ KLTD +A 
Sbjct: 540 ASPYTFITTYTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKLTDEVA- 598

Query: 591 EGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
                 E  ++ E +EK        F A+   K K  
Sbjct: 599 -----HEDISEGEYIEKASGDPIGEFFAKLFKKTKNK 630

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 272/585 (46%), Positives = 377/585 (64%), Gaps = 28/585 (4%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI    Y++   +A L FS F+  Y YGLDG IRY +  YATSSYS+HSLLST+N 
Sbjct: 62  IKQTEIIGTAYNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINV 121

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 122 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 181

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILIL +I SDFS+L WRLL  F P  PFI+NTWI+G++TS      NW W +GMWAF
Sbjct: 182 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 241

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFS--------IDIVFWKL 283
           I PL+CIP+ LCMLHM++ A K       PE++ L     KS+         ++ +FWKL
Sbjct: 242 IFPLSCIPIVLCMLHMQWRAGK------TPEWQELKGQ--KSYYQEHGLMKILEQLFWKL 293

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D+IG+LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  VWE  Y+R P
Sbjct: 294 DVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWVWEYSYARDP 352

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           + P+ L+KDRGV             +YM  DY+YTV++VAV+ESIKSATRI+ L SFVSV
Sbjct: 353 ILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSV 412

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +     G ++ +  R KPFI+ G S W+++ GLL  +RG S +H+GIIG+LC+ G G   
Sbjct: 413 VASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTL 472

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D 
Sbjct: 473 FTYPVTVSVQ-SAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDV 531

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
            LAA AY SP+ FI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ +
Sbjct: 532 ALAASAYDSPYVFIETYTWGTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPR 591

Query: 584 LTDSIALEG---NDHLESKNDNEIVEKEETSLRTRFLAQFTSKEK 625
           LTD++A+E     +++++K+ + I+E  E     +  ++FTSK+ 
Sbjct: 592 LTDTVAVENIKDGEYVDTKDSDPILEWFE-----KIPSKFTSKQD 631

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 268/585 (45%), Positives = 374/585 (63%), Gaps = 28/585 (4%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI+   Y++   +  L  S F+  Y YGLDG IRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIFGAAYNKWYLQVFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILIL +I SDFS+L WRLL  F P  PFI+NTWI+G++TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFS--------IDIVFWKL 283
           I PL+CIP+ LCMLHM++ A+K       PE+ TL     KS+         I  +FW L
Sbjct: 238 IFPLSCIPIVLCMLHMQWRAKK------TPEWHTLKGQ--KSYYQEHGFIKIIKQLFWML 289

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D+IG+LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE +++R P
Sbjct: 290 DIIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPVLWIWEYRFARDP 348

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           + P+ L+KDR V             +YM  DY+YTV++VAV+ES+KSATRI+ L SFVS 
Sbjct: 349 ILPYKLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVST 408

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +       ++ +  R KPFI+FG S W+V+ GLL H+RG S +H+GIIG+L + G G   
Sbjct: 409 VASPFFALLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTL 468

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D 
Sbjct: 469 FTYPVTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDV 527

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
            LA  AY SP+TFI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ K
Sbjct: 528 ALATAAYDSPYTFIETYTWGTPQRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPK 587

Query: 584 LTDSIA---LEGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEK 625
           LT+++A   +E  +++++K+++ I+E  E     +  ++FTSK  
Sbjct: 588 LTNAVAVEYIEDGEYVDTKDNDPILEWFE-----KIPSKFTSKRD 627

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  508 bits (1308), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 266/585 (45%), Positives = 373/585 (63%), Gaps = 28/585 (4%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI    Y++   +A L  S F+  Y YGLDG IRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIIGSAYNKWYLQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + + +VI Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILIL +I SDFS+L WRLL  FVP  PFI+NTWI+G++TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFS--------IDIVFWKL 283
           I PL+C+P+ LCMLHM++ ARK       PE+  L     KS+         +  +FW L
Sbjct: 238 IFPLSCVPIVLCMLHMQWRARK------TPEWHALKGQ--KSYYQEHGFIKILKQLFWML 289

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D++G+LL+    GC+LVP TLAGG+K  W  + +I P V+G+V+ +P+  +WE +++R P
Sbjct: 290 DVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVL-IPILWIWEYRFARDP 348

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           + P+ L+KDR V             +YM  DY+YTV++VAV+ES+KSATRI  L SFVS 
Sbjct: 349 ILPYRLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVST 408

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +       ++ +  R KPFI+FG + W+V+ GLL H+RG S +H+GIIG+LC+ G G   
Sbjct: 409 VASPFFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTL 468

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D 
Sbjct: 469 FTYPVTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDV 527

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
            LA  AY SP+TFI TYTWGTP+R AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ K
Sbjct: 528 ALATTAYESPYTFIETYTWGTPQRNALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPK 587

Query: 584 LTDSIA---LEGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEK 625
           LTD++A   +E  +++++K+++ I++  E     +  ++FT K +
Sbjct: 588 LTDTVAVEYIEDGEYVDTKDNDPILDWFE-----KLPSKFTFKRE 627

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  500 bits (1287), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 266/583 (45%), Positives = 367/583 (62%), Gaps = 17/583 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  E+ A  Y +  Y   L  S F+  Y YGLDG IRY +  YATSSY++HSLLSTV  
Sbjct: 54  IKQTEVMASVYDKWYYHVVLLVSAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTV 113

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI ++RLSD FGRF + VI+++ Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 114 INAVVSAASQIVYSRLSDFFGRFILFVIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGY 173

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV+LIL +I SDFS+L WRL   F P  PFI+NTWISG++T A     +W W +GMWAF
Sbjct: 174 VGVLLILLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITLAANPLVHWSWDVGMWAF 233

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+CIP+ LCM+HM++ A K  + K   + ++         ++  +FW+LD+IG+LL+
Sbjct: 234 IFPLSCIPMLLCMIHMQWKASKTEEWKELKKEKSYYEKHGLLLTLKELFWRLDIIGVLLM 293

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            A+ GC+LVP TLAGG+K +W    II P V+G+V+ +P++  WE  ++R PL P+ LIK
Sbjct: 294 VAWLGCILVPLTLAGGVKSKWNDGRIIGPFVLGFVL-VPIFAAWEYFFARDPLIPYALIK 352

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRGV             +YM  DY+YTVL+VAVHES+KSATRI++L SFVS +       
Sbjct: 353 DRGVWASMGISFLIDFIFYMASDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPFFAL 412

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           +L +  R KPFI+ G S W++S GLL H+RG   +H+GIIG+LC+ G G   FTY    S
Sbjct: 413 LLTRCSRLKPFIMVGCSLWMLSMGLLYHFRGGEQSHSGIIGALCVWGIGTTLFTYPVNVS 472

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISD-------PT 524
           +Q SA +H  MA VT++    Y +            WT  L  +I KR+++        T
Sbjct: 473 VQ-SATSHENMATVTAINYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTEVVGATEAVT 531

Query: 525 LAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKL 584
           +A EAY SP+TFIT YTWGTP R A+V SYRY+Q++  I+ LVFC PL+  +  LR+ KL
Sbjct: 532 IATEAYSSPYTFITKYTWGTPVRDAVVESYRYIQRLETIVALVFCVPLIIFSLCLRDAKL 591

Query: 585 TDSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
           TD IA     H E+  + E V KE++ +   +L +   + KK+
Sbjct: 592 TDEIA-----H-ENIKEGEYVSKEDSDVFFDWLKKVFGRSKKS 628

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  499 bits (1285), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 251/558 (44%), Positives = 358/558 (64%), Gaps = 7/558 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI +  Y++   +    F  FL  Y YGLD  IRY +  YATSSYS+HSLLSTV  
Sbjct: 51  IKKAEIISASYAKWYEKLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTV 110

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD FGRF + V++++ YS+GTII+ QA  + R+A G  FY  G 
Sbjct: 111 INAVVSAASQIVYARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGY 170

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVIL+L +I SD S L WRL   FVP  P+I+NTWISG++TSA     NW W +GMWAF
Sbjct: 171 VGVILVLLLILSDMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAF 230

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+C+P+  CM+HM++ ARK  + K     +T         S+  +FWK+D+IG+LL+
Sbjct: 231 IFPLSCLPILACMIHMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLFWKIDIIGVLLM 290

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            A  GC+LVP TLAGG   +W+ + II   V+G+V+ +P++ +WE K++  P+ P+ L+K
Sbjct: 291 AASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVL-IPIFFIWEKKFATDPIVPYKLVK 349

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRGV             +YM  DY+YTVL+VAV+ES+ +ATRI++LYSFVS +    +  
Sbjct: 350 DRGVWASLGISFLIDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSL 409

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            L +  R KPFI+FG   W ++ GLL H+RG + +H+GIIG LC+ G G+  FTY    S
Sbjct: 410 ALTRFTRLKPFIIFGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVS 469

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +QA A +H +MA V++L    Y I            WT  L K++   + D TLA  AYG
Sbjct: 470 VQA-AVSHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYG 528

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA-- 589
           SP+TFI TYTWGTPER A+V +YRY+Q++  ++ LVFC PL+  +  LR+ +LTD++A  
Sbjct: 529 SPYTFIVTYTWGTPEREAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAHD 588

Query: 590 -LEGNDHLESKNDNEIVE 606
            +   + +++K+D+ + E
Sbjct: 589 DMSSGEFIDTKSDDPLAE 606

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  495 bits (1274), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 256/558 (45%), Positives = 352/558 (63%), Gaps = 7/558 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI    Y +  Y   L FS F+  Y YGLDG IRY +  YATSSY++HSLLST+N 
Sbjct: 96  IRETEIMKSVYDKWYYHVILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINV 155

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V +A  QI +AR SD+FGR S+ ++SV+FY+VGTII+ QA  + R+  G  FY +G 
Sbjct: 156 INAVASAASQIVYARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGY 215

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVIL+L +I SDFS+L WRL   F P  P+I+NTWISG++TSA     +W W IGMWAF
Sbjct: 216 VGVILVLLLILSDFSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAF 275

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+ IP+ LC++HMR++A K  + KL  + ++         +I  +FW+LD+IG+LL+
Sbjct: 276 IFPLSSIPIILCLIHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDLFWRLDVIGVLLM 335

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            A  GC+LVP TLAGG   +W   +II P  +G+V+ +P++  WE K+S+ PL P  L+K
Sbjct: 336 GASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVL-IPIFTFWEWKFSKSPLIPSKLVK 394

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DR V             +YM  DY+YTVL+V V+ES+KSATRI++L SFVS +   I   
Sbjct: 395 DRAVWSSMAISFLIDFIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFAL 454

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KPFI+ G + W++S GLL HYRG + +H GII SLC+ G G   FTY    S
Sbjct: 455 LITRFTRLKPFIVAGCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINVS 514

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +QA A +HA MA VT+L    Y I            WT  L K++ KR+ D TLA  AY 
Sbjct: 515 VQA-AVSHADMATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAYS 573

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA-- 589
           SP++FI  YTWGT  R  +V +YRYVQ++  I+ LVF  PLL  +  LR+ +LTD++A  
Sbjct: 574 SPYSFIVNYTWGTTVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVASD 633

Query: 590 -LEGNDHLESKNDNEIVE 606
            +E   H+   + + I +
Sbjct: 634 DIEEGQHINKTDSDPIAD 651

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  478 bits (1229), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 264/581 (45%), Positives = 369/581 (63%), Gaps = 18/581 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI A QY    YR  L F+ F+  Y YGLDG IRY +  YAT++YS+HSLLST+  
Sbjct: 46  IKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGV 105

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           +  VI A  Q+ +ARL+D FGR S+ + +++FY+VGTII+SQA  + R+A G  FY +G 
Sbjct: 106 VNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGY 165

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVIL+L ++ SDFS+L WRLL   VP  PFI+NTWISG++TSA    TNW W IGMWAF
Sbjct: 166 VGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAF 225

Query: 232 ILPLACIPLGLCMLHMRYLARKH----AKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIG 287
           I PL+C+PL  CM+HMR  ARK     A  + +  F+T    D    ++  +FWKLD++G
Sbjct: 226 IFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWD----TLVELFWKLDVVG 281

Query: 288 LLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPW 347
           +LL+ A  GC+LVP TLAGG   +W   HII P V+G+V+ +P+ M WE++++R PL P+
Sbjct: 282 VLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVL-VPILMFWEMRWARDPLVPY 340

Query: 348 DLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGT 407
            LIKDRGV             + +   Y+Y +L+VAV ES+KSATRI++L SFVSV+   
Sbjct: 341 GLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSP 400

Query: 408 ILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYV 467
           I    + + ++ KP+I+ G + W+V  GLL HYRG S AH+GIIG+LC+ G G+  +TY 
Sbjct: 401 IFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYP 460

Query: 468 TQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  +A VT+L    Y I            WT  L K++ KR+ D  LAA
Sbjct: 461 VNISVQ-SATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAA 519

Query: 528 EAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDS 587
            AY SP+TFI +Y WGTP+R A+V +YR+VQ+   I+ LVFC PL+  A  LR+  LTD 
Sbjct: 520 AAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDE 579

Query: 588 IALEGNDHLESKNDNEIVEKEETSLRTRFLAQFTS-KEKKN 627
           +A  G +  E      IV+ +   +   F ++++  +E+K 
Sbjct: 580 VAHSGLEKGE-----YIVKDQTDPISDWFSSKWSRLRERKE 615

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  475 bits (1222), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 252/574 (43%), Positives = 355/574 (61%), Gaps = 19/574 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI A QY++  +   L F+ F+  Y YGLDG IRY +  YATSSY++HSLLSTV  
Sbjct: 57  IRKTEIMAAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTV 116

Query: 114 IKTVIAAVGQIFFARLSDIFGR-FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
           I  V++AV QI+      +FGR + I +++++ YSVGTII+SQA  + R+A G  FY  G
Sbjct: 117 INAVVSAVSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAG 176

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWA 230
            +GV+ IL +I SDFS+L WRL   F P  PFI+NTWISG++TSA     NW W IGM A
Sbjct: 177 YSGVLFILLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRA 236

Query: 231 FILPLACIPLGLCMLHMRYLARKHA--KDKLRPE--FETLNNLDWKSFSIDIVFWKLDLI 286
           FI+PL+C+P   CM+HM + ARK    K+ L+ +  +E  N L W +  +  +FW+LD+ 
Sbjct: 237 FIIPLSCLPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGL-WGT--LVELFWRLDVA 293

Query: 287 GLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTP 346
           GL+L+ +  GC+LVP TLAGG   +W   ++I P ++G+V+ +P + +WE  ++R PL P
Sbjct: 294 GLILMGSSLGCILVPLTLAGGTSSKWNHGNVIGPFILGFVL-IPFFALWEKFFARDPLLP 352

Query: 347 WDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVG 406
             L+KDRGV             +YM  DY+YTVL+VAV ES+KSATRI++L SFVS +  
Sbjct: 353 AKLVKDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVAS 412

Query: 407 TILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTY 466
                 L +  R KP+I+ G S W+++ GLL ++RG   +H+GIIG+LC+ G G   FTY
Sbjct: 413 PFFALYLTRCSRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTY 472

Query: 467 VTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLA 526
               S+QA A +H  MA VT+     Y I            WT  L K++ K + D  LA
Sbjct: 473 PVTVSVQA-AVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALA 531

Query: 527 AEAYGSPFTFITTYTWGT-PERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLT 585
             AY SP+TF T Y WGT PER A+V +YRYVQ++  ++ LVFC PL+  +  LR+ +LT
Sbjct: 532 TAAYSSPYTFTTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLT 591

Query: 586 DSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQ 619
           D +A  GN       + EI+ K ++   + F  +
Sbjct: 592 DEVA-HGN-----IAEGEIIVKSDSDPISEFFVK 619

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  474 bits (1220), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 255/560 (45%), Positives = 353/560 (63%), Gaps = 20/560 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI A QY    YR+ L FS FL  Y YGLDG +RY +  YAT+SY++HSLLST+  
Sbjct: 46  IRKTEILAAQYDTWFYRSILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAV 105

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR  + + +VIFY VGTII+SQA  + R+A G  FY  G 
Sbjct: 106 INAVISAAAQIVYARLADVFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGY 165

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV+L+L +I SDFS+L WRL   FVP  PFI+NTWI+GD+TS      NW W I MWAF
Sbjct: 166 VGVVLVLLLILSDFSSLKWRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAF 225

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSF--------SIDIVFWKL 283
           I PL+ +P+  CMLHMR  ARK       PE++ L+  + KSF        ++  +FWKL
Sbjct: 226 IFPLSALPIICCMLHMRIKARK------TPEWQVLS--EEKSFYQTHGFIQTLVQLFWKL 277

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D+IG+L++T   GC+LVP TLAGG   +W+ + II P V+G+V+ +P+Y+ WE K+++ P
Sbjct: 278 DVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVLGFVL-IPMYIYWESKWAKEP 336

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           + P+ L+KDRGV             +YM  DY+Y VL++ V++S+KSA+RI++L SFVS 
Sbjct: 337 MAPFKLLKDRGVWAALGISFLIDFIFYMAADYLYAVLLIGVNQSVKSASRISSLSSFVST 396

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +       I+ +  R KP+I+ G S W+++ GLL H+RG S +++GI+G+LC+ G G   
Sbjct: 397 VASPFFALIITRSTRLKPYIITGCSLWMLAMGLLYHFRGGSESYSGIVGALCVWGIGTTM 456

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q S  +H  MA VT+L    Y I            WT  L K++  R+ D 
Sbjct: 457 FTYPVNVSVQ-SVTSHENMATVTALNYTLYRIGAAVGAAVSGAIWTQTLYKDLLNRLDDA 515

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
            LA  AY  P++FI T+TW TPER A+V SYRYVQ++  I+ LVF  PLL  +  LR+  
Sbjct: 516 ALAMSAYSEPYSFIITHTWNTPERDAMVQSYRYVQRLETIVALVFTVPLLVFSFFLRDPP 575

Query: 584 LTDSIALEGNDHLESKNDNE 603
           LTD +A +  +  E  N N 
Sbjct: 576 LTDKVAQDNIEEGEYINVNH 595

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  474 bits (1220), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 252/559 (45%), Positives = 353/559 (63%), Gaps = 10/559 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI A+QY    ++A L FS+FL +Y YGLDG +R  +  YAT+SYS HSLLST++ 
Sbjct: 51  LRKTEILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISI 110

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI A  Q+FFARLSD+FGR ++L+++ +FYSVGTII+SQA  + R+A G  FY +GL
Sbjct: 111 INLVIGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGL 170

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV+L + +I SDFS+L WRL   FVP+ PFI+N W+SG+V +A     NW W IGMWAF
Sbjct: 171 VGVVLQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAF 230

Query: 232 ILPLACIPLGLCMLHMRYLARK-HAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           I PL C+PL  C+LHMRY A K  A   L+ E     +       I + FWKLD++G+LL
Sbjct: 231 IFPLTCLPLVCCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQL-FWKLDVVGVLL 289

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           +T   GC+LVP TLAGG+ ++W   H+I P V+G+V+ LP+++VWE K++  P+ P++L+
Sbjct: 290 LTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGFVL-LPIFVVWESKWALDPIAPFELL 348

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDRGV             + M   Y+YT+LV+AV ES  SATRIT++YSF + +      
Sbjct: 349 KDRGVWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFA 408

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470
            ++ + +R KP+I+ G S W+V+ G+L H+R    +  GIIG L L G  +  FTY    
Sbjct: 409 LVVTRSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPVTV 468

Query: 471 SIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPTLAAEA 529
           S+Q S  +H  MA VT+L    Y I            WT +L K++ K ++ D TLA  A
Sbjct: 469 SLQ-SITSHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLATAA 527

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
           YGSPF FI  Y WGTP R A+V SYRYVQK   ++ L+F  P+   +  LR+  LTD  A
Sbjct: 528 YGSPFDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDDQA 587

Query: 590 LEG---NDHLESKNDNEIV 605
            E     +++ +++D+ I+
Sbjct: 588 QENLKEGEYINTEHDDPIL 606

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  474 bits (1219), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/538 (46%), Positives = 338/538 (62%), Gaps = 4/538 (0%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A +Y    +R  L F  F+  Y YGLD  IR+ + +Y T+S+S+HSLLSTVN 
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR ++ + +V+FYS+GT+I+SQ+  I  +A G  FY LG 
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV+L+L +I SDFS+L WRL   F P  PFI+NTWISG++TS      NW W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+C+PL  CMLHM + AR+  + K+  E +T          I  +FWKLD IG  ++
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIM 318

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           T   GC+LVP TLAGG   +W  + II P V+G VV LP+ +V+E+K++R P+ PW LIK
Sbjct: 319 TVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLIK 377

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DR V             +YM  DY+YTV++VAV ES+KSATRI++L +FVS +       
Sbjct: 378 DRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFAL 437

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +V R KP+I+ G   W+V+ GLL H+RG   +H+GIIG LC+ G G   FTY    S
Sbjct: 438 YITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVS 497

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q SA +H  MA VTSL    Y I            WT  L  EI KR+ D  +A+ AY 
Sbjct: 498 VQ-SATSHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYE 556

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
            P+ FI  YTWGTP R  +V +Y +VQK+  ++GLVFC PLL  +  LR+ +LTD IA
Sbjct: 557 QPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIA 614

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  465 bits (1196), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 238/559 (42%), Positives = 338/559 (60%), Gaps = 8/559 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI AEQYS   +R  L FS FL  Y YGLDG +R  +  +AT+SYS HSLLST+  
Sbjct: 64  IRKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGV 123

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           +  V+ A  QI +ARLSD++GRF++ V +++FY VGTIIESQA  + R+A G  FY +G 
Sbjct: 124 VNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGY 183

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GVILI+ +I SDFS+L WRL   FVP  PFI+NTWISG++        NW W I MWAF
Sbjct: 184 VGVILIVLLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWDIAMWAF 243

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+C+PL  CMLHM++ AR+    K     +T         S+  +FWKLD+IG+  +
Sbjct: 244 IFPLSCLPLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLDVIGVFFM 303

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
               GC+LVP TLAGG+  +W   HII P ++G+V+ +P ++ WE K++R P+ P+ L++
Sbjct: 304 IIILGCILVPLTLAGGISNKWNNPHIIAPFILGFVL-IPFFIAWESKWAREPIAPFKLLR 362

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+L+VAV+ES+ SATRI+++ +F S +       
Sbjct: 363 DRGIWAALCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFAL 422

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPFI+ G S W+V+ G+L H+R    +  GIIG+L + G G   FTY    S
Sbjct: 423 FITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGLGTTMFTYPVTVS 482

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPTLAAEAY 530
           +Q S  +H  MA VT+L    Y I            WT +L K++ + +  D TLAA  Y
Sbjct: 483 LQ-SVTSHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQHLDGDATLAASFY 541

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590
           GSP T+I  Y WGTP R  +V +YRYVQK   ++ LVF  PL   +  LR+  LT+ +A 
Sbjct: 542 GSPLTYIAQYPWGTPVRDGVVQAYRYVQKYEVLVALVFTAPLFVFSLCLRDPPLTNEVAH 601

Query: 591 EG---NDHLESKNDNEIVE 606
           E     ++++ ++D+ +  
Sbjct: 602 ENIKQGEYVDVEDDDPVAN 620

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  455 bits (1170), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 345/578 (59%), Gaps = 11/578 (1%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
            +R  E+ A  Y R  +   L F+ FL  Y YGLDG IR  + +YA +SY+ H L+ST++
Sbjct: 40  NIRKTELMASCYDRWYHHVFLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLS 99

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
            +  V++A  QIFFARLSD+FGR S+ V ++ FY VGTII+SQA  I R+AVG  F+ +G
Sbjct: 100 VVTGVMSAASQIFFARLSDVFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIG 159

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVT--SAIGTNWKWGIGMWA 230
             G++L+L +I SDFS+L WRLL  F P+ P I+NTWI+G +T  S     W W IGMWA
Sbjct: 160 YVGILLMLILIVSDFSSLRWRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWA 219

Query: 231 FILPLACIPLGLCMLHMRYLARKHAK-DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLL 289
           FI+PL C+P+ LCMLHMR+ AR+  +  +LR E             I++ FWK+D++G+L
Sbjct: 220 FIIPLTCLPMILCMLHMRFKARRTEQWAELRNERSYYQTHGLIKTLIEL-FWKVDVVGIL 278

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDL 349
           L+TA  GCVL P TLAGG   +W+   +I P V+G+V+ LP++++WE K++R P+ P+DL
Sbjct: 279 LMTASIGCVLAPLTLAGGTGSKWQNPRVISPFVLGFVL-LPIFLIWEKKWARDPIIPYDL 337

Query: 350 IKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTIL 409
           IKDR V             + M   Y+Y +L+V V+ESIKSAT IT L SFV+       
Sbjct: 338 IKDRAVWASLNSQFLIGFIYMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPF 397

Query: 410 GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQ 469
              + +  R K +I+ G   W+++ GL  HYRG   AH GI+ ++ + G G     Y   
Sbjct: 398 CLWITRCTRMKGYIVAGCGLWMLAMGLFYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPIT 457

Query: 470 ASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEA 529
            S+Q SA +H  MA+VT+L   TY I            WT  L KE+ KR+ D TLA  A
Sbjct: 458 VSVQ-SATSHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSA 516

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
           Y  PF FITTYTWGTPER A+V +YR+VQ+   I+ LVF  PLL     LR+  LTD +A
Sbjct: 517 YSDPFKFITTYTWGTPEREAVVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVA 576

Query: 590 LEGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
                H   K+   + +  E  + + F   +     KN
Sbjct: 577 -----HGSIKDGEYVAKDHEDPIFSWFAGGWKRLVHKN 609

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  453 bits (1165), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 240/575 (41%), Positives = 347/575 (60%), Gaps = 17/575 (2%)

Query: 47  IELIDPG----------VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQA 96
           +E + PG          +R  EI A QY R  + A + FS F+  Y YGLDG +RY + +
Sbjct: 21  VEKVTPGCTLKTTKSLVIRKTEIMAAQYDRWYHHAIILFSAFICGYGYGLDGSVRYVYTS 80

Query: 97  YATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQA 156
           YA SSYS H L+ST+  +  +I+A  QI FARLSD+FGR S+ + +++FY+VGTII+SQA
Sbjct: 81  YAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLFYAVGTIIQSQA 140

Query: 157 VTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTS 216
             + ++A G  F+  G  G++LIL +I SDFS+L WRL+  F P+ P+I+NTW +G VT+
Sbjct: 141 TDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYIINTWFAGTVTA 200

Query: 217 AIG--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSF 274
                 +W W I MWAFI+PL+ +P+  CMLHMR+ ARK  +     + ++         
Sbjct: 201 RANPQEHWSWDIAMWAFIVPLSALPMIFCMLHMRFKARKTEQWAAIKDEKSFFQSHGLIR 260

Query: 275 SIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMV 334
           ++  +FWKLD++G+LL+T   GC+L P TLAGG+K +W   H+I P V+G+V+ LPL+M+
Sbjct: 261 TLVELFWKLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPHLIGPLVLGFVL-LPLFMI 319

Query: 335 WEVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRI 394
           WE K +++P+ P+ LIKDR V             +     Y+YT+L+VAV+ES+KSAT I
Sbjct: 320 WESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGYIYTILIVAVNESVKSATVI 379

Query: 395 TALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSL 454
           ++L SFVS +  T     + +  + K +I+ G   W+++ GL  HYRG   AH+GI+G++
Sbjct: 380 SSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFYHYRGGEFAHSGIVGAM 439

Query: 455 CLLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPK 514
            + G G     Y T  S+Q SA +H  MA VT+L    Y I            W+  L K
Sbjct: 440 VIWGLGDTLLIYPTTISVQ-SATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLYK 498

Query: 515 EISKRISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLG 574
            +  R+     A+ AY +PF FI TYTWGTPER A+V +YR+VQ+   I+ LVF  PLL 
Sbjct: 499 ALLSRLQSVEQASAAYSTPFEFILTYTWGTPERNAMVDAYRHVQRYESIVALVFTVPLLF 558

Query: 575 CACMLRNHKLTDSIALEGNDH---LESKNDNEIVE 606
               LR+  LTD +A E  D    L+  +D+ I E
Sbjct: 559 FGLCLRDPPLTDKVAQEDIDDGEFLDKNHDDPIAE 593

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  447 bits (1149), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 236/557 (42%), Positives = 340/557 (61%), Gaps = 6/557 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A+QY     ++   FS FL ++ YGLDG IR  +  YA +SYS HSL+STV  
Sbjct: 54  IRKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGV 113

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI+AV Q+ +A LSD+FGR S+ ++S++FY VGTII+SQA  + R+A G  FY +GL
Sbjct: 114 ISMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGL 173

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDV--TSAIGTNWKWGIGMWAF 231
            GV+L + ++ SD S+L WRL   FVPA P I+ TW+SG+V  T+    NW W I MWAF
Sbjct: 174 VGVMLQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAF 233

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+CIPL  CMLHMR+  R   + K     +T         ++  +FWKLD++G++L+
Sbjct: 234 IFPLSCIPLIACMLHMRWKVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDVVGIILL 293

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           T   GC+LVP TLAGG+  +W++A +I P V+G+V+ + +++ WE K +  P+ P+ ++K
Sbjct: 294 TVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVL-IAIFIYWESKLALAPIAPFKMLK 352

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+L+VAV E+  SATRIT+LYSFVS I   +LGF
Sbjct: 353 DRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPVLGF 412

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           I+ +  R KP+++ G S + V+ GL   YR    AH G+IG++ + G  +  F Y    S
Sbjct: 413 IVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFDYPVTVS 472

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           IQ S  +H  MA VT+L    ++I            WT +L  ++ + I D  LA  AY 
Sbjct: 473 IQ-SVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADLAEAAYS 531

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
           SP TF   Y WGTP R A+V +Y++VQK   +I LVF  P+      LR+  LTD +A +
Sbjct: 532 SPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLTDDVAQK 591

Query: 592 GND--HLESKNDNEIVE 606
            ND  ++E+ +D+ I E
Sbjct: 592 LNDGEYVETSHDDPISE 608

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  445 bits (1145), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 245/549 (44%), Positives = 338/549 (61%), Gaps = 20/549 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  EI A QY    YR  L FS F+  + YGLD  IRY +  YATSSY+QHSLLSTV  
Sbjct: 47  IRKTEILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAI 106

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  +++A  QIF+ARLSD+FGR S+ V+S++FY +GTII+SQA  + ++A G  FY +G 
Sbjct: 107 INNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGY 166

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ LIL +I SD S+L WRL   + P  PFI+ TWISG++ S      NW WGIGMWAF
Sbjct: 167 VGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAF 226

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSF--------SIDIVFWKL 283
           I PL C+P+  CMLHMR+ ARK       PE++ L++   KSF        ++  +FWKL
Sbjct: 227 IFPLTCLPILFCMLHMRFKARK------TPEWQDLSSQ--KSFFQTHGIVQALVQLFWKL 278

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D++G+ ++T   GC+LVP TLAGG   +W+ + II P V+G+V+ +P+++ WE K+++ P
Sbjct: 279 DVVGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVL-VPVFIYWESKWAKDP 337

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           L P++L+KDRG+             + M   Y+Y VL+VAV ES KSATRIT+L SFVS 
Sbjct: 338 LAPFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVST 397

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGS 463
           +    +G+ + +  R KP+I+ G   W ++ GLL HYR    +H+GIIG L LLG G   
Sbjct: 398 VASPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTL 457

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
             Y    S Q S  +H  MA VT+L    Y I            WT  L  ++ KR+ D 
Sbjct: 458 SIYPINVSAQ-SLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRLGDA 516

Query: 524 TLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHK 583
           TLA  AY +P++F+ TY W TP R A+V +YR VQ++  +I L+F  PLL  +  LR+  
Sbjct: 517 TLAMSAYSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLFLRDPP 576

Query: 584 LTDSIALEG 592
           LTD +  E 
Sbjct: 577 LTDQVGQEN 585

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  439 bits (1130), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/576 (40%), Positives = 341/576 (59%), Gaps = 11/576 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A+QY     ++    + F+ ++AYGLD  IR  +  YA   Y++HSLLSTVN 
Sbjct: 53  IRKSELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           +  +I+AVGQIFFA LSD+FGR S+ V+++IFY VGTII+SQA  + R+  G  FY +GL
Sbjct: 113 VSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGL 172

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDV--TSAIGTNWKWGIGMWAF 231
            G I  + +I SD S+L WRL   FVPA P  V  WISG+V   +    NW WGIGMW F
Sbjct: 173 VGAIFQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P +C+PL  CMLHMR+  +   + K   E ++         S+  +FWKLD+ G+LL+
Sbjct: 233 IFPASCLPLIACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLL 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           TA  GC+LVP T+AGG+  +W++A +I P V+G+ + +P+++ WE + +  PL P+ ++K
Sbjct: 293 TACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFAL-VPVFLYWESRIALVPLAPFKMLK 351

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YTVL+VA +ES  SATRIT+LYSFV+ I   ILG 
Sbjct: 352 DRGIWAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGV 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ L G S + V+ GL  HYRG   A  GIIG++ + G  +  + Y    S
Sbjct: 412 LVARSTRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISIS 471

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+L L  + I            WT  L  ++ K + DP +AA+AY 
Sbjct: 472 MQ-TVTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAYD 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P TFI  Y WGT  R A V +YRYVQK   ++GL+F  P+      LR+  LT+    E
Sbjct: 531 EPLTFIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTE----E 586

Query: 592 GNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
              +LE   D+E V++ +  +    + +F+  +K+ 
Sbjct: 587 YGQNLE---DDEYVKENDDPINDWIMERFSRLKKQE 619

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  427 bits (1097), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 233/578 (40%), Positives = 345/578 (59%), Gaps = 16/578 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSI-FLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           +R  EI A QY+   Y   LF S  FL AY Y LD  IRY +  YAT+SY+ HSLLST++
Sbjct: 57  IRKTEIMASQYNT-WYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTIS 115

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
            I  +I+AV Q+FFA LSD+FGR  +++++++FY VGT+I+SQA  I R+A G  FY +G
Sbjct: 116 IINMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIG 175

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWA 230
           + GV+L + +  +D S+L WRLL  FVPA P I+N W+SG++  A     NW W I MWA
Sbjct: 176 VVGVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWA 235

Query: 231 FILPLACIPLGLCMLHMRYLARKHAK-DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLL 289
           FILPL+C+PL  C++HMR+ A K  +  +L  E  T         +I  VFWK+D++GLL
Sbjct: 236 FILPLSCVPLLCCVVHMRWKASKTPEWQELESEL-TFYQKHGFVHTIVEVFWKVDIVGLL 294

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDL 349
           L+TA  GC+LVP T+AGG+ E+W    II P V+G V  +PL + WE  +++ P  P+ L
Sbjct: 295 LLTASMGCILVPLTIAGGISEQWNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLL 353

Query: 350 IKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTIL 409
           +KDRG+             + M   Y+YT+L+V+++++  SATRI  LYSFV+ I   I 
Sbjct: 354 LKDRGIWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIF 413

Query: 410 GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQ 469
           GF++ +  R K F+L G   + +  GL   YRG  GA +GIIG++ + G  +  +TY   
Sbjct: 414 GFVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVT 473

Query: 470 ASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEA 529
            S Q S  +H  MA VT++ L  + I            WTN+L  ++ + + D  LA+ A
Sbjct: 474 TSAQ-SVTSHENMATVTAMLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAA 532

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
           Y +P TFI ++ W T  R A++ +YR+VQK   ++GL+F  P+L     LR+ +LTD   
Sbjct: 533 YTAPLTFIVSHPWNTEVRTAMIDAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTD--- 589

Query: 590 LEGNDHLESKNDNEIVEKE-ETSLRTRFLAQFTSKEKK 626
               D+ +   + + V+ E E  +   F  +F   +++
Sbjct: 590 ----DYGQKLAEGQCVQTEGEDPIAEWFSDRFKKLKRR 623

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  426 bits (1096), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/555 (40%), Positives = 325/555 (58%), Gaps = 4/555 (0%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A QY   + ++   FS F+ +++YGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 55  IRKSELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR SI +++++FY VGTII+SQA  + R+A G  FY +GL
Sbjct: 115 ISMTISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRL   FVPA P +V  WISGDV +      NW WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P  C+P+  C+LHMR+  +   + K   E +T         ++  +FWKLD +G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDAVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           +   GC+LVP T+AGG+  +W++A II P V+G V+ L +++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M  DY+YT+L+VA +ES  SATRIT+LYSFV+ ++    G 
Sbjct: 354 DRGIWAPLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAAGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KPF  FG + + V+  L   +RG      G+IG++ + G  +  F Y    S
Sbjct: 414 LVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFDYPINIS 473

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+L LA + I            WT  L   + K + DP +A EAY 
Sbjct: 474 MQ-TVTSHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDMAIEAYD 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P +F+  + WGTP R A+V SYRYVQK   ++GLVF  P+      LR+  LT+     
Sbjct: 533 MPLSFMLEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLTEDYGQR 592

Query: 592 GNDHLESKNDNEIVE 606
             D+   K+D+ I +
Sbjct: 593 LEDNEYVKHDDPITD 607

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  425 bits (1093), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 226/576 (39%), Positives = 340/576 (59%), Gaps = 13/576 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A QY     ++   FS F+ A++YGLD  IR  +  YA +SYS HSLLSTV+ 
Sbjct: 53  IRKTELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY VGTII+SQA  + R+A G  FY +GL
Sbjct: 113 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGL 172

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + +I SD S+L WRL   FVPA P +V  WISG+V S      NW WGI MWAF
Sbjct: 173 VGSMFEITLILSDCSSLKWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P +C+P+  C+LHMR+  R + +     E +T         ++  +FWKLD++G+LL 
Sbjct: 233 IFPASCLPIIGCLLHMRWKLRNNPEWIELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           +   GC+LVP TLAGG   +W++A +I P V+G+++ +P+++ WE K +  PL P+ ++K
Sbjct: 293 SISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLL-VPVFIYWESKLALVPLAPFKMLK 351

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+LVVA +ES  SATRIT+LYSFV+ +   ++G 
Sbjct: 352 DRGIWAPLVITFLICYIYMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSPVVGI 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 412 FVARFTRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYPINIS 471

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DP +A EAY 
Sbjct: 472 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAIEAYS 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P +F+  + WGT  R  +V +YRYVQ+   ++GL+F  P+      LR+  LT+     
Sbjct: 531 MPLSFVLKHEWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPLTE----- 585

Query: 592 GNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
             D+ +  +DNE +++++    T +LA+  S+ KK+
Sbjct: 586 --DYGQKLDDNEYLKQDDPI--TDWLAERFSRFKKH 617

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  424 bits (1091), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/552 (38%), Positives = 328/552 (59%), Gaps = 6/552 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A+QY     ++   F++F+ ++AYGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 53  IRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  VI+AVGQIFFARLSD+FGR S+ ++S++ Y VGT+I+SQA  + R+A G  FY +GL
Sbjct: 113 ISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGL 172

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + +I SD S L WRL   FVPA P I+  WISG+V        NW WGI MWAF
Sbjct: 173 VGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P++CIP   C+LHMR+  R   + +   E ++         +   +FW+LD++G++L+
Sbjct: 233 IFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILL 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           + F GC+ VP T+AGG+  EW++  +I P V+G+ + +P ++ WE + +R PL P+ ++K
Sbjct: 293 SVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSL-IPAFVYWESRLARFPLAPFLMLK 351

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M  +Y+YT+L+VA +ES  SA RIT+LYSFV+ I   I+G 
Sbjct: 352 DRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGL 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ + G S + V+ GL  HYRG + A  G+IG++ + G  +  + Y    S
Sbjct: 412 LVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPISVS 471

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           IQ +  +H  +A V++L    + I            WT  L  ++ K + D  +A  A+ 
Sbjct: 472 IQ-TVTSHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAAFN 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA-- 589
           SP  FIT Y WGTP R A V +++YVQK   ++GL+F  P+      LR+  L +     
Sbjct: 531 SPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLNEEFGQN 590

Query: 590 LEGNDHLESKND 601
           L G ++++  +D
Sbjct: 591 LNGEEYVKENDD 602

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  424 bits (1091), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/555 (41%), Positives = 325/555 (58%), Gaps = 6/555 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A++Y     +A   FS F+  +AYGLD  IR T+  YA +SYS HSL+STV+ 
Sbjct: 53  IRKSELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  +I+AV Q+ F  LSDIFGR ++ ++S++ Y VGTII+SQA  + R+A G  FY +GL
Sbjct: 113 IVLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGL 172

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV+L + ++ SD S+L WRL    +P+ P I+ TW+SG V  A     NW W I MWAF
Sbjct: 173 VGVMLQVVLMLSDNSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAF 232

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL CIPL LCMLHMR+  R   + K   + ++          +  +FWKLD++G+LL 
Sbjct: 233 IFPLCCIPLILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKLDVVGVLLF 292

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           TA  GC+LVP TLAGG+   W+ + II P V+G+V+ +P ++ WE + +  P  P+ L+K
Sbjct: 293 TAGVGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVL-VPGFIYWESRLALVPFAPFKLLK 351

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRGV             + M   Y+YT+LVVAV ES  SATRI  LYSFV+ +V   LG 
Sbjct: 352 DRGVWAPLGIMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLGL 411

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           I+ +  R K +I+FG S + ++ GL   YR    A  GII  + + G  +  F Y T  S
Sbjct: 412 IVTRSSRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVS 471

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           IQ S  +H  MA VT+L    + I            WT  L  ++   + D  LA  AYG
Sbjct: 472 IQ-SVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAYG 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA-- 589
           SP TFI +  WGTP R A+V +YR+VQK   I+ LVF  P+      +R+ +LT+  A  
Sbjct: 531 SPLTFILSNPWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFAQK 590

Query: 590 LEGNDHLESKNDNEI 604
           L   +++++K D+ I
Sbjct: 591 LPDREYVQTKEDDPI 605

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  424 bits (1090), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 219/555 (39%), Positives = 326/555 (58%), Gaps = 4/555 (0%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A QY   L ++   FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY VGT+I+SQA  + R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  FVPA P +V  WISG+V        NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P  C+P+  C+LHMR+  R +++ K   E +T         ++  +FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    W++A +I P V+G ++ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLL-VPFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+L+VA +ES  SATRIT+LYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA EAY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P +F+  + WGTP R A++ +YRYVQK   ++GL+F  P+      LR+  LT+    +
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 592 GNDHLESKNDNEIVE 606
             D    K+D+ I +
Sbjct: 593 LEDDEYVKHDDPITD 607

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  424 bits (1090), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 219/555 (39%), Positives = 326/555 (58%), Gaps = 4/555 (0%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A QY   L ++   FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ +++++FY VGT+I+SQA  + R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  FVPA P +V  WISG+V        NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P  C+P+  C+LHMR+  R +++ K   E +T         ++  +FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    W++A +I P V+G ++ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLL-VPFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+L+VA +ES  SATRIT+LYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA EAY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P +F+  + WGTP R A++ +YRYVQK   ++GL+F  P+      LR+  LT+    +
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 592 GNDHLESKNDNEIVE 606
             D    K+D+ I +
Sbjct: 593 LEDDEYVKHDDPITD 607

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 227/576 (39%), Positives = 334/576 (57%), Gaps = 13/576 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R  E+ A QY     ++   FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKSELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR SI ++++ FY VGTII+SQA  + R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G +  + ++ SD S+L WRL   FVPA P +V  WISG+V        NW WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAF 234

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I P AC+P+  C+LHMR+  R   + K   E +T         ++  +FWKLD++G+LL 
Sbjct: 235 IFPAACLPIIGCLLHMRWKLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
           +   GC+L+P T+AGG    W++A +I P V+G V+ +P ++ WE K +  PL P+ ++K
Sbjct: 295 SVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVL-VPAFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             + M   Y+YT+L+VA +ES  SATRIT+LYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG      G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPINIS 473

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
           +Q +  +H  MA VT+L L  + I            WT  L   + K + DPT+A EAY 
Sbjct: 474 MQ-TVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEAYN 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALE 591
            P +F+  + WGT  R A+V SYRYVQ+   ++GL+F  P+     +LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPLTE----- 587

Query: 592 GNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
             D+ +   DNE V+ ++    T ++A+  S+ KK+
Sbjct: 588 --DYGQRLEDNEYVKHDDPI--TDWIAERFSRFKKH 619

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  405 bits (1040), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/563 (40%), Positives = 328/563 (58%), Gaps = 17/563 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++ IEI    Y    + A L F  F+ +Y Y LD  +R  ++ YA SSY +HSL+ST+N 
Sbjct: 97  IKEIEIMKSVYDTWYFHALLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINV 156

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I +V +A  Q+ ++R SDIFGR S+L++++I Y VGTII+SQA  I R+  G  FY LG 
Sbjct: 157 IDSVASATSQVVYSRASDIFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGY 216

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV L++ +I SD+S+L WR     + A P I+N WISG +        +W W IGMWAF
Sbjct: 217 VGVSLLMTLILSDYSSLKWRFFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAF 276

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK-DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           I PL+CIP+  C++HM++LA +  +  +L+          +K   ID+ FW+ D++G++L
Sbjct: 277 IFPLSCIPILCCLIHMQWLASQTDEWKQLKKGKSYFKYYGYKDSLIDM-FWRFDVVGVIL 335

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           + AF G +L+P TLAGG K  W    +I P VIG  V +P + +WE  +++HP+ PW LI
Sbjct: 336 LAAFIGLILIPLTLAGGTKSRWSEGKLIAPFVIG-CVMVPCFAIWEKWFAKHPIMPWRLI 394

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           KDR +             + +  DYMY++L+VAV ESIKSAT I  ++SFVS +      
Sbjct: 395 KDRSIWAALTLSLVYKFVFAVAQDYMYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFS 454

Query: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLG-----FGAGSFT 465
           +    V R KPFI  G   +++S GLL +YRG   AH+GIIG+LC++G     F     T
Sbjct: 455 YGTTFVGRLKPFIFLGTLLYMLSLGLLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLT 514

Query: 466 YVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
            +TQAS+ +     A MA VT+L L   NI            WT  L KE+ KR+ + TL
Sbjct: 515 VITQASVSS-----ADMANVTALILTFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTL 569

Query: 526 AAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLT 585
           A +AY SP +FI  Y+WGTP R  +V SYR VQ+   I+ + FC PL+     LR+  L 
Sbjct: 570 AKKAYSSPLSFIANYSWGTPVRNIMVESYRSVQRYEIIVAISFCAPLVLLTFALRDINLN 629

Query: 586 DSI--ALEGNDHLESKNDNEIVE 606
            S    LE   H++  + + I +
Sbjct: 630 RSTDADLEDGKHVKMTDSDPIFD 652

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  397 bits (1021), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/575 (37%), Positives = 326/575 (56%), Gaps = 13/575 (2%)

Query: 58  EIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A Q+  P YRA +  + FL  + Y LD  +R T+  YAT+SY++HSLLST+  I  V
Sbjct: 42  EIIAVQFDTPKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAV 101

Query: 118 IAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVI 177
           ++   Q+ F+RLSD FGR  + V + I Y +GTI++SQA +++ +A G  FY  G  GV 
Sbjct: 102 VSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVT 161

Query: 178 LILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+L  +VP  PFI+  WISG++ +A     +W W I MWAFI PL
Sbjct: 162 LVLLLILSDFSSLKWRILYQYVPYWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPL 221

Query: 236 ACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFF 295
           + +P+   +++M Y + K  + K   E   +        +   +FW+LD IG++L+T   
Sbjct: 222 SALPMICLLVYMMYKSSKTPEWKALKERTHIKKNQGFLKNTVFLFWELDSIGIILITVSL 281

Query: 296 GCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
           GCVLVP TLA G+ ++W ++ II   V G V+   +++ WE  Y+++PL P+ L+ DRG+
Sbjct: 282 GCVLVPLTLANGVSQKWHSSKIIGTLVFGGVL-FCIFVFWETAYAKNPLLPFKLLGDRGI 340

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIK 415
                        +++  D++Y VL+V+++ES  +ATRI  L  FV   +    G ++ K
Sbjct: 341 WAPLGVAFFNYFTFFIACDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPFYGILVAK 400

Query: 416 VRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            RR K  ++ G + W++S GL   YRG S +H G I +  ++G      +     S+QA 
Sbjct: 401 ARRLKFSVVGGCAAWMISMGLFYQYRGGSESHGGAIAASVIMGMSGLLCSNSVIVSLQAM 460

Query: 476 AGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFT 535
             TH RMA++TS+Y     +            WT I+P ++ K  S+ TLA  AY SP+T
Sbjct: 461 T-THGRMAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQLRKAFSNDTLADAAYESPYT 519

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDH 595
           FI  Y WG+PERIA+V +YRYVQ+I+  IGLV   P       +R+ +L D      + H
Sbjct: 520 FIYEYPWGSPERIAVVEAYRYVQRIMMTIGLVCTIPFFAFTLFMRDPELIDK-----STH 574

Query: 596 LESKNDNEIVEKEE----TSLRTRFLAQFTSKEKK 626
            E   D   + K+E      L+  F     ++++K
Sbjct: 575 EEFTEDGLALSKDEPGILPQLKVFFRGNRANRKEK 609

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  385 bits (990), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 272/413 (65%), Gaps = 19/413 (4%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI +  Y +  +   L FS F+  YAYGL+  IRY +  YATSSY++HSLLSTVN 
Sbjct: 49  IKKTEIMSAVYDKWYHHVILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNV 108

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++A  QI ++RLSD FGR ++ +I+++ Y VGTII+SQA  + R+A G  FY  G 
Sbjct: 109 INAVVSAASQIIYSRLSDFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGY 168

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRL   F P  PFI+NTWISG+VTS+     +W W +GMWAF
Sbjct: 169 VGIILILLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAF 228

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSF--------SIDIVFWKL 283
           I PLACIP+  CM+HM++ A K       PE+  L +   KSF        ++  +FWKL
Sbjct: 229 IFPLACIPMIGCMIHMQWKASK------TPEWHALRSE--KSFYQANGFYKTMTELFWKL 280

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHP 343
           D+IG LL TA  GC+LVP TLAGG   +W  + +I P V+G+V+ +P+  VWE K++R P
Sbjct: 281 DIIGTLLFTACLGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVL-IPILGVWEYKWARDP 339

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           L P+ L++DRGV             +YM  DY+YTV+VVAVHES+KSATRI+ L SFVS 
Sbjct: 340 LIPYKLVRDRGVWAALGISFLIDFIFYMAADYLYTVMVVAVHESVKSATRISTLSSFVST 399

Query: 404 IVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCL 456
           +       ++ +  R KPFI+FG S W++S GLL ++RG   +H+GIIG+LC+
Sbjct: 400 VASPFFALLMTRCTRLKPFIIFGCSLWMLSMGLLYNFRGGEQSHSGIIGALCV 452

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  378 bits (971), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/575 (35%), Positives = 317/575 (55%), Gaps = 18/575 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +R +EI  +QY+         F+ FL      L+  +R  +  YAT+SY  HSLLST+  
Sbjct: 65  IRKMEIMRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGV 124

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           + ++I+A     +ARLSD+FGR  + + +++F+ VGTII+SQA  + ++A G  FY LG 
Sbjct: 125 VSSIISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGT 184

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ +++ +I SDFS+L WRL   F P  P +   WI+G +   +     W WGIGMWAF
Sbjct: 185 AGIQVMMFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAF 244

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL+ +P    +L +RY A K  + K+    +T         ++  +FWK+D++GLLL 
Sbjct: 245 IYPLSSVPFVAYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLF 304

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            AF GC+LVP TLAGG+  +W    I+ P ++G+ + +P +++WE KY+R P+ P+ ++K
Sbjct: 305 VAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCL-VPAFILWETKYARLPIAPFKMLK 363

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRG+             +Y+   Y+ T+L+VAV++S   A  I  ++S V         +
Sbjct: 364 DRGIWSALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSY 423

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
            +++VRR KPFI+ G   W+VS GLL +YR    +  GIIG++ L G G+   T  T  S
Sbjct: 424 FVVRVRRLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVIS 483

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYG 531
            Q S   H  MA +T++ LA   I            WT  L  ++ + I DP +A + Y 
Sbjct: 484 SQ-SITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQ 542

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDS---- 587
           SP + I  Y WGTP R A+V +YR+VQ+   ++ ++   PL   +  LR+ +LTD     
Sbjct: 543 SPLSAIRVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVAHT 602

Query: 588 -------IALEGNDHLESKNDNEIVEKEETSLRTR 615
                  IA++GND + +   N+    E   LR R
Sbjct: 603 DIKDGEFIAVDGNDAIANWFSNKW---ENIKLRRR 634

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/544 (38%), Positives = 311/544 (57%), Gaps = 9/544 (1%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           V+ +EI  +  S  L R  L  S FL  +AY LD   R  +  YA +SY +HSLLST+  
Sbjct: 47  VKEMEIIKDVCSGNLARVFLLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQV 106

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I +V+    QI FARLSD+FGR  + V+  I Y VGTII+SQA  +  +AVG  FY  G 
Sbjct: 107 INSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGF 166

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            GV L+L ++ SD S L WRL   F  + P I+ +WISGD+  A     NW W IGMWAF
Sbjct: 167 VGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEAANPMKNWSWDIGMWAF 226

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDK-LRPEFET-LNNLDWKSFSIDIVFWKLDLIGLL 289
           I PL+ +P    + +  +++ K  K K LR + ET   N+      +  +F ++D++G +
Sbjct: 227 IFPLSSLPFITYLFYATHISSKTKKWKDLRNKVETHKRNI---ILVVKDIFNQIDIVGTV 283

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDL 349
           LVTA  G +LVP TLAGG+ E W    II   VIG +  L +++ WE K++++   P++L
Sbjct: 284 LVTAALGLILVPLTLAGGVSERWHEPGIIATLVIG-IALLLVFLFWEAKFAKNAALPFNL 342

Query: 350 IKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTIL 409
           +KDRGV             + M  DY+Y VL+V+V+E+ KSATRI  L +F++ +     
Sbjct: 343 LKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMACLCSVFF 402

Query: 410 GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQ 469
           G +++ V+R K F + G   WI+S GL   +RG   +H+GIIG+  +LGFG+  FT    
Sbjct: 403 GLLVVSVQRLKVFTICGTFLWIISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSII 462

Query: 470 ASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEA 529
            ++QA A +H  MA +T LY     +            WT  + K++ K++ D  L    
Sbjct: 463 VTLQAMA-SHDNMASITGLYFMFAQVGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAV 521

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIA 589
           + SP+ FI +Y WGT ER  ++ +YR+VQK+  ++ L+   PLL      ++ KL+DS++
Sbjct: 522 FASPYEFIASYAWGTKERDLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVS 581

Query: 590 LEGN 593
            + +
Sbjct: 582 SDAS 585

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  370 bits (951), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/579 (35%), Positives = 316/579 (54%), Gaps = 29/579 (5%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI + Q+    Y+  L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  
Sbjct: 43  LKENEIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQV 102

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++   Q+ ++RLSD FGR  + +++ IFY +GTII+SQA  +T +A G  FY  G 
Sbjct: 103 INAVVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGY 162

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G  L+L +I SDFS+L WR+   +    P+I+  WISG++ +A     NW W I MWAF
Sbjct: 163 VGTNLLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAF 222

Query: 232 ILPLACIPLGLCMLHMRYLARKHA-----KDKLRPE-----FETLNNLDWKSFSIDIVFW 281
           I PL+ +P+   +L+M+Y + K A     K++ R E     FE L            +FW
Sbjct: 223 IYPLSTLPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENL----------VFLFW 272

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
           KLD++G+LL+T   GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++
Sbjct: 273 KLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAK 331

Query: 342 HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFV 401
            PL P+ L+ DRG+             +++  DY+Y VL+V++ ES  SA RI  L  FV
Sbjct: 332 SPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFV 391

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGA 461
           +         ++ K R+ K  ++ G + W+V  GL   YRG SG+H G+I +  ++G  +
Sbjct: 392 AATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-S 450

Query: 462 GSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS 521
           G     +   I  +  TH+RMA++T +      +            WT  +P ++ K + 
Sbjct: 451 GLLCSNSVIVILQAMTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLG 510

Query: 522 DPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRN 581
           + TLA  AY SP+TFI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +RN
Sbjct: 511 NDTLAEIAYASPYTFISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRN 570

Query: 582 HKLTDSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQF 620
            +L D        H E   D  +V  +E ++ ++  A F
Sbjct: 571 PELIDKAT-----HEEFTEDGLVVLPDEENIFSQIKALF 604

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  369 bits (948), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/579 (35%), Positives = 316/579 (54%), Gaps = 29/579 (5%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++  EI + Q+    Y+  L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  
Sbjct: 43  LKENEIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQV 102

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++   Q+ ++RLSD FGR  + +++ IFY +GTII+SQA  +T +A G  FY  G 
Sbjct: 103 INAVVSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGY 162

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAF 231
            G  L+L +I SDFS+L WR+   +    P+I+  WISG++ +A     NW W I MWAF
Sbjct: 163 VGTNLLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAF 222

Query: 232 ILPLACIPLGLCMLHMRYLARKHA-----KDKLRPE-----FETLNNLDWKSFSIDIVFW 281
           I PL+ +P+   +L+M+Y + K A     K++ R E     FE L  L          FW
Sbjct: 223 IYPLSALPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFL----------FW 272

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
           KLD++G+LL+T   GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++
Sbjct: 273 KLDIVGILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAK 331

Query: 342 HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFV 401
            PL P+ L+ DRG+             +++  DY+Y VL+V++ ES  SA RI  L  FV
Sbjct: 332 SPLLPFKLLSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFV 391

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGA 461
           +         ++ K R+ K  ++ G + W+V  GL   YRG SG+H G+I +  ++G  +
Sbjct: 392 AATASPFYSLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-S 450

Query: 462 GSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS 521
           G     +   I  +  TH+RMA++T +      +            WT  +P ++ K + 
Sbjct: 451 GLLCSNSVIVILQAMTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLG 510

Query: 522 DPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRN 581
           + TLA  AY SP+TFI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +R+
Sbjct: 511 NDTLAEIAYASPYTFISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRD 570

Query: 582 HKLTDSIALEGNDHLESKNDNEIVEKEETSLRTRFLAQF 620
            +L D        H E   D  +V  +E ++ ++  A F
Sbjct: 571 PELIDKAT-----HEEFTEDGLVVLPDEENIFSQIKALF 604

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  367 bits (943), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/552 (37%), Positives = 310/552 (56%), Gaps = 17/552 (3%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           V+ +EI +   S    RA L  S FL  + Y LD   R  +  YATSSY++H+LLST+  
Sbjct: 61  VKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGYATSSYNEHALLSTIQV 120

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I +VI+   QI FA+LSDIFGR  + ++  + Y VGTII+ +A  I  +AVG  FY  G 
Sbjct: 121 INSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGY 180

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAI--GTNWKWGIGMWAF 231
            GV ++L ++ SD S   WRLL  F  + P I+  WISGD+  +     NW++ IGMWAF
Sbjct: 181 VGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAF 240

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFW------KLDL 285
           + P++ +P    ++ + Y  R+ +K     E +  N    K  S+ IV+W       +D+
Sbjct: 241 LFPISALPF---IIFLLYFTRQASKTAEWKEIQGDN----KEPSVRIVYWIKSIYSNIDV 293

Query: 286 IGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLT 345
           +G  LVT   GC+LVP TLAGG+ ++W    II   V+G+ V+   ++ W++K++++ + 
Sbjct: 294 VGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGF-VSFMFFLAWDIKFAKNAVL 352

Query: 346 PWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIV 405
           P+ L+KDRGV             +    DY+Y VL+V+V+ES KSATRI  L +FV+   
Sbjct: 353 PFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACTG 412

Query: 406 GTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFT 465
               G ++++ +R K + + G+  WI+S GL  HYRG + +H+GIIG+  +LG G+  FT
Sbjct: 413 SIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFT 472

Query: 466 YVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
                ++Q +  +H  MA +T LY     I            WT  + K++ KR+ D +L
Sbjct: 473 QSLIVNLQ-TMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTMYKQLYKRLEDSSL 531

Query: 526 AAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLT 585
           AA A+ SP+ FI  Y WGTPER  ++ +YR VQK   ++ LV   PL       ++ KL 
Sbjct: 532 AATAFSSPYEFIELYPWGTPERTQMIYAYREVQKKTMLVSLVLTGPLFLLILFTKDRKLG 591

Query: 586 DSIALEGNDHLE 597
           D++  E     E
Sbjct: 592 DNVTAETTQSDE 603

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  348 bits (894), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/578 (35%), Positives = 321/578 (55%), Gaps = 14/578 (2%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           ++ +EI +       +++ L  +  +  ++Y LD  +R T+  YAT+S+SQHSLL+T+N 
Sbjct: 64  MKELEIVSSFCKEWHFQSILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINV 123

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I +V++   Q+FFARLSD FGR  +     + Y VGTI++SQ+  ++ +A G  FY  G 
Sbjct: 124 INSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGY 183

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDV--TSAIGTNWKWGIGMWAF 231
           TGV L++ ++ SDFS L WR   +  P   +I+ TW+SG++   S    NW W I MWAF
Sbjct: 184 TGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWAF 243

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I PL  IPL   +++M Y A +  + K   E  ++         I  VFW LD+ G+LL+
Sbjct: 244 IFPLTTIPLVGFLVYMFYKASRTDEWK---ELRSVTKKMPTPVYIKEVFWNLDIPGVLLI 300

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
               GC+L+P T++GG  EEWK +  I    +G V+  P++++WE K ++ P+     +K
Sbjct: 301 AISLGCILIPLTVSGGETEEWKDSRNIGVLCLGSVL-FPIFLLWEGKIAKRPVLALTYLK 359

Query: 352 DRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGF 411
           DRGV             + +  DY+Y VL+V  ++S  ++ RIT L SF  V++    G 
Sbjct: 360 DRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFTGL 419

Query: 412 ILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ + +  K   + G   + ++FGL   YRG S   AGII     +GFG+G  TY    S
Sbjct: 420 LITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMVS 479

Query: 472 IQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRI-SDPTLAAEAY 530
           +QA   +H ++AIVT+L+     +            WT ++ KEISKR+  +P +A  AY
Sbjct: 480 LQA-VSSHTKIAIVTALFYTFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALAAY 538

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKL-TDSIA 589
            SP+TF+T Y W T +R+A+V +Y +VQKIL ++ L+   PL   A M+R+ +L T  +A
Sbjct: 539 ASPYTFVTKYGWETSQRMAVVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSDVA 598

Query: 590 LEGNDHLESKNDNEIVEKEETSLRTRFLAQFTSKEKKN 627
           L  +D     + + I+ K E  +   F   F+   KK 
Sbjct: 599 LSSSD-----DSHVIISKHEDKIYEAFCKFFSFSTKKE 631

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  304 bits (778), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/439 (38%), Positives = 246/439 (56%), Gaps = 5/439 (1%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
           Q+  ARLSD FGR  I + S + Y   +I+ES A  I+ +  G   Y +G   V ++L V
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 183 IASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGIGMWAFILPLACIPL 240
           + SDFS+L WR+L  F P    +V  WISGDV ++IG   +W WGIG WAF  PLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300
             CM++M Y  RK  + KL  + + LN     +  + I F ++D IG L+ +   GCVLV
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRI-FHQVDFIGTLIFSVALGCVLV 180

Query: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXX 360
           P TLAGG   +W  +  IVP V+G V+ +  Y+VWE   + +P  P+ L+KDRG+     
Sbjct: 181 PLTLAGGYSSKWSHSDSIVPLVVGSVLFV-FYIVWESFMASYPALPFKLLKDRGIWIPIL 239

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420
                   +Y   DYMY VL+VA++ES KSAT I +L  FV+ +       +L    R K
Sbjct: 240 AGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLK 299

Query: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480
            + + G + W+VS GL   YR   G+H G++ ++ LLG G     +    ++QA A  H 
Sbjct: 300 WYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARA-PHT 358

Query: 481 RMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540
           +MA VT L+    ++            WT  +PK++ K +    LA  AY SP+TFI +Y
Sbjct: 359 KMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIISY 418

Query: 541 TWGTPERIALVMSYRYVQK 559
            WGT ER+A+V++Y+ VQK
Sbjct: 419 PWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  284 bits (726), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/431 (35%), Positives = 248/431 (57%), Gaps = 7/431 (1%)

Query: 159 ITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAI 218
           ++ +A G  FY  G  GV LIL +I SDFS L WR+   +    P+I+  W+SG++ +A 
Sbjct: 14  VSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSGNIITAA 73

Query: 219 G--TNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDK-LRPEFETLNNLDWKSFS 275
               NW W I MWAFI PL+ +PL   +++++  + K  + K L+    ++    +K+  
Sbjct: 74  KPEKNWTWDIAMWAFIFPLSSLPLYCLIIYLKMKSVKTPEWKALKERAHSVKRGFFKN-- 131

Query: 276 IDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVW 335
           I  +FW+LD+IG++L+T   GC+LVP TLA G  E+W+++ II   V G V+ L ++M W
Sbjct: 132 IIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFL-IFMFW 190

Query: 336 EVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRIT 395
           E  Y+ +PL P+ L+KDRG+             +Y+  D++Y VL+V+++ES  SA RI 
Sbjct: 191 EASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMNESSTSAARIL 250

Query: 396 ALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLC 455
            L  FV+         ++ K +R K  ++ G + W++S GL   +RG  G+H G+I +  
Sbjct: 251 NLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYGSHGGVISASV 310

Query: 456 LLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKE 515
           ++GF     +      +QA   TH+RMA++T ++     I            WT  +P  
Sbjct: 311 IMGFSGLLCSNSVIVLLQAMT-THSRMAVMTGIHYTFSRIGAAVGASVSGGVWTQTMPSR 369

Query: 516 ISKRISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGC 575
           + K + + TLAAEAY SP++FI +Y WGT ER A+V +Y+YVQ+I+ I+GL+   PL   
Sbjct: 370 LYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVGLICTIPLFAF 429

Query: 576 ACMLRNHKLTD 586
           +  +R+ +L D
Sbjct: 430 SLFMRDPELID 440

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  260 bits (664), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 163/553 (29%), Positives = 285/553 (51%), Gaps = 23/553 (4%)

Query: 70  RAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           +  L  ++FL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 63  KTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARI 122

Query: 130 SDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSN 189
           SD FGR    + +++ Y++G II +   T +    G    Q G +G  L+   +  D S 
Sbjct: 123 SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG 182

Query: 190 LNWRLLALFVPALPFIVNTWISGDVTSAIGTN-----WKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ +  +P I+NTW+SG++ S++  N     W+WG G++  I+P++ + L L  
Sbjct: 183 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPY 242

Query: 245 LHMRYLARKHAK---DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVP 301
           ++ +Y++ +  K    KL+ + +TL    WK F+ DI     +LIG++L TAF   VL+P
Sbjct: 243 VYAQYISWRSGKLPPLKLKEKGQTLRQTLWK-FADDI-----NLIGVILFTAFLVLVLLP 296

Query: 302 FTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXXX 361
            T+AGG   +W+  HII   V+G  +   ++++WE+K++++P  P   + D  +      
Sbjct: 297 LTIAGGATSKWREGHIIAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVALLM 355

Query: 362 XXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      K 
Sbjct: 356 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHPKV 415

Query: 422 FILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHAR 481
           F++ G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH  
Sbjct: 416 FVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THNE 474

Query: 482 MAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTYT 541
           MA VT L ++ Y I            WT  L KE+ +R+   +L    Y SP  ++  Y 
Sbjct: 475 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKKYP 533

Query: 542 WGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600
            G+  R+ ++ SY  +Q++L I+ + F  F  + C   LR   +    +L      E + 
Sbjct: 534 IGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNKKQSLSA----EERE 588

Query: 601 DNEIVEKEETSLR 613
             ++  K+++ LR
Sbjct: 589 KEKLKIKQQSWLR 601

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  228 bits (581), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 261/517 (50%), Gaps = 24/517 (4%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           L  ++FL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+SD 
Sbjct: 65  LLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARMSDR 124

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
           FGR    + +++ Y+VG II +   T      G    Q G +G  L+   +  D S L  
Sbjct: 125 FGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSGLRD 184

Query: 193 RLLALFVPALPFIVNTWISGDVTSAIGT-----NWKWGIGMWAFILPLACIPLGLCMLHM 247
           R  A+ +  +P I+NTW+SG++ S++       NW+WG G++  I+P + + L L   + 
Sbjct: 185 RTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPYAYA 244

Query: 248 RYLARKHAK---DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTL 304
           +Y+  ++      KLR + + L    WK      +   ++LIG++L +AF   +L+P T+
Sbjct: 245 QYIGWRNGTLPPYKLREKGQNLRQTLWK------IVEDINLIGVILFSAFLVLLLLPLTI 298

Query: 305 AGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXXXXXX 364
           AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D  +         
Sbjct: 299 AGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 357

Query: 365 XXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKPFIL 424
                 ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K F++
Sbjct: 358 WRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHPKLFVV 417

Query: 425 FGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHARMAI 484
            G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH  MA 
Sbjct: 418 AGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THNEMAT 476

Query: 485 VTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTYTWGT 544
           VT L ++ Y I            WT  L KE+ +R+    L    Y SP  ++  Y  G+
Sbjct: 477 VTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGS-NLGMSIYKSPLNYLKKYPIGS 535

Query: 545 PERIALVMSYRYVQKILCIIGLVF-------CFPLLG 574
             R  +V SY  +Q++L I+ + F       CF L G
Sbjct: 536 EVRDQMVESYSKIQRLLIIVSISFAAFNAVLCFFLRG 572

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  216 bits (549), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 160/522 (30%), Positives = 259/522 (49%), Gaps = 28/522 (5%)

Query: 70  RAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           +  L  ++FL  Y  GL G I  + Q YA +++ +   + ++N +K+V+AA   + +ARL
Sbjct: 61  KIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARL 120

Query: 130 SDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSN 189
           SD FGR    + +++ Y+VG II +   T      G    Q G +G  L+   + +D S 
Sbjct: 121 SDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISG 180

Query: 190 LNWRLLALFVPALPFIVNTWISGDVTSAIGT-----NWKWGIGMWAFILPLACIPLGLCM 244
           L  R  A+ +  +P I+NTW+SG++  ++        W+WG G++  I+P + + L L  
Sbjct: 181 LRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPY 240

Query: 245 LHMRYLARKHAKDKLRPEFE-TLNNLDWKSFSIDIVFWKL----DLIGLLLVTAFFGCVL 299
            + +YLA +  +    P+FE       WK        WKL    +LIG++L TAF   VL
Sbjct: 241 AYAQYLAWREGR---LPQFEFRKQGQSWKQ-----ALWKLTEDVNLIGIVLFTAFLVLVL 292

Query: 300 VPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXX 359
           +P TLAGG   +WK  HII   V+G    + L+ VWE+  ++ P  P   + D  +    
Sbjct: 293 LPLTLAGGASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYVAL 351

Query: 360 XXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRT 419
                      ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      
Sbjct: 352 LMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPHP 411

Query: 420 KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTH 479
           KPFI+ G    ++  GLL  YR      +G+IG+  ++G  AGS       ++  ++ +H
Sbjct: 412 KPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGI-AGSMVRFPMWTLVHASTSH 470

Query: 480 ARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITT 539
             MA+ T L ++ Y I            WT  L KE+ KR+    +    Y SP +++T 
Sbjct: 471 EEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGS-KVGLAVYNSPLSYLTK 529

Query: 540 YTWGTPERIALVMSYRYVQKILCIIGLVF-------CFPLLG 574
           Y  G+  R  ++ SY  +Q++L I+ + F       CF L G
Sbjct: 530 YPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPG 571

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  214 bits (544), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 245/483 (50%), Gaps = 17/483 (3%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           L  ++FL  Y  GL G I  + Q YA + + +HS + ++N +K+++++V  + +AR+SD 
Sbjct: 61  LLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSDR 120

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
           FGR    + +++ Y+VG II +          G    Q G +G  L+   +  D S L  
Sbjct: 121 FGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLRD 180

Query: 193 RLLALFVPALPFIVNTWISGDVTSAIGTN-----WKWGIGMWAFILPLACIPLGLCMLHM 247
           R  A+ +  +P I+NTW+SG++ S++  +     W+WG G++  I+P + + L L   + 
Sbjct: 181 RTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPYAYA 240

Query: 248 RYLARKHAK---DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTL 304
           +Y++ ++      KL+ + + L    WK F+ DI     +LIG++L TAF   VL+P T+
Sbjct: 241 QYISWRNGTLPPFKLKEKGQNLRQTIWK-FAEDI-----NLIGIILFTAFLVLVLLPLTI 294

Query: 305 AGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXXXXXX 364
           AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D  +         
Sbjct: 295 AGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 353

Query: 365 XXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKPFIL 424
                 ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K F++
Sbjct: 354 WRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKVFVV 413

Query: 425 FGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHARMAI 484
            G    ++  GLL  YR      +G+IG+  ++G   G   +     + AS  TH  MA 
Sbjct: 414 AGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKEMAT 472

Query: 485 VTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAEAYGSPFTFITTYTWGT 544
           VT L ++ Y I            WT  L KE+ +R+    L    Y SP  ++  Y  G+
Sbjct: 473 VTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGY-DLGMSIYKSPLNYLKKYPIGS 531

Query: 545 PER 547
             R
Sbjct: 532 EVR 534

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  185 bits (470), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 160/576 (27%), Positives = 258/576 (44%), Gaps = 19/576 (3%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E+ S  +    L  SI L A+   LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 62  GVTRIEVVKEKMSTKVTWI-LAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLT 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     + +I Y +G II + + TI  + VG  F  +G
Sbjct: 121 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVG 180

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGD-VTSAIGTNWKWGIGMWAF 231
            +G+ L+  VI +D ++L WR     + ++P++V TWISG  V + I +NW+WG GM+A 
Sbjct: 181 QSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAI 240

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKL--RPEFETLNNLDWKSFSIDIVFWKL------ 283
           I P+A  P  L M ++ + A K  +  +   P  E    +     S    +W+L      
Sbjct: 241 ITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLI 300

Query: 284 --DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
             D  GL+L+   F  +L+P +L    +  WK   +I  EVIG +  +  Y+++EV ++ 
Sbjct: 301 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLIS-YVIFEVFFAP 359

Query: 342 HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S K+   ++   +  
Sbjct: 360 FPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMG 419

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     I+ +L +  F
Sbjct: 420 LCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAALIVTNF 479

Query: 460 GAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKR 519
           G  +    TQ + QA+   H  MA   S+     +I            WTN LP  + K 
Sbjct: 480 GDAANVMGTQVAAQAAV-PHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELPGALLKY 538

Query: 520 ISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACML 579
           + D   A   + S  T I    WG+  R   + +Y+ V   L  +GL     +   A   
Sbjct: 539 VPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMFIVALFQ 597

Query: 580 RNHKLTDSIALEGNDHLESKNDNEIVEKEETSLRTR 615
            N  L D       +  E  + N      E +L  R
Sbjct: 598 TNFYLGDQQNCVEGEQKEDYHHN--ANGTEMTLMNR 631

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  184 bits (467), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 153/569 (26%), Positives = 259/569 (45%), Gaps = 17/569 (2%)

Query: 53  GVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E+ S  + R  L  SIFL +    LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 61  GVTRIEVVREKMSTRV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLT 119

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     + ++ Y +G +I + + TI  + VG  F  +G
Sbjct: 120 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIG 179

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGD-VTSAIGTNWKWGIGMWAF 231
            +G+ L+  VI +D + L WR     + ++P++V TWISG  V   I +NW+WG GM+A 
Sbjct: 180 QSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAI 239

Query: 232 ILPLACIPLGLCMLHMRYLARKHAK--------DKLRPEFETLNNLDWKSF--SIDIVFW 281
           I P+A  P  L M ++ + A K  +         K R E    +   ++ +   + +   
Sbjct: 240 ITPVALTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLI 299

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
           ++D  GL+L+   F  +L+P +L    +  W    +I  EV+G +  +  Y+V+EV ++ 
Sbjct: 300 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLIS-YVVFEVFFAP 358

Query: 342 HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S ++   ++   +  
Sbjct: 359 FPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMG 418

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     ++ +L +  F
Sbjct: 419 LCFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTNF 478

Query: 460 GAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WT+ LP  +SK 
Sbjct: 479 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKY 537

Query: 520 ISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACML 579
           + D   AA A+    T +    WG+  R   + +Y+ V   L  +GL     +   A   
Sbjct: 538 VPDREKAA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVALFQ 596

Query: 580 RNHKLTDSIALEGNDHLESKNDNEIVEKE 608
            N+ L D       +  E  + N    K+
Sbjct: 597 TNYYLGDQQNCVEGEQREDYHHNADGSKK 625

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  182 bits (463), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 157/572 (27%), Positives = 262/572 (45%), Gaps = 35/572 (6%)

Query: 53  GVRNIEIYAEQYS-RPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTV 111
           GV  IE+  E+ S + ++  GL  SIFL ++   LD    Y +Q YATSS+++HS+LST+
Sbjct: 61  GVTRIEVVREKMSTKVIWILGL--SIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTL 118

Query: 112 NCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQL 171
               +VI AV + F A++SD+  R     + ++ Y +G +I + +  I+ + +G  F  +
Sbjct: 119 TIANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAV 178

Query: 172 GLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGD-VTSAIGTNWKWGIGMWA 230
           G +G+ L+  VI +D + L WR     + ++P++V TWISG  V   I +NW+WG GM+A
Sbjct: 179 GQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFA 238

Query: 231 FILPLACIPLGLCMLHMRYLARKHAK-----DKLRPEFETLNNLDWKSFSIDIVFWKL-- 283
            I P+A  P  L M ++ + A K  +     D L  +   +     + F    V+W+L  
Sbjct: 239 IITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFK---VYWELLK 295

Query: 284 ------DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEV 337
                 D  GL+L+   F  +L+P +L    +  W    +I  EV+G ++ +  Y+V+EV
Sbjct: 296 VSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLIS-YVVFEV 354

Query: 338 KYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQ----GDYMYTVLVVAVHESIKSATR 393
            ++  PL P  ++ +R                Y        Y + VL ++  + +  +  
Sbjct: 355 FFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNT 414

Query: 394 ITALYSFVSVIVGTIL-GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAH--AGI 450
            T    F  V+ G +  GF      R K F + GI+  ++  GL V      G+     +
Sbjct: 415 TTMGLCFFGVVWGALFRGF-----HRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLV 469

Query: 451 IGSLCLLGFGAGSFTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTN 510
           + +L +  FG  +    TQ + QA A  H  MA   S+     +I            WT+
Sbjct: 470 VAALVVTNFGDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTD 528

Query: 511 ILPKEISKRISDPTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCF 570
            LP  + K + D   A  A+    T I    WG+  R   + +Y+ V   L  +GL    
Sbjct: 529 QLPGALFKYVPDKEKAV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSS 587

Query: 571 PLLGCACMLRNHKLTDSIALEGNDHLESKNDN 602
            +   A    N+ L D       + +E  + N
Sbjct: 588 IMFVVALFQTNYYLGDQQNCVEGEQIEDYHHN 619

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  137 bits (344), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 133/500 (26%), Positives = 223/500 (44%), Gaps = 37/500 (7%)

Query: 78  FLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-- 135
           F++A++ G+ G    T   Y TSS+ QHSL +   C         QI   +  DI+GR  
Sbjct: 76  FVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALCQSIDIWGRAQ 131

Query: 136 -FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRL 194
            F+ +V+S+   ++GTI+ +    +  +     FY +G  G+   + +  +D + L  R 
Sbjct: 132 GFAFMVLSI---TIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADTTKLKNRA 188

Query: 195 LALFVPALPFIVNTWISGDVTSAI--GTNWKWGIGMWAFILPLACIPL-GLCMLHMRYLA 251
             L   +  +I   W  G    +I     ++WG G+WA I+P+ C PL GL    + Y  
Sbjct: 189 FILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPLFGL----LYYYQ 244

Query: 252 RKHAKDKLRPEFETLNNLDWKSFSIDIVFW--KLDLIGLLLVTAFFGCVLVPFTLAGGLK 309
           +K  K  L P+ E      W+S    +VF+  + D+IG+ ++       L+ F L    K
Sbjct: 245 QKAVKVGLIPKREKSGRTFWQS----VVFYGKEFDVIGIFILALGLALFLLGFNLYSYQK 300

Query: 310 EEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXW 369
            EW++  II   +IG ++ +  + +WE  ++     PW+L+ +R V             +
Sbjct: 301 NEWRSPLIICFLIIGGLLIIS-FGIWEY-FAPVSFIPWELLTNRTVIFTYSMAAAMYCSF 358

Query: 370 YMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTKPFILF-GIS 428
           Y+   Y +       + S   AT IT +YS  S     ++G I+    R K   LF G+ 
Sbjct: 359 YIWDSYFFR-HHCRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIALFWGVP 417

Query: 429 CWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA-SAGTHARMAIVTS 487
             ++  GL++ YR        I+     + FG G+     Q ++ A SA  H  +  V +
Sbjct: 418 ITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVSAQQH--IPAVLA 475

Query: 488 LYLATYNIXXXXXXXXXXXXWTNILPKEISK----RISDPTLAAEAYGSPFTFITTYTWG 543
           +      I            WT I PK++++     + D  L+   YGS  T   +Y  G
Sbjct: 476 MEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLS--IYGS-LTVQISYPRG 532

Query: 544 TPERIALVMSYRYVQKILCI 563
           T  R A+  SY   Q+++CI
Sbjct: 533 TAAREAIDRSYGDTQRLMCI 552

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 85/147 (57%), Gaps = 5/147 (3%)

Query: 464 FTYVTQASIQASAGTHARMAIVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-D 522
           FTY    S QA A +H  MA VT+L    Y I            WT  L  EI KR+  +
Sbjct: 2   FTYPVTVSCQA-ATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGN 60

Query: 523 PTLAAEAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNH 582
            ++A  AY SP+TFITTYTWGT ER A+V +Y+YVQK+  ++ LVFC PLL  +  LR+ 
Sbjct: 61  VSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDA 120

Query: 583 KLTDSIALEG---NDHLESKNDNEIVE 606
           KLTD +A +G        +K+++ I +
Sbjct: 121 KLTDKVAHDGEIPEGEYTTKDEDPIAD 147

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score =  102 bits (255), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (61%)

Query: 54  VRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ + Q++   YR  +  + FL  + + LD  +R T+  YAT+SY++HSLLST+  
Sbjct: 41  IEESELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQV 100

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           I  V++   Q+ F+RLSD FGR  +  ++ I Y +GTI++SQA +++ +A G  FY  G 
Sbjct: 101 INAVVSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGY 160

Query: 174 TGVIL 178
            GV L
Sbjct: 161 VGVSL 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/343 (22%), Positives = 148/343 (43%), Gaps = 22/343 (6%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           AV  + + RL++I G    L+ISV+ + +G++I + + T+     G      G +G+  +
Sbjct: 57  AVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N+R + +   A+ +++   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I    C   G   L  ++L  K         +E      WK     I+ +KLD+IG++L 
Sbjct: 177 ISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKKV-FQILVFKLDMIGIILS 235

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVA----------LPLYMV-WEVKYS 340
           +A F  +++  +  GG    W ++ II    +G ++           LPL  V ++ KY+
Sbjct: 236 SAGFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYA 294

Query: 341 RHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSF 400
           R PL  W +  + G+             + +Q  Y+  +  + +  +   A+      S 
Sbjct: 295 R-PLLTWKIASNAGIFTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWELSI 353

Query: 401 VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGD 443
            ++I      ++  K    KP I+FG+ C IV  G+     G+
Sbjct: 354 PAMITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGIFTLINGE 396

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/356 (20%), Positives = 146/356 (41%), Gaps = 49/356 (13%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           AV  + + RL++I G    L+ISVI + +G++I + + ++     G      G +G+  +
Sbjct: 57  AVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N R + +   A+ +++   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLD---------WKSFSIDIVFWK 282
           I+   C   G            H K  L  + + + N D         WK+ + +++ +K
Sbjct: 177 IILAFCNTSG----------EPHQKMWLPSKIKKIMNYDYGELLKASFWKN-TFEVLVFK 225

Query: 283 LDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH 342
           LD++G++L +A F  +++  +  GG    W +  II    +G     P+ ++    Y  H
Sbjct: 226 LDMVGIILSSAGFTLLMLGLSF-GGNNFPWNSGIIICFFTVG-----PILLLLFCAYDFH 279

Query: 343 ---------------PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES 387
                          PL  W++  + G+             + +Q  Y+  +  +   + 
Sbjct: 280 FLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKK 339

Query: 388 IKSATRITALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGD 443
              A+      S  ++I    + ++  K    KP I+FG+ C IV  GL     G+
Sbjct: 340 PTLASIHLWELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGE 395

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 154/373 (41%), Gaps = 26/373 (6%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           AV  + + RL++I G    L+ISVI + VG++I + + ++     G      G +G+  +
Sbjct: 57  AVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTN--WKW------GIGMWAF 231
             V+ +     N R   +   A  +++   +   +  A   +  W+W       IG +A 
Sbjct: 117 AFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAL 176

Query: 232 ILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLV 291
           I+   C   G  +  +  L++  +    + + E      WK  +  +  +KLD+IG+ L 
Sbjct: 177 IILAFCNTSGESLPKVSLLSKIKSIMSYKYD-EVFKASFWKK-AFKVFVFKLDMIGVTLS 234

Query: 292 TAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVA----------LPLY-MVWEVKYS 340
           +A F  +++  +  GG    W ++ II    +G ++           LPL  + +E K +
Sbjct: 235 SAGFTLLMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRT 293

Query: 341 RHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSF 400
           + PL  W +  + G+             + +Q  Y+  +  + +      A+      S 
Sbjct: 294 K-PLLTWSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSI 352

Query: 401 VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFG 460
            ++I    + ++  K    KP I+FG+ C IV  GL     G S      IG   L G  
Sbjct: 353 PAIIATMAIAYLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKSSQS---IGYSILPGLA 409

Query: 461 AGSFTYVTQASIQ 473
            GS    T  S Q
Sbjct: 410 FGSIFQATLLSSQ 422

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 161/374 (43%), Gaps = 28/374 (7%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVIL 178
           +A+  + + R++ + G  + L++SV+ + +G++I + + ++     G      G +G+  
Sbjct: 91  SALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQS 150

Query: 179 ILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG--TNWKWGI-------GMW 229
           ++ ++ +   +   R + + V    F+ +      +  A+    +W+W         G  
Sbjct: 151 LVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASWRWCFFINLPIGGAA 210

Query: 230 AFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLL 289
           AF+L L   P G  +L       + A+D     +  +    + + ++D+  ++ D+IG  
Sbjct: 211 AFMLFLCYNPSGKPLLSTLTSKLEAARDY---RYSNVCTRKFWAHALDLGVFRFDIIGFA 267

Query: 290 LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIG--WVVALPLY-------MVWEVKYS 340
           L +A F  +L+  T  G  K  W +   I    +G   +V   LY       +   + YS
Sbjct: 268 LSSAGFVLLLLGLTFGG-RKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSLAYS 326

Query: 341 RH--PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALY 398
               PL PW +I   GV             + MQ  Y+     V  +ES  +A+      
Sbjct: 327 SEVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHMWAL 386

Query: 399 SFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLG 458
           S  +++V  +LG I  K    KP  + G +C  +  GLL   +G + +   I    C+L 
Sbjct: 387 SIPALVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYCILA 444

Query: 459 FGAGSFTYVTQASI 472
            GAG F+ V Q+++
Sbjct: 445 -GAG-FSAVMQSTL 456

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 155/381 (40%), Gaps = 41/381 (10%)

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
            R++   G    ++ +++ + VG++I + A ++     G     +G  G+  +  VI S+
Sbjct: 132 GRIATPIGFKRTMLFAIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSN 191

Query: 187 FSNLNWRLLALFVPALPF----IVNTWISGDVTSAIGTNWKWGI-------GMWAFILPL 235
               + R + + + +  F    +V  ++ G  TS +   W+W         G+  F+  +
Sbjct: 192 LVEESNRGVLIAILSCSFAIASVVGPFLGGVFTSRV--TWRWCFYINLPIGGLTFFLFLM 249

Query: 236 ACIPLGLCMLH-MRYLAR---------KHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDL 285
            C P        +R + R         +     L    E      WK    ++VF   D+
Sbjct: 250 FCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHLSKVKELGKRTSWKILLTELVFM-YDI 308

Query: 286 IGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVAL----------PLYMVW 335
           I  +L TA F  +L+ FT  GG +  W +A IIV  VIG ++ +          P + V 
Sbjct: 309 IEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVV 367

Query: 336 EVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSATRI 394
           +      PL  W  IK  G+             +  Q  Y+     +  ++S  K+A  +
Sbjct: 368 KTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHL 427

Query: 395 TALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSL 454
            A     +VI   + G I  K R+ KP I+      +V  GLL     +S +++  IG L
Sbjct: 428 VACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLLT-LLNNSASNSAHIGLL 485

Query: 455 CLLGFGAGSFTYVTQASIQAS 475
            L G   G    + Q+S+ AS
Sbjct: 486 ILPGIAFGG---LMQSSMLAS 503

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 153/383 (39%), Gaps = 44/383 (11%)

Query: 124 IFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVI 183
           + + R++ I G  S ++ ++I + +G++I   A ++     G     +G +G+  +  VI
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVI 190

Query: 184 ASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
            S+  +   R L +   +  F V + I   +  A  T+  W    W F + L    +   
Sbjct: 191 GSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHATW---RWCFYINLPVGGVAFA 247

Query: 244 MLHMRYLARKHAKDKLR-----PEF-------ETLNNLD----WKSFSIDIVFWKLDLIG 287
           +  + Y  ++ + + +       EF         + NL     WKS    +VF + D+I 
Sbjct: 248 LFVVFYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVF-RFDIIE 306

Query: 288 LLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWV----------VALPLYMVWEV 337
            +  +A F  VL+ FT  GG +  W +A IIV  VIG +          V  P +   + 
Sbjct: 307 FIFCSAGFVLVLLAFTF-GGNQYNWSSASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKE 365

Query: 338 KYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITAL 397
                PL  W +    G+             +  Q     TV ++   + ++  T   A 
Sbjct: 366 NSLYQPLIKWSIFSHPGIFTANAALFFECTAYICQ-----TVYIIQFFQLVRGNTAWKAA 420

Query: 398 YSFVSVIVGTIL-----GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIG 452
              ++ +V T++     G    K    K     G+   +V  GLL     +S + A  IG
Sbjct: 421 VHLIATVVPTVITTFSSGIANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNS-SSAKHIG 479

Query: 453 SLCL--LGFGAGSFTYVTQASIQ 473
            L L  +GFGA   + +  A IQ
Sbjct: 480 LLILPGIGFGATMQSTMIGAQIQ 502

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 162/385 (42%), Gaps = 49/385 (12%)

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
            R++   G  + ++ +++ + +G++I + A ++     G     +G  G+  +  VI S 
Sbjct: 117 GRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGST 176

Query: 187 FSNLNWR--LLALFVP--ALPFIVNTWISGDVTSAIGTNWKW------GIGMWAFILPLA 236
               + R  L+A+     A+  +V  ++ G  TS++   W+W       IG  AF L + 
Sbjct: 177 LVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSV--TWRWCFYINLPIGGLAFFLFVL 234

Query: 237 CIPLGLCMLH--MRYL----------ARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLD 284
               GL      M+ +           RK A   L+ +    +N  WK   I++VF   D
Sbjct: 235 FYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSN-SWKKLFIELVFM-YD 292

Query: 285 LIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAH----------IIVPEVIGWVVALPLYMV 334
           +I L+L +A F  +L+ FT  GG +  W +            +++  +I      P + +
Sbjct: 293 VIELVLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFNL 351

Query: 335 WEVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSATR 393
            +   S  PL  W  IK  GV             +  Q  Y+     +  ++S  K+A  
Sbjct: 352 VKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAVH 411

Query: 394 -ITALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGL--LVHYRGDSGAHAGI 450
            IT + S  +VI   + G I  K R+ KP I+      +V  GL  L++    S AH   
Sbjct: 412 LITCVIS--TVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNASSSAH--- 466

Query: 451 IGSLCLLGFGAGSFTYVTQASIQAS 475
           IG L L G   G    + Q+S+ AS
Sbjct: 467 IGLLILPGIAFGG---LAQSSMLAS 488

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 79/365 (21%), Positives = 145/365 (39%), Gaps = 37/365 (10%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           A+  + + RLS + G    ++  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     N   R L L +    F V + +   +  A  T+  W    W F + L   P
Sbjct: 153 SLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINL---P 206

Query: 240 LG-LCMLHMRYLARKHAKDKLRPEFETLN--------NLDWKSFSIDIVFWKLDLIGLLL 290
           +G L +    +       D L    +T          NL  K   +D + +  D++  +L
Sbjct: 207 IGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSYRRANLSLKQL-LDQLLFGFDIVSFVL 265

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH-------- 342
            TA +   L+  T  GG    WK+  I++  +I  V+ + L ++++ +   H        
Sbjct: 266 FTAGWLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFR 323

Query: 343 PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVS 402
           PL  W L+  R +             + +Q  Y      V   + +   +   A    + 
Sbjct: 324 PLLSWHLMSQRAILNANFTGFFSTIAYNVQMIYS-----VQFFQLVYGFSAWKAGLHLIP 378

Query: 403 VIVGTIL-----GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLL 457
           ++V T++     G I+ K    KP ++FG +  ++  GL++     S  H   IG L L 
Sbjct: 379 ILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQ-IGVLILP 437

Query: 458 GFGAG 462
           G   G
Sbjct: 438 GVALG 442

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 145/378 (38%), Gaps = 42/378 (11%)

Query: 124 IFFARLSDIFGRFSILVISVIFYSVGTII----ESQAVTITRFAVGGCFYQLGLTGVILI 179
           + + RL+ I G  + L  S++ + +G++I     S  + I    V GC    G +G+  +
Sbjct: 60  LLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGC----GGSGIQSL 115

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
           + V+ +       R + + V  L F V   +   +  A   N  W    W F + L    
Sbjct: 116 VFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGG 172

Query: 240 LGLCMLHMRY-LARKHAKDKLR---PEFETLNNLDWKSFSI-----DIVFWKLDLIGLLL 290
           + L ML   Y    K  ++ L     + +T     W + S      + + + LD IG  L
Sbjct: 173 VALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAYNFLMFDLDFIGFAL 232

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIG------WVV----ALPLYMVWEVKYS 340
            +  F   ++  T  GG    W +  II    +G      W+V     L  +  W  K  
Sbjct: 233 SSTGFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKRE 291

Query: 341 RHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSF 400
             PL    L    G+             + MQ     TV +V +++ + ++    A    
Sbjct: 292 ATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQ-----TVYIVQLYQLVFNSGPTAASMHL 346

Query: 401 VSVIVGTILGFILIKVRRT-----KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLC 455
            + ++ T++  I+I          KP I+FG +C +V  GL+   R  S     +IG   
Sbjct: 347 WAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTS-TTGNVIGYCI 405

Query: 456 LLGFGAGSFTYVTQASIQ 473
           L G   GS    T  S Q
Sbjct: 406 LPGAAFGSIMQGTLLSAQ 423

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 87/201 (43%), Gaps = 9/201 (4%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S+FL  +   LDG I  T      S ++    +S +     + ++  Q  + +LSD 
Sbjct: 84  IMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQ 143

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
            GR  +LV S + +S+G +I   + +I    VG     +G  G+  +  ++ SD   L  
Sbjct: 144 LGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRE 203

Query: 193 RLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY--L 250
           R +   +    F + T  SG +  A   +W+      AF +    I L  C L + Y  L
Sbjct: 204 RAVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYLEL 256

Query: 251 ARKHAKDKLRPEFETLNNLDW 271
             +H  DK R     L +LDW
Sbjct: 257 PPRHEDDKDRHWTSKLRDLDW 277

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/248 (22%), Positives = 110/248 (44%), Gaps = 23/248 (9%)

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
            R + I G  S +++S+I + VG+++ + A ++     G     +G +G+  +  +I S 
Sbjct: 99  GRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIIST 158

Query: 187 FSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLH 246
             N   R +A+ V +  F V + +   +  A  T+  W    W F + L    L   +  
Sbjct: 159 LVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGGLAFLVFV 215

Query: 247 MRYLAR-KHAKDKLRPEFETLNNLDW------KSF--SIDIVFWKLDLIGLLLVTAFFGC 297
           + Y     ++         +++++D+      KS+  + + + +K D +G  L +A F  
Sbjct: 216 LSYNPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGFCL 275

Query: 298 VLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR----------HPLTPW 347
           +L+  T  GG +  W +  II   VIG V+++  ++     ++R           PL  W
Sbjct: 276 ILLGLTF-GGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLVSW 334

Query: 348 DLIKDRGV 355
           ++I   GV
Sbjct: 335 NVISKPGV 342

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 88/377 (23%), Positives = 163/377 (43%), Gaps = 44/377 (11%)

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILE 181
           G+I F+ L    G  + ++ +++ + +G++I + A ++     G     +G +G+  +  
Sbjct: 114 GRIAFSFL----GFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSF 169

Query: 182 VIASDFSNLNWR-LLALFVPA---LPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLAC 237
           VI S   +   R  +  F+ A   +  ++  +I G  TS +   W+W    W   LP+  
Sbjct: 170 VIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHV--TWRWC--FW-INLPVGA 224

Query: 238 IPLGLCMLHMRYLARKHAK---DKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAF 294
           + L +         +K        L+   E +  + +K     ++F KLD+I  +L++A 
Sbjct: 225 VALVIFTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLF-KLDIIEFMLISAG 283

Query: 295 FGCVLVPFTLAGGLKEEWKAAHIIVPEVIGW---VVAL-------PLYMVWEVKYSRH-P 343
             C+L+ FT  GG + +W +  II+  VIG    +VAL       P   + +  Y ++ P
Sbjct: 284 IVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQP 342

Query: 344 LTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSV 403
           L  W  ++ RG+             +  Q     TV  V   + I +++   A    ++V
Sbjct: 343 LISWKNLRIRGIFTASMTTFFFCIGYMSQ-----TVYYVQFFQLIYNSSPWKASIHLIAV 397

Query: 404 IVGTIL-----GFILIKVRRTKPFILFGISCWIVSFGL--LVHYRGDSGAHAGIIGSLCL 456
           ++ T+L     GF+  K    KP  + G+   ++  GL  L+    +S  H   IG L L
Sbjct: 398 MIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQH---IGLLIL 454

Query: 457 LGFGAGSFTYVTQASIQ 473
            G   G+    T  + Q
Sbjct: 455 PGVAFGACNQCTMMAAQ 471

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 82/382 (21%), Positives = 164/382 (42%), Gaps = 40/382 (10%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTII----ESQAVTITRFAVGGCFYQLGLTG 175
           A+  + + R + IFG  + L++S+I + +G+++     S  + I    + GC    G +G
Sbjct: 69  ALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGC----GASG 124

Query: 176 VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPL 235
           +  ++  IA+   + + R   + + +L + V + +   +  A+     W    W F + L
Sbjct: 125 IQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYVTW---RWCFYINL 181

Query: 236 ACIPLGLCMLHMRYLARKHAKDKLRPE-FETLNNLDWKSFSIDIVFWKLDLIGLLLVTAF 294
               L L + ++ Y   +    K  P  F+++ +L++K   + + F+++ L  L+    F
Sbjct: 182 PIGGLALGVFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQL-LSLKFYRMLLKFLVFELDF 240

Query: 295 FGCVLVP--------FTLAGGLKEEWKAAHIIVPEVIG--WVVALPLY------MVWEVK 338
           FG                 GG    W++  II   V+G  ++V   +Y      M W+ +
Sbjct: 241 FGFTFCSVGFVLLLLGLTFGGNLHPWQSGTIIAYLVVGSFFIVIFFVYEFVIFDMFWQSQ 300

Query: 339 YSRH--PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES-IKSATRIT 395
            + +  PL  W      G+             + +Q  ++  +  +   +S  ++A+ + 
Sbjct: 301 RNGNARPLISWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLW 360

Query: 396 ALY--SFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGS 453
           +L   +FVS+I+    G I  +    KP  LF     ++  GLL    G+S  ++  IG 
Sbjct: 361 SLLIPAFVSIIIS---GKITSRYGYVKPITLFAGISGVIGAGLLTLLNGES-TNSEQIGY 416

Query: 454 LCLLG--FGAGSFTYVTQASIQ 473
             L G  FG  + + +  A IQ
Sbjct: 417 AILSGAAFGCINLSTLLSAQIQ 438

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 71/376 (18%), Positives = 148/376 (39%), Gaps = 29/376 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           A+  + + R++ + G  + LV S++ +  G+++ + A ++     G      G +G+  +
Sbjct: 56  ALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETL 115

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
           +  + +   +   R   + +  + +++       +  A   +  W    W F + +    
Sbjct: 116 VFAVGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFINIPIGG 172

Query: 240 LGLCMLHMRY-LARKHAKDKLRPEFETLNNLDWKSF--------SIDIVFWKLDLIGLLL 290
           + L +L   Y  A +   + L   +++     WK           + +  ++LD++GLLL
Sbjct: 173 VALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLL 232

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEV-----------KY 339
            +  F  +++  T  GG K  W +A II    IG +  L ++M+++              
Sbjct: 233 SSGGFALIMLALTF-GGNKFAWNSASIICMFTIG-IALLGIFMLYDFVVLPYIGRRLENG 290

Query: 340 SRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYS 399
              PL PW L  +  +             + +Q  Y+     +  +E    A+      S
Sbjct: 291 EAMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMS 350

Query: 400 FVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGF 459
             ++I   +   I  K    KP I+ G+    +  GLL  +  ++   A I  S+     
Sbjct: 351 VPALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASIGYSM----L 406

Query: 460 GAGSFTYVTQASIQAS 475
              SF  V Q S+ +S
Sbjct: 407 AGASFGCVYQLSLLSS 422

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 120/293 (40%), Gaps = 40/293 (13%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           ++  IFL A     DG +  T  A+  S +++   +S +     + +A  Q  + +LSDI
Sbjct: 85  MYLGIFLAAA----DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTI-----TRFAVGGCFYQLGLTGVILILEVIASDF 187
           FGR  +L+++ I + VG ++     +       RF  G     +G  GV  +  +  SD 
Sbjct: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGGGGVTSMCSITISDI 195

Query: 188 SNLNWRLLALFVPALPFIVNTWISGDVT---SAIGTNWKWGIGMWAFIL--PLACIPLGL 242
             L  R L   +    F + T   G V    S  G  W+      AF++  PL+ +   L
Sbjct: 196 VPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWR-----MAFLIQVPLSALSSLL 250

Query: 243 CMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPF 302
             + M+   R    +        L ++DW   S  +VF     + L LVTA  G   + F
Sbjct: 251 IAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVF-----LSLFLVTASLGGKEIAF 305

Query: 303 TLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
                       +   V   IG  +A   ++  E+  ++ P+ P   +++R V
Sbjct: 306 N-----------SKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV 347

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 89/211 (42%), Gaps = 20/211 (9%)

Query: 248 RYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGG 307
           R LAR   + +  P    L    W+  +  +VF +LD+ GL L +  F  V++  T  GG
Sbjct: 191 RALARFWVRARAFPYGTLLQAQFWRRAAALMVF-RLDIPGLALSSGGFALVMLALTF-GG 248

Query: 308 LKEEWKAAHIIVPEVIGWVVALPLYMVWE-----------VKYSRHPLTPWDLIKDRGVX 356
            +  W++A I+   V G  + L L+M+++             Y   PL PW L  +  V 
Sbjct: 249 NQYAWRSATIVCMFVFGAAL-LALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAANVPVL 307

Query: 357 XXXXXXXXXXXXWYMQGDYM--YTVLVVAVHESIKSATR-ITALYSFVSVIVGTILGFIL 413
                       + +Q  Y+  Y  LVV    ++ S      +L + VSVI   ++    
Sbjct: 308 TSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSVIASAVVN--- 364

Query: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRGDS 444
            +    KP +L G+    V  GLL   R D+
Sbjct: 365 ERFGVVKPLVLAGVVMGFVGSGLLTLVRSDT 395

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 89/363 (24%), Positives = 151/363 (41%), Gaps = 34/363 (9%)

Query: 124 IFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVI 183
           + + R + IFG    L++S++ +  G++I + + ++     G     +G +G+  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R +A+ V +  + V    S  + SA  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFA 210

Query: 244 MLHMRYLARKHAKDKLRPEFETLNNL----DWKSFSIDIVFWKL--DLIGLLLVTAFFGC 297
           +L + Y  + H  +  R     L +       + FS D+ + K+  +L+       F  C
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDL-YLKMFNELVFGFDFIGFIFC 267

Query: 298 VL--VPFTLA---GGLKEEWKAAHIIVPEVIGWVVALPL----YMVWEVKYSR------- 341
            +  + F L    GG K  W +  IIV  V+G  +++      +MV+  K+ R       
Sbjct: 268 SVGFILFRLGLTFGGDKYTWSSGAIIVYFVVGVTISVAFLLYDFMVFP-KFGRVRKNASF 326

Query: 342 HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITALYSF 400
            PL PW ++   G+             +  Q  Y+     +V   ++ +++  + AL   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 401 VSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLG-- 458
             +I   I G I       KP I  GI   +V  GLL     DSG+    IG L L G  
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKH-IGLLILPGVA 444

Query: 459 FGA 461
           FGA
Sbjct: 445 FGA 447

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 121/287 (42%), Gaps = 18/287 (6%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
           FGR  +L+   I + VG++I   + +      G     +G  G+  +  +  SD   L  
Sbjct: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRN 242

Query: 193 RLLALFVPALPFIVNTWISGDVT---SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRY 249
           R L   +    F + T + G V    S     W+     +   LP+A     L +L +R 
Sbjct: 243 RALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298

Query: 250 LARKHAKDKLRPEFETLNNLDWKSFS-IDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGL 308
           L ++     L+        +D   FS I +    +D IG   +  F    ++  +L G  
Sbjct: 299 LPKESKGRGLQ--------VDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITASLGG-- 348

Query: 309 KEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
           KE    +H  +   +  V+   ++   E+K ++ P+ P   +KDR V
Sbjct: 349 KEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 101/218 (46%), Gaps = 15/218 (6%)

Query: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE+ S    R  +  S++L  +   +D  I  T  A+  S ++Q S +S +     + +A
Sbjct: 102 AEEISGARLRV-IMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSA 160

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQA-----VTITRFAVGGCFYQLGLTG 175
             Q  + ++SDIFGR  +LV + + + +G ++   +     + I RF  G     +G  G
Sbjct: 161 TFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAG-----VGGGG 215

Query: 176 VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFIL-- 233
           +  +  +  +D   L  R +   +  + + + T   G V      N K G  M AF++  
Sbjct: 216 LTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDN-KGGWRM-AFLIQV 273

Query: 234 PLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDW 271
           PL+ I L + +LH++  +++  +++       L  +DW
Sbjct: 274 PLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDW 311

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 79/352 (22%), Positives = 142/352 (40%), Gaps = 31/352 (8%)

Query: 124 IFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVI 183
           + + R + IFG    L++S++ +  G++I + + ++     G     +G +G+  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R +A+ V +  + V       +  A  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFA 210

Query: 244 MLHMRYLARKHAKDKLRPEFETLNNL----DWKSFSIDIVFWKLD-LIGLLLVTAFFGCV 298
           +L + Y  + H  +  R     L +       + FS D+     D L+       F  C 
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCS 268

Query: 299 L--VPFTLA---GGLKEEWKAAHIIVPEVIGWVVALPL----YMVWEVKYSR-------H 342
           +  + F L    GG K  W +  IIV  ++G  +++      +M++  K+ R        
Sbjct: 269 VGFILFLLGLTFGGDKYAWSSGAIIVYFIVGVTISVAFLLYDFMIFP-KFGRVRKNASFR 327

Query: 343 PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITALYSFV 401
           PL PW ++   G+             +  Q  Y+     +V   ++ +++  + AL    
Sbjct: 328 PLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIP 386

Query: 402 SVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGA--HAGII 451
            +I   I G I       KP I  GI   +V  GLL     DSG+  H G++
Sbjct: 387 DIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIGLL 438

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 144/360 (40%), Gaps = 38/360 (10%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           + FS+FL  +   LDG I  T   +  S ++     S +     + ++  Q  + +LSD 
Sbjct: 88  IMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDR 147

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
            GR  +LV S   +++G +I   + +I     G     +G  G+  +  +I SD   L  
Sbjct: 148 LGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRD 207

Query: 193 RLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFIL--PLACIPLGLCMLHMRYL 250
           R +   +    F + T  SG +  A   +W+      AFIL  P++ +   L ++++   
Sbjct: 208 RAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-----LAFILQCPISVLSGILIVVYLELP 261

Query: 251 ARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKE 310
            R  A +K       L  LDW   +  I F     + L ++T+  G   V +        
Sbjct: 262 PRASASNK-DCWSARLRRLDWAGATSLIAF-----LFLFMLTSSMGGSSVAY------GS 309

Query: 311 EWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWY 370
              AA      V G V     ++  E++ +  P+ P   ++DR V             W+
Sbjct: 310 RLFAAMCAATLVFGAV-----FVYVELRVAADPVLPVTFLRDRSV------LGSSLANWF 358

Query: 371 MQGDYMYTVLVVAVHESIKSATRIT-----ALYSFVSVIVGTILGFILIKVRRTKPFILF 425
                M T   + V+ S     + T     A+ SF SV  G++   + +K  RT  +  F
Sbjct: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMK--RTGKYYYF 416

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 90/222 (40%), Gaps = 37/222 (16%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  A+G + 
Sbjct: 66  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLI 125

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FAR +D  GR   +VI V+ Y VG II+ S +    ++ VG   Y LG  G  ++  ++ 
Sbjct: 126 FARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLCPMLL 185

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        +PLGL
Sbjct: 186 SEIAPKDLRGGLISLYQLNMTFGIFL----GYCSVYGTRKYDDTAQWR-------VPLGL 234

Query: 243 CML--------------HMRYLARKHAKDKLRPEFETLNNLD 270
           C L                RYL  +   ++ R     +N + 
Sbjct: 235 CFLWALIIIVGMLLVPESPRYLIEREKHEEARISLAKINKVS 276

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + ++  A+G + 
Sbjct: 66  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLI 125

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 126 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 185

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        +PLGL
Sbjct: 186 SEIAPTDLRGGLVSLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGL 234

Query: 243 CML 245
           C L
Sbjct: 235 CFL 237

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + ++  A+G + 
Sbjct: 66  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLI 125

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 126 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 185

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        +PLGL
Sbjct: 186 SEIAPTDLRGGLVSLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGL 234

Query: 243 CML 245
           C L
Sbjct: 235 CFL 237

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  AL +++V+EVKY++
Sbjct: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326

Query: 342 HPLTPWDLIKDRGV 355
            PL P  +  +RG+
Sbjct: 327 TPLIPKAISSNRGM 340

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%)

Query: 76  SIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 136 FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLL 195
             +++IS +F+ +G +I   +  +     G     +G  GV  +  + ASD   L  R L
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRAL 185

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
            +D IG +L    FG +++ F         W++A+IIV  V+ +  AL +++V+EVKY++
Sbjct: 294 SMDWIGAIL--GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 350

Query: 342 HPLTPWDLIKDRGV 355
            PL P  +  +RG+
Sbjct: 351 TPLIPKAISSNRGM 364

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 139/333 (41%), Gaps = 43/333 (12%)

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
            R++   G    ++ +++ + +G++I + A +++    G     +G  G+  +  VI S 
Sbjct: 123 GRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGST 182

Query: 187 FSNLNWRLLALFVPALPF----IVNTWISGDVTSAIGTNWKW------GIGMWAFILPLA 236
               + R + + V +  F    +V  ++ G  TS++   W+W       IG  AF L L 
Sbjct: 183 LVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSV--TWRWCFYVNLPIGGLAFFLFLF 240

Query: 237 CIPLGLC-----MLHMRY-------LARKHAKDKLRPE-FETLNNLDWKSFSIDIVFWKL 283
               GL      M ++R        + R  A   L+ + F  LN   W+   ++++F   
Sbjct: 241 FYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNG--WRKPFMELIFM-Y 297

Query: 284 DLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAH----------IIVPEVIGWVVALPLYM 333
           D+I  +  +A F C+L+ FT  GG +  W +A           ++V   I   +  P + 
Sbjct: 298 DIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFN 356

Query: 334 VWEVKYSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSAT 392
           + +      PL  W  IK  G+             +  Q  Y+     +  ++S  ++A 
Sbjct: 357 IVKATPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAV 416

Query: 393 RITALYSFVSVIVGTIL-GFILIKVRRTKPFIL 424
            + A    +S +V  IL G I  K R+ KP I+
Sbjct: 417 HLVA--CIISTVVTAILCGAITDKTRQIKPIIV 447

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  ++G + 
Sbjct: 69  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVA 128

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        IP+GL
Sbjct: 189 SEIAPTDLRGGLVSLYQLNMTFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGL 237

Query: 243 CML 245
           C L
Sbjct: 238 CFL 240

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  ++G + 
Sbjct: 69  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVA 128

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 129 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        IP+GL
Sbjct: 189 SEIAPTDLRGGLVSLYQLNMTFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGL 237

Query: 243 CML 245
           C L
Sbjct: 238 CFL 240

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  A+G + 
Sbjct: 138 FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVS 197

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FAR +D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 198 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 257

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        +PLGL
Sbjct: 258 SEIAPKDLRGGLISLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGL 306

Query: 243 CML 245
           C L
Sbjct: 307 CFL 309

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 67/139 (48%), Gaps = 18/139 (12%)

Query: 73  LFFSIFLIAYAYG----------LDGGIRYT--FQAYATSSYSQHSLLSTVN-----CIK 115
           LF SI  +  A+G          + G +R T   + + T+  +  S LS V       I 
Sbjct: 84  LFVSICCLMVAFGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTSYLSNVRTGLLVSIF 143

Query: 116 TVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLT 174
            +  A+G I  +RL D++GR   LVI V+ YSVG II+  ++    ++ +G     LG+ 
Sbjct: 144 NIGCAIGGIVLSRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVG 203

Query: 175 GVILILEVIASDFSNLNWR 193
           G+ ++  ++ S+ S    R
Sbjct: 204 GITVLSPMLISEVSPKQLR 222

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 94/400 (23%), Positives = 165/400 (41%), Gaps = 45/400 (11%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVIL 178
           +A+  + + R++ + G  S ++ ++I + VG+++ + A ++     G     LG +G+  
Sbjct: 103 SALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQT 162

Query: 179 ILEVIASDFSNLNWRLLALFVPALPF----IVNTWISGDVTSAIGTNWKW---------G 225
           +  VI S     + R L +      F    +V  ++ G  T+ +   W+W         G
Sbjct: 163 LCFVIISTLVEESKRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFWINLPIGG 220

Query: 226 IGMWAFILPLACIPLGLCMLHMRYLAR--KHAKDKLRPEFETLNNLDWKSFSIDIVFWKL 283
           +    FIL     P G     + Y+    K     L+   + L    W+    ++++ K 
Sbjct: 221 LAFAFFILFYN--PHGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIY-KF 277

Query: 284 DLIGLLLVTAFFGCVLVPFTLA-GGLKEEWKAAHIIVPEVIGWVVALPLYMVWE------ 336
           D+I   L T   G VL+   L+ GG K  W +   I   VIG +V + L +V++      
Sbjct: 278 DIIEFALCTT--GLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTI-LALVYDFAIFPR 334

Query: 337 VKYSR-----HPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KS 390
           +K  R      PL P  + K   +             +  Q +Y+     +  +E+  K+
Sbjct: 335 LKVVRENPRYQPLIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKA 394

Query: 391 ATRITALY--SFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHA 448
           +  + A    + ++VI   IL     K    KP  + GI+  IV  GLL      S  ++
Sbjct: 395 SIHVIACVVPTVITVITSGILNS---KFGIVKPINVLGITAAIVGAGLLTLLTNKS-TNS 450

Query: 449 GIIGSLCLLG--FGAGSFTYVTQASIQ-ASAGTHARMAIV 485
             IG L L G  FGA   + +  + IQ     TH RM  +
Sbjct: 451 EHIGLLILPGVAFGATMQSTLIGSQIQLDKKSTHYRMDFI 490

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  A+G + 
Sbjct: 69  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVS 128

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FAR +D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 129 FARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 188

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        +PLGL
Sbjct: 189 SEIAPKDLRGGLISLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGL 237

Query: 243 CML 245
           C L
Sbjct: 238 CFL 240

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%)

Query: 62  EQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
            +Y+  L +  + FS++L ++   LDG I           +S+ S    +     +    
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTA 86

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILE 181
            Q  + +LSDI GR S L+ +  F+ +G ++   A  +T F++      +G  G+  I  
Sbjct: 87  FQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGS 146

Query: 182 VIASD 186
           +  SD
Sbjct: 147 IAVSD 151

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 92/224 (41%), Gaps = 9/224 (4%)

Query: 76  SIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S++L  +   LD  +  T  A+  S ++Q   +  V     + +AV Q  + +LSDIFGR
Sbjct: 402 SMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGR 461

Query: 136 FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLL 195
            ++L+ S + +  G II   + ++     G     +G  G+  +  +  SD   L  R +
Sbjct: 462 KALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSRAV 521

Query: 196 ALFVPALPFIVNTWISGDVTSA-IGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKH 254
              +    F + T   G +    +   + W +  W+ +       L +C     +L    
Sbjct: 522 YQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQVPVSGLSTLLIC----SFLVVPR 577

Query: 255 AKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCV 298
            K+        L  +DW   SI ++ W   L   LL+T   G +
Sbjct: 578 IKNYEVSLGRKLMRVDWLG-SISMILW---LTSFLLITTMMGGI 617

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 37/219 (16%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + ++  ++G + 
Sbjct: 66  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCSLGGVA 125

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 126 FARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 185

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++LF   + F +         S  GT        W        IP+GL
Sbjct: 186 SEIAPKDLRGGLVSLFQLNVTFGIFL----GYCSVYGTRKYDNTAQWR-------IPVGL 234

Query: 243 CML--------------HMRYLARKHAKDKLRPEFETLN 267
           C L                RYL  +   ++ R     +N
Sbjct: 235 CFLWALIIIIGMLLVPESPRYLIERGKNEEARISIAKIN 273

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 3/72 (4%)

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
            +D IG    T   G +L  F       + W +A++IV  VI  V+AL  + ++E++Y+ 
Sbjct: 250 SMDWIGSF--TGVLGLILFNFVWNQAPADGWNSAYLIVLLVIS-VIALIAFGIYELRYAE 306

Query: 342 HPLTPWDLIKDR 353
           +PL P ++I++R
Sbjct: 307 NPLLPSEIIRNR 318

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%)

Query: 62  EQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
            +Y+  L +  + FS++L ++   LD  I           +S+ S    +     +    
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTA 86

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILE 181
            Q  + +LSDI GR S L+I+  F+ +G ++   A  +T F++      +G  G+  I  
Sbjct: 87  FQPLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISS 146

Query: 182 VIASD 186
           +  SD
Sbjct: 147 IAVSD 151

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 5/143 (3%)

Query: 283 LDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH 342
           +D IG +L  A  G +L+ F    G    W+ A+II   V+  V  L L+  +EVKY+  
Sbjct: 265 MDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIALLVVS-VFFLALFFTYEVKYAES 321

Query: 343 PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVS 402
           PL P ++ K+R +             + +   Y ++ L+   H S   A     +++   
Sbjct: 322 PLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIWG 381

Query: 403 VIVGTILGFILIKVRRTKPFILF 425
            +   I+G  + K+  +  FILF
Sbjct: 382 TVAAVIVGAFIKKI--SAAFILF 402

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 75/361 (20%), Positives = 143/361 (39%), Gaps = 29/361 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           A+  + +ARLS + G    +V  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L L +    F V + +   +  A  T+  W    W F + L    
Sbjct: 153 SLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGLCMLHMRYLARK-HAKDKLRPEFETLNNLDWKSFSIDIVFWKL----DLIGLLLVTAF 294
           L + +    Y     +  +K    F+ +++      S   V  +L    D++  +  TA 
Sbjct: 210 LAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAG 269

Query: 295 FGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKY--------SRHPLTP 346
           +   L+  T  GG    W +  +I   +IG V+ + + +V++ K         S  PL  
Sbjct: 270 WLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPLLS 327

Query: 347 WDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVG 406
           W+++ +R +             + +Q  Y      V   + +   +   A    + ++V 
Sbjct: 328 WEIMSNRSILLSNFTGFFSTVAYNVQMIYS-----VQFFQLVYGFSAWKAGLHLIPILVS 382

Query: 407 TIL-----GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGA 461
           T++     G +  K    KP ++FG +  ++  GL+      S  H   IG L L G   
Sbjct: 383 TVVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLILPGVAL 441

Query: 462 G 462
           G
Sbjct: 442 G 442

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query: 66  RPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIF 125
           R +  A +   +FL A    LDG I  T   +  S +++   +S +     + +A  Q  
Sbjct: 139 RRVVMASMCLGVFLAA----LDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPL 194

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIAS 185
           + +LSDIFGR  +LV S + + +G +I   +  +    +G     +G  G+  +  +  +
Sbjct: 195 YGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTT 254

Query: 186 DFSNLNWRLL 195
           D   L  R L
Sbjct: 255 DIVPLRSRAL 264

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 127/296 (42%), Gaps = 23/296 (7%)

Query: 68  LYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFA 127
           L  + ++  IFL A    LD  I  T  A   S +++   +S +     + +A  Q  + 
Sbjct: 96  LAMSSMYLGIFLSA----LDNTIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYG 151

Query: 128 RLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDF 187
           ++SDIFGR  +L    + + +G +I   A +     +G     +G  G+  +  +  SD 
Sbjct: 152 KISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDI 211

Query: 188 SNLNWRLLALFVPALPFIVNTWISGDV----TSAIGTNWKWGIGMWAFILPLACIPLGLC 243
             L  R L   V    + +   + G +    T  +G+ W+   G + F +PL+ I     
Sbjct: 212 IPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGS-WR---GAFLFQVPLSVISTVTV 267

Query: 244 MLHMRYLARKHAKDKLRPEFE-TLNNLDWKSFSIDIVFWKLDLI---GLLLVTAFFGCVL 299
           M+ ++       KD      E T++N    + +  I+  KL  I   G + +  F    +
Sbjct: 268 MVWLQL-----PKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSFM 322

Query: 300 VPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
           +  + AGG     K+   +   +I  V +   ++  E+K+++ P+ P   +KDR V
Sbjct: 323 I-LSSAGGSDISVKSNTFLYLTLIS-VTSFISFIYIELKFAKDPILPLVFLKDRSV 376

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%)

Query: 86  LDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           LDG I  T   Y  S +     +S +     + A + Q  + +LSDIFGR +IL+ S + 
Sbjct: 167 LDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLM 226

Query: 146 YSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
           + +G ++   A T+     G     +G  G+  +  +I SD   L  R
Sbjct: 227 FGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSR 274

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 12/165 (7%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   L+++   + VG +IE  ++       I R   G  
Sbjct: 123 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIG 182

Query: 168 FYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L +    F+ +    G  T +  T W+ G+G
Sbjct: 183 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLG 242

Query: 228 M-WAFILPLACIPLGLCML--HMRYLARKHAKDKLRPEFETLNNL 269
           + +A+ L   C+  G+  +    RYL  K   ++ +    T N L
Sbjct: 243 LQFAWCL---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKL 284

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 24/172 (13%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGC 167
           I  V +A+G +F ++L DI+GR + L+I ++ Y VG +I+  +V       I R   G  
Sbjct: 119 IFNVGSAIGCLFLSKLGDIYGRCTGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIG 178

Query: 168 FYQLGLTGVILILEVIASDFSNL---NWRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
              + +   +LI E             W+L+  F   L +  N    G  + +    W+ 
Sbjct: 179 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTNY---GTKSYSNSVQWRV 235

Query: 225 GIGM---WAFILPLACIPLGLCML---HMRYLARKHAKDKLRPEFETLNNLD 270
            +G+   WA I+      +G  M      R+L +    ++ R  F   N L 
Sbjct: 236 PLGLCFAWAIIM------IGGMMFVPESPRFLVQVKKTEEARASFAKSNKLS 281

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 77/172 (44%), Gaps = 24/172 (13%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLG 172
           I  V +A+G +F ++L DI+GR   L+I ++ Y VG +I+  +V    ++ +G     +G
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIG 182

Query: 173 LTGVILILEVIASDFSNLN--------WRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
              + ++  ++ S+ +  +        W+L+  F   L +  N    G  T +    W+ 
Sbjct: 183 AGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNY---GTKTYSNSVQWRV 239

Query: 225 GIGM---WAFILPLACIPLGLCML---HMRYLARKHAKDKLRPEFETLNNLD 270
            +G+   WA I+      +G  M      R+L +    ++ R  F   N L 
Sbjct: 240 PLGLCFAWAIIM------IGGMMFVPESPRFLVQVKKTEQARASFAKSNKLS 285

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 13/211 (6%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
            + + R + + G  S ++IS+  + VG+I+ + A ++    VG     +G +G+  +  +
Sbjct: 127 SLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMI 186

Query: 183 IASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTN--WKWGI-------GMWAFIL 233
           I         R + + V    F V++ I   +  A  T+  W+W         G  AF+ 
Sbjct: 187 IGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTHATWRWCFWISLPVGGSAAFLF 246

Query: 234 PLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTA 293
                P  L +        K  K     +F+ +    +K+   ++VF + DLIG  L   
Sbjct: 247 FFTYNPERLSITARLVRCLKLVKAIPLKQFQYVET--YKTIVRNLVF-RFDLIGFTLNCT 303

Query: 294 FFGCVLVPFTLAGGLKEEWKAAHIIVPEVIG 324
                L+  T  G     WK A ++   VIG
Sbjct: 304 GICLFLLGLTF-GSEDNSWKRAFVVCFLVIG 333

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y VG +I
Sbjct: 95  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 151

Query: 153 ESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR-----LLALFVPA---LP 203
              A +   ++A+G  F  LG+ G+ +   ++ S+ S  + R        L + A   + 
Sbjct: 152 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 211

Query: 204 FIVNTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 212 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 271

Query: 253 KHAKDKLRP 261
            +  D   P
Sbjct: 272 SNKIDVEDP 280

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y VG +I
Sbjct: 93  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 149

Query: 153 ESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR-----LLALFVPA---LP 203
              A +   ++A+G  F  LG+ G+ +   ++ S+ S  + R        L + A   + 
Sbjct: 150 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 209

Query: 204 FIVNTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 210 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 269

Query: 253 KHAKDKLRP 261
            +  D   P
Sbjct: 270 SNKIDVEDP 278

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 78/375 (20%), Positives = 148/375 (39%), Gaps = 27/375 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILI 179
           AV  + + R + I G    L+++V+ +  G+++ + A ++    VG     +G +G+  +
Sbjct: 94  AVLSLLWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTL 153

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L + + +  F V   +   +  A  T+  W    W F + L    
Sbjct: 154 CFVIGCTMVDERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINLPIGG 210

Query: 240 LGLCMLHMRYLAR-----KHAKDKLRP----EFETLNNLDWKSFSIDIVFWKLDLIGLLL 290
           L + M  + Y A+     +  K  LR     EF  L        +I+ + +K D  G  L
Sbjct: 211 LAVIMFLLTYDAKNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFAL 270

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVAL-----PLYMVWEVKYSRHPLT 345
            +      L+  T  GG K  W +  +I   V+G V+ +       ++  +    R  ++
Sbjct: 271 SSTGLVLFLLGLTF-GGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNIS 329

Query: 346 PWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIV 405
              L   R V                 G     +  V   + I +++   A    + +++
Sbjct: 330 YRPLFLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVI 389

Query: 406 GTIL-----GFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFG 460
             ++     G I  K+   KP ++FG    ++  GL+   + +S +    IG L L GF 
Sbjct: 390 TNVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQ-IGVLILPGFS 448

Query: 461 AGSFTYVTQASIQAS 475
            G   +  QAS+ ++
Sbjct: 449 LG---FALQASLMSA 460

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 85/208 (40%), Gaps = 20/208 (9%)

Query: 76  SIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S++L  +   LD  I  T  A+  S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 134 SMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGR 193

Query: 136 FSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLL 195
             +L+ S + +++G +I   +  +     G     +G  G+  +  +  SD   L  R L
Sbjct: 194 KPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGGGLTSMSSITTSDIVPLRNRAL 253

Query: 196 ALFVPALPFIVNTWISGDVT---SAIGTNWKWGIGMWAFI--LPLACIPLGLCMLHMRYL 250
              +    F + T   G V    S  G  W+      AF+  +PL  I    C L + YL
Sbjct: 254 YQGICNFFFGLGTACGGLVGGWFSEHGGGWR-----VAFLIQIPLCAIS---CSLIVAYL 305

Query: 251 ARKHA-------KDKLRPEFETLNNLDW 271
                        D+     E L  +DW
Sbjct: 306 ELPKGCKGSGIQSDEDNQISEKLRRIDW 333

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   LVI  + Y VG +I
Sbjct: 92  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 148

Query: 153 ESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR-----LLALFVPA---LP 203
              A +   ++A+G  F  LG+ G+ +   ++ S+ S  + R        L + A   + 
Sbjct: 149 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 208

Query: 204 FIVNTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGLCMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 209 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 268

Query: 253 KHAKDKLRP 261
            +  D   P
Sbjct: 269 SNKIDVEDP 277

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 24/172 (13%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGC 167
           I  V +A+G +F ++L DI+GR   L+I ++ Y VG II+  +V       I R   G  
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIIIQIASVDKWYQYFIGRIIAGIG 182

Query: 168 FYQLGLTGVILILEVIASDFSNL---NWRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
              + +   +LI E             W+L+  F   L +  N    G  + +    W+ 
Sbjct: 183 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTNY---GTKSYSNSVQWRV 239

Query: 225 GIGM---WAFILPLACIPLGLCML---HMRYLARKHAKDKLRPEFETLNNLD 270
            +G+   WA I+      +G  M      R+L +    ++ R  F   N L 
Sbjct: 240 PLGLCFAWAIIM------IGGMMFVPESPRFLVQVKKTEQARASFAKSNKLS 285

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 62/147 (42%), Gaps = 30/147 (20%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE--SQAVTIT 160
           S ++LL     + TVI   GQI F  ++DI GR  I  + +I   V TI++  + +    
Sbjct: 113 STNTLLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSI 169

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTS 216
            F     FY+    +G+ G   +  +I S+FS   WR                  G +  
Sbjct: 170 NFVAILTFYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 211

Query: 217 AIGTNWKWGI---GMWAFILPLACIPL 240
           A+  N  WG    G+ A IL  A  P+
Sbjct: 212 AVFANQAWGQILGGIVALILVAAYKPM 238

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 73/171 (42%), Gaps = 30/171 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE---SQAVTI 159
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  + +I     T+++     + +I
Sbjct: 97  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSI 153

Query: 160 TRFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR---LLALFVPA---------LP 203
              AV   FY+    +G+ G   +  +I S+FS   WR   + A+F            L 
Sbjct: 154 NFVAV-LTFYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLSCGILA 212

Query: 204 FIVNTWISGDVTSAIGTN------WKWGIGMWAFILPLACIPLGLCMLHMR 248
            I+     GD+  A   +       K    MW  ++   C+P GL  L+ R
Sbjct: 213 LILVAAYKGDLVGATTGDECGFECQKACDQMWRILVGFGCVP-GLIALYFR 262

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 72/170 (42%), Gaps = 44/170 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIES---QAVTI 159
           S  +LL     + TV   VGQ+ F  L+D+ GR  I    +I   V TI+++   QA  +
Sbjct: 99  STQTLLKVSTSVGTV---VGQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGL 155

Query: 160 TRFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVT 215
           + F     FY+    LG+ G   +  +I S+F+   WR                  G + 
Sbjct: 156 S-FTAMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR------------------GAIM 196

Query: 216 SAIGTNWKWGIGMWAFILPLACIPLGLCMLHMRYLARKHAKDKLRPEFET 265
            A+  N  WG  +++ I+ + CI                 KD+L+P +++
Sbjct: 197 GAVFANQAWG-QIFSGIVSIVCIAA--------------YKDQLKPAYDS 231

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 75/184 (40%), Gaps = 25/184 (13%)

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTIT 160
           Y  ++ +  +  I  +  AVG I  +RL D++GR   L+I  + Y VG II+ S      
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWY 147

Query: 161 RFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGT 220
           ++ +G     LG+ G+ ++  ++ S+ S  + R     V     ++   I     +  GT
Sbjct: 148 QYCIGRVISGLGVGGIAVLSPMLISETSPKHLR--GTLVSCYQLMITAGILLGYCANYGT 205

Query: 221 NWKWGIG-MWAFILPLACIPLGLCML--------------HMRYLARKHAKDKLRPEFET 265
             ++     W        IPLGLC L                RYL  K   ++ +    T
Sbjct: 206 KSRYDDSRQWR-------IPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLAT 258

Query: 266 LNNL 269
            N +
Sbjct: 259 SNKV 262

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 90/214 (42%), Gaps = 31/214 (14%)

Query: 88  GGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYS 147
           G   ++  AY  S+     ++S  N    V +A+G +F ++L DI+GR   L+I ++ Y 
Sbjct: 100 GNYSHSRNAYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCVGLIIVIVVYM 155

Query: 148 VGTIIESQAVT------ITRFAVGGCFYQLGLTGVILILEVIASDFSNL---NWRLLALF 198
           VG +I+  +V       I R   G     + +   +LI E             W+L+  F
Sbjct: 156 VGIVIQIASVDKWYQYFIGRIVAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 215

Query: 199 VPALPFIVNTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGLCML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 216 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 266

Query: 253 KHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLI 286
               +K +  F   N L   + +  +V  ++DL+
Sbjct: 267 VGRVEKAKASFAKSNKL---AIADSVVIAEIDLL 297

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%)

Query: 62  EQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
            +Y+  L +  + FS++L ++   LD  I           +S+ S    +     +    
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTA 86

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILE 181
            Q  + +LSDI GR S L+ +  F+ +G ++   A  +T F++      +G  G+  I  
Sbjct: 87  FQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISS 146

Query: 182 VIASD 186
           +  SD
Sbjct: 147 IAVSD 151

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 12/163 (7%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGCFYQLGL 173
           AVG +   +L DI+GR   L+++ I + +G +IE  +V       I R   G     + +
Sbjct: 127 AVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAV 186

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG---MWA 230
              +LI EV   +          L +    F+ N    G  + +    W+ G+G   +W+
Sbjct: 187 LSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLWS 246

Query: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKS 273
            I+  A +         RYL +K   ++ +      N +D  S
Sbjct: 247 IIMVCAMM---FVPESPRYLIQKGKTEQAKISIARSNKVDIDS 286

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 134/329 (40%), Gaps = 48/329 (14%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
           Q  + +LSD+ GR   ++ +  F+ +G ++   A ++T+FA+      +G  G+  +  +
Sbjct: 89  QPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSI 148

Query: 183 IASDFSNLNWRLL----ALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
             SD      R +    A  V  L  I+   I G     +G         W  +  L   
Sbjct: 149 TVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTLG---------WRILFGLQVP 199

Query: 239 PLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCV 298
            + LC      L  K+   KL           W + S      ++D++G           
Sbjct: 200 TILLC----SSLVHKNVNIKLSHLLPVEERFKWSNLS------RIDILG--------SST 241

Query: 299 LVPFTLAGGL---KEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
           LV FT++G L     E   A + +  VI ++     +++ E+ YS+  + P++L+K    
Sbjct: 242 LV-FTISGVLFLCSTELNKALLSIFTVISFIA----FILIELYYSKERIMPFELLKGS-- 294

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIK-SATRITALYSFVSVIVGTI-LGFIL 413
                        + + GD   + + + + + +  + T    L+  +SV VG++  G+IL
Sbjct: 295 -FGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGWIL 353

Query: 414 IKVRRTKPFILFGISCWIVSFGLLVHYRG 442
              R TK   L   + WIV+ G+ +   G
Sbjct: 354 ---RHTK-MKLSHCAYWIVTIGMSIQLLG 378

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 66/147 (44%), Gaps = 20/147 (13%)

Query: 67  PLYRAGLFFSIFLI-------AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN 112
           PL  +G+ + I ++        Y  G D G    F+A       + ++S      LS V 
Sbjct: 60  PLVPSGINWGICILCLMVAFGGYISGWDSGTIGGFEAHTDFLARFGSTSGEGKRYLSKVR 119

Query: 113 -----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGG 166
                 +  V  A+G  F  RL DI+GR   L+++ + + +GT+I+  +V    ++ +G 
Sbjct: 120 TGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGR 179

Query: 167 CFYQLGLTGVILILEVIASDFSNLNWR 193
               LG   + ++  ++ S+ S  N R
Sbjct: 180 IIAGLGCGLIAILSPMLISEVSPKNMR 206

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 94/229 (41%), Gaps = 31/229 (13%)

Query: 81  AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D G    F+A       + ++S S    LS V       +  V  A+G  F  R
Sbjct: 74  GYISGWDSGTIGGFEAQTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGSFFLGR 133

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDF 187
           L DI+GR   L+++   + VGT+I+  +V    ++ +G     LG   + ++  ++ S+ 
Sbjct: 134 LGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLISEV 193

Query: 188 SNLNWRLLALFVPALPFIVNTWIS-----GDVTSAIGTNWKWGIGMWAFILPLA-CIPLG 241
           S  N R   +    L   +  ++      G       T W+ G+G     L  A C+ + 
Sbjct: 194 SPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQWRVGLG-----LQFAWCLCMI 248

Query: 242 LCMLHM----RYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLI 286
           + ML +    R+L  K   ++ +      N +   S    +  W+LD I
Sbjct: 249 VAMLFVPESPRFLVEKGRIEEAKRSIGKSNGV---SPDDPVTLWELDEI 294

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 57/137 (41%)

Query: 57  IEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKT 116
           +E    +Y+  L +  + FS++L ++   LD  I           +S+ S    +     
Sbjct: 22  LEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFL 81

Query: 117 VIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGV 176
           +     Q  + +LSDI GR   L+ +  F+ +G ++   A  +T F++      +G  G+
Sbjct: 82  LTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGL 141

Query: 177 ILILEVIASDFSNLNWR 193
             I  +  SD      R
Sbjct: 142 NAISSIAVSDICTARER 158

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 71/171 (41%), Gaps = 24/171 (14%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGC 167
           I  V +A+G +F ++L DI+GR   LVI ++ Y VG +I+  +V       I R   G  
Sbjct: 120 IFNVGSAIGCLFLSKLGDIYGRCMGLVIVIVVYMVGIVIQIASVDKWYQYFIGRIVAGVG 179

Query: 168 FYQLGLTGVILILEVIASDFSNL---NWRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
              + +   +LI E             W+L+  F   L +  N    G  + +    W+ 
Sbjct: 180 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTNY---GTKSYSNSIQWRV 236

Query: 225 GIGM---WAFILPLACIPLGLCML---HMRYLARKHAKDKLRPEFETLNNL 269
            +G+   WA I+      +G  M      R+L +    +K +  F   N L
Sbjct: 237 PLGLCFAWAIIM------IGGMMFVPESPRFLVQVGRVEKAKASFAKSNKL 281

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 50/108 (46%)

Query: 86  LDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIF 145
           LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   L+   I 
Sbjct: 117 LDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIV 176

Query: 146 YSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
           ++VG  +   + +I + A+      +G +G   +  +I SD + L+ R
Sbjct: 177 FAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSER 224

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 85/364 (23%), Positives = 150/364 (41%), Gaps = 34/364 (9%)

Query: 124 IFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVI 183
           + + R + I G  S L++S++ +  G++I + + ++     G     +G +G+  +  VI
Sbjct: 171 LLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVI 230

Query: 184 ASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243
           AS  +    R++ + V +  + V   +   +  A+ T+  W    W F + L    L   
Sbjct: 231 ASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFV 287

Query: 244 MLHMRY--LARKHAKDKL---RPEFET-LNNLDWKSFSIDIVFW---KLDLIGLLLVTAF 294
           +L M Y    RK  KD     +  +   +  L    F   I  W   ++D +G +L TA 
Sbjct: 288 VLAMVYNPSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAG 347

Query: 295 FGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVA----------LPLYMVWEVKYSRHPL 344
           F  +L+  T  G +   W +  IIV  V+G ++            P +       S  PL
Sbjct: 348 FTLLLLGLTFGGSM-YAWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPL 406

Query: 345 TPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVI 404
            PW ++   G+             +  Q      V  V   + ++ A+  TA    +S+ 
Sbjct: 407 LPWRVVSRPGIFTSNTAVFLGCIAYSAQ-----IVYAVQFFQLVRGASAWTASIHLLSLD 461

Query: 405 VGTIL-GFILIKVRRT----KPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGF 459
           V  I+   +   V RT    KP ++ G+   +V  GLL     +SG+    IG L L G 
Sbjct: 462 VSDIITVVVGGVVNRTTGHVKPILVTGVVAGVVGAGLLTLLNNESGSSRH-IGLLILPGV 520

Query: 460 GAGS 463
            +G+
Sbjct: 521 ASGA 524

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 6/121 (4%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   L+++ + + VG +IE  ++       I R   G  
Sbjct: 124 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIG 183

Query: 168 FYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L +    F+ +    G  T +  T W+ G+G
Sbjct: 184 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLG 243

Query: 228 M 228
           +
Sbjct: 244 L 244

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 18/139 (12%)

Query: 73  LFFSIFLIAYAYG----------LDGGIRYT--FQAYATSSYSQHSLLSTVN-----CIK 115
           LF SI  +  A+G          + G +R T   + + ++     S LS V       I 
Sbjct: 84  LFVSICCLMVAFGGFVFGWDTGTISGFVRQTDFIRRFGSTRADGTSYLSDVRTGLMVSIF 143

Query: 116 TVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLT 174
            +  A+G I  +RL D++GR   L+  V+ YSVG II+  ++    ++ +G     LG+ 
Sbjct: 144 NIGCAIGGIVLSRLGDMYGRKIGLMSVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVG 203

Query: 175 GVILILEVIASDFSNLNWR 193
           G+ ++  ++ S+ S    R
Sbjct: 204 GITVLAPMLISEVSPKQLR 222

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 80/192 (41%), Gaps = 34/192 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQI F  ++DI GR  I  + +I     T+++     S AV
Sbjct: 96  STTTLLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAV 152

Query: 158 TITRFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR---LLALFVPALPFIVNTWI 210
           +   F     FY+    +G+ G   +  +I S+FS   WR   + A+F       ++  I
Sbjct: 153 S---FVAVLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGI 209

Query: 211 SGDVTSA--------IGTNWKWGI-------GMWAFILPLACIPLGLCMLHMRYLARKHA 255
              V  A        + T  + GI        MW  ++ L C+P G+  L+ R    +  
Sbjct: 210 VALVLVAAYKNQLIDVNTGAECGIECAKACDQMWRILVGLGCVP-GVVALYFRLTIPESP 268

Query: 256 KDKLRPEFETLN 267
           + +L    E  N
Sbjct: 269 RYQLDVHVEAEN 280

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 55/121 (45%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L      +DG I  T      S + + SL++ V     +     Q  + + SD+
Sbjct: 53  VLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDL 112

Query: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192
            GR   L+ + + + +G ++   A T+   A+      +G +G+  +  +I SD + L+ 
Sbjct: 113 LGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQ 172

Query: 193 R 193
           R
Sbjct: 173 R 173

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 281 WKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYS 340
           +K+D IG  +    FG +L  F         W +A+IIV  ++  VVAL  ++ +E++++
Sbjct: 244 YKMDWIGSAI--GVFGLILFNFVWNQAPIAGWGSAYIIVLLIVA-VVALIAFITYEIRFA 300

Query: 341 RHPLTPWDLIKDR 353
           + PL P  ++ +R
Sbjct: 301 KQPLLPHSVLFNR 313

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLG 172
           I  V +A+G +F ++L DI+GR   L+I ++ Y VG +I+  ++    ++ +G     +G
Sbjct: 123 IFNVGSAIGCLFLSKLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIG 182

Query: 173 LTGVILILEVIASDFSNLN--------WRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
              + ++  ++ S+ +  +        W+L+  F   L +  N    G  T +    W+ 
Sbjct: 183 AGSISVLAPMLISETAPKHIRGTLLACWQLMVTFAIFLGYCTNY---GTKTYSNSVQWRV 239

Query: 225 GIGM---WAFIL 233
            +G+   WA I+
Sbjct: 240 PLGLCFAWAIIM 251

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 88/214 (41%), Gaps = 22/214 (10%)

Query: 75  FSIFLIAYAYGLDGGI----RYTFQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIF 125
           F  F++ +  G  GG      +  +  +T+   +H  LS V       I  +  A+G + 
Sbjct: 77  FGGFMMGWDIGTIGGFIAQPDFKRRFGSTTKEGEH-YLSKVRTGLLVSIFNIGCAIGSVT 135

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGCFYQLGLTGVILI 179
             RL DI+GR   L+++   + VG +IE  ++       I R   G     + +   +LI
Sbjct: 136 LGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAILSPMLI 195

Query: 180 LEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGM-WAFILPLACI 238
            EV   +          L +    F+ +    G  T +    W+ G+G+ +A+ L   C+
Sbjct: 196 SEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGLQFAWCL---CM 252

Query: 239 PLGLCML--HMRYLARKHAKDKLRPEFETLNNLD 270
             G+  +    RYL  K   ++ +    T N L+
Sbjct: 253 VGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLN 286

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 13/121 (10%)

Query: 81  AYAYGLDGGIRYTF-------QAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y YG D G    F       + +    +     LS V       I  +  A+G + F+R
Sbjct: 80  GYVYGWDTGTISGFVSQTDWIRRFGQKHHDGTHYLSKVRTGLLLAIFNIGCAIGGLLFSR 139

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDF 187
           L DI+GR   LV   + Y VG II   ++    ++ +G     +G+ G+ +   ++ S+ 
Sbjct: 140 LGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAVYSPLLISEV 199

Query: 188 S 188
           S
Sbjct: 200 S 200

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAV--TIT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I   V TI+++        
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 95/223 (42%), Gaps = 34/223 (15%)

Query: 75  FSIFLIAYAYGLDGGIRY--TFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQI 124
           F  F++ +  G  GG+    +F+ +  + Y+  +        LL  +  I  V  A+G +
Sbjct: 64  FGGFILGWDIGTIGGLMNMPSFKNHFGTRYNASTGLNEFPNLLLGLIIGIFNVACALGGL 123

Query: 125 FFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVI 183
             A++ D  GR   + +S++ Y  G +IE ++     +F +G  F  +G+  + +++ + 
Sbjct: 124 TLAKVGDFKGRKVGIAVSLLVYVFGVVIELAKPTHWGQFFIGRIFTGVGVGSLTVLVPMY 183

Query: 184 ASDFSNLNWRLLALFVPALPFIVNTWIS-----------GDVTSAIGTNWKWGIG---MW 229
            ++ S +  R   + +  L   V   +            GD+ S    +W+  I    MW
Sbjct: 184 VAEISPVRIRGSMVVLFQLNITVGVLVGNFVNYGCKKGFGDILSK--KHWQVPIALGPMW 241

Query: 230 AFILPLACIPLGLCML--HMRYLARKHAKDKLRPEFETLNNLD 270
           A     A + LGL M+     YLA K    +    F  +N L+
Sbjct: 242 A-----AVVLLGLVMIPESSHYLASKDKIKEAERSFAVMNALE 279

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 97/236 (41%), Gaps = 24/236 (10%)

Query: 70  RAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           R  +  S+++  +   +D  I        T  + +   +  V     + + V Q  + +L
Sbjct: 46  RLPMLLSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKL 105

Query: 130 SDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSN 189
           SD+ GR  +LV++   + +G ++ + A  I  FA G     +G  G+  +  +   D  +
Sbjct: 106 SDVTGRRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFS 165

Query: 190 LN----WRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCML 245
           +     ++  A  +  +  ++   I G     +G         W  I  LA +P+    +
Sbjct: 166 VKEQSIYQSYAHIIYTIGEVLGAPIGGIALETVG---------WRAIF-LAQVPVLTICI 215

Query: 246 HMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIG-LLLVTAFFGCVLV 300
           ++       A+  + P  E    L WK+ S      ++DL G +LL+ +  G +L+
Sbjct: 216 YLTLCDDDLAQQHIPPHGE---RLTWKNIS------RMDLSGSILLIISLCGVILL 262

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAV--TIT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I   V TI+++        
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp,
           53 aa] {OFF}  YCL073C (HSP)
          Length = 53

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 94  FQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVI 144
           F  Y TS+YS+H   S+ +   ++++   QI F+ LSD F R  +  ++ I
Sbjct: 5   FTGYTTSAYSEH---SSQHFNPSILSEFSQITFSSLSDYFRRLELSAVATI 52

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 274 FSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYM 333
           FS+D +   L +IGL+L+   +    +           W  A+IIV  +I  V+ L L+ 
Sbjct: 274 FSMDWIGSGLGVIGLVLLNLVWNQAPI---------SGWNQAYIIVLLIIS-VLFLVLFG 323

Query: 334 VWEVKYSRHPLTPWDLIKDR 353
           V+E+ +++ PL P  ++KDR
Sbjct: 324 VYEIHFAKSPLLPQAVMKDR 343

>KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P32466 Saccharomyces cerevisiae
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily expression is induced in
           low or high glucose conditions
          Length = 567

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 10/125 (8%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVIL 178
           A+G I   +L +++GR   L I VI YSVG II+  ++    ++ +G     LG+  + +
Sbjct: 125 AIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASIDKWYQYFIGRIISGLGVGAITI 184

Query: 179 ILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ S  + R     V    F+V   I     +  GT        W        +
Sbjct: 185 LSPMLISEVSPKHLR--GTLVSCYQFMVTGGIFLGYCTNYGTKRYSNSVQWR-------V 235

Query: 239 PLGLC 243
           PLGLC
Sbjct: 236 PLGLC 240

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 10/89 (11%)

Query: 75  FSIFLIAYAYGLDGGIRY--TFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQI 124
           F+ F + +  G  GG+    +FQ    +SY            LL  +  I  +  AVG +
Sbjct: 65  FAGFTLGWDIGTIGGMTSMESFQNRFGTSYDSQRGVQYFPDLLLGLIISIFNIGCAVGSV 124

Query: 125 FFARLSDIFGRFSILVISVIFYSVGTIIE 153
             A+L+D FGR + L ++VI Y +G +I+
Sbjct: 125 TLAKLADWFGRKTGLYVTVIIYVIGLLIQ 153

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 6/134 (4%)

Query: 296 GCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355
           G +L  F    G  + W   +II   ++  V  L  + ++E+K+++ PL P ++IK+R +
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFIL-I 414
                        + +   Y Y   +   H S   A        F+ VI GTI  F++ +
Sbjct: 341 GMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF----FMFVIWGTIAAFLVAL 396

Query: 415 KVRRTKPFILFGIS 428
            ++R  P +L   S
Sbjct: 397 TIKRVGPSVLLCFS 410

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 82/386 (21%), Positives = 152/386 (39%), Gaps = 49/386 (12%)

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
            R++ + G  +  + +++ + VG+++ + A ++     G     +G +GV  ++ VI+S 
Sbjct: 99  GRIATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISST 158

Query: 187 FSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCMLH 246
                 R L + V +  F + + +   +  A  T+  W    W F + L    L   +  
Sbjct: 159 LVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVTW---RWCFYINLPVGGLAFFLFL 215

Query: 247 MRYLARKHAKDKLRPEFETLNNLDW--------------KSFSIDI-------------- 278
             Y   K   +K   E E + N                 KS  + +              
Sbjct: 216 TFYNPEKWVVNKDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGTWRIIAR 275

Query: 279 -VFWKLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALP------- 330
            +F++ D++  + +T     +L+ FT  GG K +W +   I   V+G +  L        
Sbjct: 276 ELFYRFDIVEFVFMTLGSVLILLAFTF-GGNKYKWNSGSTISMFVLGILFTLGAFVYDFF 334

Query: 331 LYMVWE-VKYSRH--PLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES 387
           +Y  +E VK   H  PL  W++ K  GV             + +Q +Y+     +  +++
Sbjct: 335 IYPKFEAVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLVFNDT 394

Query: 388 I-KSATRITALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGA 446
             K+A  + A    V + V +  G +  K    KP  +F     I+  GLL     +  +
Sbjct: 395 AWKAAIHLIATVVPVVITVVS-SGIVNSKTGYVKPIAIFSGVTGIIGAGLLTLLD-NHAS 452

Query: 447 HAGIIGSLCLLGFGAGSFTYVTQASI 472
            A  IG L L G    +F  + Q+SI
Sbjct: 453 SAKKIGLLILPGV---TFGAIMQSSI 475

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 81  AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D G    F+A       + ++S      LS V       +  V  A+G  F  R
Sbjct: 84  GYISGWDSGTIGGFEAQTDFLARFGSTSSDGTRYLSKVRTGLLTSMFNVGQAIGSFFLGR 143

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDF 187
           L DI+GR   L+++ + +  GTII+  ++    ++ +G     LG   + ++  ++ S+ 
Sbjct: 144 LGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCGLIAILSPMLISEV 203

Query: 188 SNLNWR 193
           S  N R
Sbjct: 204 SPKNMR 209

>TBLA0A06370 Chr1 complement(1565642..1566370) [729 bp, 242 aa] {ON}
           Anc_4.260 YDL069C
          Length = 242

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 233 LPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDI 278
           LPLA +PL +  LH + L R+HA++  R E +  N L+ + ++I+I
Sbjct: 27  LPLANVPLKIPSLHPKILERQHAQNIKRIE-KFKNTLNLQDYNINI 71

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 48/104 (46%)

Query: 62  EQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
           ++++R L +A +  S++L ++   +D  I           + +      +     +  A 
Sbjct: 35  QEHNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAA 94

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVG 165
            Q  + R SDI GR   L+I+  F+ +GT++   A  +T FA+ 
Sbjct: 95  FQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIA 138

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 13/121 (10%)

Query: 81  AYAYGLDGG-----------IRYTFQAYATSSYSQHSLLSTVN-CIKTVIAAVGQIFFAR 128
            Y YG D G           IR   Q  A  +Y    + + +   I  +  A+G + F+R
Sbjct: 81  GYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNIGCAIGGLAFSR 140

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDF 187
           L DI+GR   LV   I Y VG +I   ++    ++ +G     +G+ G+ +   ++ S+ 
Sbjct: 141 LGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGIAVYSPLLISEV 200

Query: 188 S 188
           S
Sbjct: 201 S 201

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 51/109 (46%)

Query: 85  GLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVI 144
            LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   L+   +
Sbjct: 74  ALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEV 133

Query: 145 FYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
            +++G ++ + A TI + A+      +G +G   +  ++ +D   L+ R
Sbjct: 134 IFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVR 182

>TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {ON}
           Anc_8.521 YBR207W
          Length = 455

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTIT 160
           S S+H     ++ I +VI +V  +FF R+  +  +F + + S+I+   G ++E QAV  +
Sbjct: 153 SVSEHYYEGILSIIASVIISVMGLFFLRMGKLREKFRVKLASMIYSEHGNLLERQAVNDS 212

Query: 161 RFAV 164
           +  V
Sbjct: 213 KNVV 216

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 87/213 (40%), Gaps = 37/213 (17%)

Query: 73  LFFSIFLIAYAYGLDGGIRYTFQAYAT------------SSYSQHSLLSTVNCIKTVIAA 120
           +FF I    + YG D G    F A+              + Y  +     +  I  +  A
Sbjct: 143 IFFCIAFGEFIYGWDTGTISGFVAFDNFLENFGEKRKDDTYYLSNVRTGLIVAIFNIGCA 202

Query: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTIT-------RFAVGGCFYQLGL 173
           VG IF +++ DI+GR     I +IF +V  II  Q + IT       ++ +G     L +
Sbjct: 203 VGGIFLSKIGDIYGR----KIGIIFMNVIYII-GQLICITSMKHKWYQYTIGRIISGLAV 257

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPA--------LPFIVNTWISGDVTSA-----IGT 220
            G + ++ +  ++ +  + R LA+ V          L +  N  +    T+A     +G 
Sbjct: 258 GGFMTLIPIFLAETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGL 317

Query: 221 NWKWGIGMWAFILPLACIPLGLCMLHMRYLARK 253
            + W I ++A +L     P  LC      LA+K
Sbjct: 318 TFAWAILLFAGVLVTPESPRYLCECKKIELAKK 350

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 92/234 (39%), Gaps = 35/234 (14%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
           Q  + +LSDI GR   ++ S  F+ +G  +   A  IT+F++      +G  GV  +  +
Sbjct: 92  QPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSI 151

Query: 183 IASDFSNLNWRLL----ALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
             SD  +   R +    A  V  L  ++   + G    ++G         W  I  +   
Sbjct: 152 TVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFIDSVG---------WRVIFGVQVP 202

Query: 239 PLGLC-MLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGC 297
            L LC  L  R +  K A    R E        WK+ S   +F  L L+G +    F   
Sbjct: 203 MLLLCSTLATRNINVKLAHIPPRKE-----RFTWKNLSRIDIFGSLALVGTISSLLF--- 254

Query: 298 VLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            L   TL              +   +  + +  L++  E+ Y++  + P+DL+K
Sbjct: 255 -LTSTTLNK------------IVLTLSMIASFILFIWIELYYAKERILPFDLLK 295

>SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P53387 Kluyveromyces lactis
           KHT2 Hexose transporter 2
          Length = 571

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLG 172
           I  V  AVG +  ++L DI+GR   L+   I Y VG +I+  +V    ++ +G     LG
Sbjct: 125 IFNVGCAVGGLVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLG 184

Query: 173 LTGVILILEVIASDFSNLN--------WRLLALFVPALPFIVNTWISGDVTSAIGTNWKW 224
           + GV ++  ++ S+ +  +        W+L+  F   L +  N    G  +      W+ 
Sbjct: 185 VGGVCVLAPMLISETAPKHLRGTLLACWQLMVTFAIFLGYCANY---GTKSYDNSVQWRV 241

Query: 225 GIGM---WAFIL 233
            +G+   WA I+
Sbjct: 242 PLGLCFAWAIIM 253

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAV 157
           A+G  F  RL D++GR   ++I+ I + VGTII+  +V
Sbjct: 131 AIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASV 168

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 63/156 (40%), Gaps = 7/156 (4%)

Query: 71  AGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           A +F  IFL A    LD  I  T   +  S  +    +S V        A+ Q  F + S
Sbjct: 85  ASMFLGIFLAA----LDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCAIFQPLFGKTS 140

Query: 131 DIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNL 190
           D+FGR  +L+ S + +  G +    + TI    +G     +G  G+  +  +I +D   L
Sbjct: 141 DVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTSMCTIIINDIVPL 200

Query: 191 NWRLLALFVPALPFIVNTWISGDVT---SAIGTNWK 223
             R +      L + + T   G V    S  G  W+
Sbjct: 201 RNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWR 236

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVIL 178
           AVG IF ++ +D++GR   L+I  + Y +G +++ S      ++ +G     LG+ G+ +
Sbjct: 111 AVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVISGLGVGGIAV 170

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S  + R
Sbjct: 171 LSPMLISETSPKHLR 185

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 6/135 (4%)

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           V A  G +L  F         W  A+II   +I  V  L  + V+EVKY++ PL P  + 
Sbjct: 272 VLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAKVPLLPHAVT 330

Query: 351 KDRGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410
           K+R +             W   G + +  +   ++    S       Y FV VI GTI  
Sbjct: 331 KNRHM---IMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FVFVIFGTIAA 386

Query: 411 FIL-IKVRRTKPFIL 424
           F++ + ++R  P  L
Sbjct: 387 FMVALSIKRVGPAFL 401

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 75  FSIFLIAYAYGLDGGIRYT---FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFF 126
           F  F++ +  G  GG        + + +++ +    LS V       +  V  ++G  F 
Sbjct: 68  FGGFILGWDTGTIGGFESHTDFLRRFGSTNKNGEHYLSKVRTGLLTSMFNVGCSIGSFFL 127

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAV 157
            RL D++GR   L+I+   + VGTII+  +V
Sbjct: 128 GRLGDMYGRRIGLIIATTIFIVGTIIQVASV 158

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 8/91 (8%)

Query: 75  FSIFLIAYAYGLDGGI--------RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFF 126
           F  F++ +  G  GG         R+  +    S Y     +  +  I  +  A+G +F 
Sbjct: 55  FGGFILGWDTGTIGGFMAQTDFIRRFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFL 114

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAV 157
            RL D  GR   +V++V  Y VG +I+  +V
Sbjct: 115 GRLGDTIGRRKGIVVAVSIYMVGIVIQIASV 145

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 89  GIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSV 148
           G  Y  +A    +  + SL+S++  +    A  G I    LS+ FGR   LVIS IFY++
Sbjct: 115 GASYGMKASLKLTSDEDSLISSLMPLG---AVGGSILLTPLSEYFGRKVALVISCIFYTI 171

Query: 149 GTIIESQAVTITRFAVG 165
           G I+ + A  +     G
Sbjct: 172 GGILCAAAQDVHTMYAG 188

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 34/145 (23%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII-----ESQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I   V +++     ES+A+
Sbjct: 88  STATLLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAI 144

Query: 158 TITRFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGD 213
               F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 145 ---NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 183

Query: 214 VTSAIGTNWKWGIGMWAFILPLACI 238
           +  A+  N  WG  + A I+ L C+
Sbjct: 184 IMGAVFANQAWG-QIAAGIVALVCV 207

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITR- 161
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I     TI+++   TI R 
Sbjct: 103 STQTLLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQT---TIGRS 156

Query: 162 ----FAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
               F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 157 PGINFPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 196

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 282 KLDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSR 341
           K+D IG LL     G +L+ F         W  A+IIV  ++  V  L  + ++E+K + 
Sbjct: 269 KMDWIGSLL--GVIGLILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYELKKAE 325

Query: 342 HPLTPWDLIKDRGV 355
            PL P ++ K+R +
Sbjct: 326 SPLLPPEVTKNRHI 339

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVIL 178
           A G +   +L DI+GR   L+I ++ Y VGTII+ S      ++ +G   Y  G+ GV +
Sbjct: 129 AFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSV 188

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 189 LAPMLISE 196

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 101/234 (43%), Gaps = 34/234 (14%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
           Q  + RLSDI GR    +I   F+ +G+ + + + T+ +FA+      +G  G+  +  +
Sbjct: 118 QPLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSI 177

Query: 183 IASDFSNLNWRLL-----ALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLAC 237
             SD   +  R +      +F  A   I    I G +   IG  W+    ++AF +P+  
Sbjct: 178 AVSDICTVKERGMYQGYANIFYGAGQLI-GAPIGGLLIDRIG--WR---ALFAFQVPMVA 231

Query: 238 IPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGC 297
           + +    L   YL  K A   L P+ E      WK  S      KLD+ G + +    G 
Sbjct: 232 VAM---FLSFTYLNIKLA--HLPPKEE---RYKWKHLS------KLDIFGSITLVITIGI 277

Query: 298 VLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIK 351
            +V  +   GL         +V   +G +++  L+++ E  Y++H + P   ++
Sbjct: 278 CIVILS-DNGLNR-------MVLGAMG-LLSFGLFLIIEKYYTKHQILPLKCLQ 322

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVIL 178
           A+G +  ++L DIFGR   L+  V  Y VGTII+ S +    ++ +G   Y  G+ GV +
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSV 185

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 186 LAPMLISE 193

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 58/142 (40%)

Query: 52  PGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTV 111
           P     E   + +  P     +  S++L      +DG I  T      S + + S ++ V
Sbjct: 29  PDTGEEEDLEKDFRDPNTFPYILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWV 88

Query: 112 NCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQL 171
                +     Q  + + SD+ GR   L+ + + + VG ++   A TI    V      +
Sbjct: 89  ATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGV 148

Query: 172 GLTGVILILEVIASDFSNLNWR 193
           G +G+  +  +I SD + L+ R
Sbjct: 149 GGSGLGAMCNIILSDLAPLSQR 170

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 70/175 (40%), Gaps = 34/175 (19%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLG 172
           I  V  A+G I  +R+ D++GR   L+  VI Y VG +I+  +     ++ +G     LG
Sbjct: 122 IFNVGCAIGGIILSRIGDVYGRRVGLITVVIIYVVGILIQICSFDKWYQYFIGRIISGLG 181

Query: 173 LTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWIS-----GDVTSAIGTNWKWGIG 227
           + G+ ++  ++ S+ S    R   +    L   +  ++      G  T +  T W+    
Sbjct: 182 VGGISVLSPMLISEVSPKEMRGAMVSSYQLMITLGIFLGYCCNYGTKTYSDSTQWR---- 237

Query: 228 MWAFILPLACIPLGLC----------MLHM----RYLARKHAKDKLRPEFETLNN 268
                     +PLGLC          ML +    RYL      D+ R     +N 
Sbjct: 238 ----------VPLGLCFAWALFMIGGMLFVPESPRYLIEAGKHDEARRSLARVNK 282

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAV--TIT 160
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I     TI+++        
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAI 158

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 76/371 (20%), Positives = 153/371 (41%), Gaps = 46/371 (12%)

Query: 123 QIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEV 182
            + + R + + G  + + +S+  + VG+I+ + A ++    VG     +G +G+  +  V
Sbjct: 110 SLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLV 169

Query: 183 IASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           I S       R + + +    F   + I   V  A  T+  W    W F + L   P+G 
Sbjct: 170 IGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVIW---RWCFWINL---PIGA 223

Query: 243 CMLHMRYLA----RKHAKDKLRPEFETLNNLD------WKSFSI--DIVFWKLDLIGLLL 290
               + Y      R  A  +    F+++  L       W+++      + ++ D++G   
Sbjct: 224 VTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVGF-- 281

Query: 291 VTAFFG-CVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEV-----------K 338
            T   G C+L+     GG  + WK+A +I   ++G+++++ L +V++             
Sbjct: 282 ATGCAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSV-LSVVYDFYIFDKINPEPSN 340

Query: 339 YSRHPLTPWDLIKDRGVXXXXXXXXXXXXXWYMQGDYMYTV---LVVAVHESIKSATRIT 395
            S  P+    L+ +R +             +   G  +Y+V    +V    +  +   + 
Sbjct: 341 LSFRPMLVKGLLNNRFILLPNLVTCASAIAF--SGYMLYSVQFFQLVMGSSAWNAGLHLI 398

Query: 396 ALYSFVSVIVGTILGFILIKVRRTKPFILFGISCWIVSFG---LLVHYRGDSGAHAGIIG 452
            L    S++   I G I+ K  + KP ++  +S  ++  G   LL ++ G+S      IG
Sbjct: 399 PLV-IASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSGNSMQ----IG 453

Query: 453 SLCLLGFGAGS 463
              L GFG G+
Sbjct: 454 VWILPGFGLGA 464

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT 150
           R+  Q    S Y        +  I  +  A+G I F++L D +GR   LVI  I Y VG 
Sbjct: 87  RFGMQHPDGSYYFSKVRTGLIVSIFCIGCAIGGIVFSKLGDQYGRRIALVIVTIVYMVGI 146

Query: 151 IIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
           +I   ++    ++ +G     LG+ G+ +   ++ S+ S  + R
Sbjct: 147 LISIASIDKWYQYFIGRIIAGLGVGGIAVYSPLLISEVSPKHLR 190

>NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 1/104 (0%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT 150
           R+  + +  + Y     +  +  I  +  A G I  A+  DI+GR   L+I V  Y VG 
Sbjct: 98  RFGQKHHNGTHYLSKVRMGLMVSIFNIGCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGI 157

Query: 151 IIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
           +I+  +V    ++ +G     LG+ G+ ++  ++ S+ S  + R
Sbjct: 158 VIQIASVKAWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHMR 201

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 122 GQIFFARLSDIFGRFSILVISVIFYSVGTII 152
           G I    LS+ FGR   LV+S IFY+VG I+
Sbjct: 153 GSILLTPLSETFGRKKALVMSCIFYTVGAIV 183

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query: 81  AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D G    F++       + ++S S    LS V       +  V  A+G  F  R
Sbjct: 79  GYISGWDSGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGCFFLGR 138

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDF 187
           L DI+GR   L+++ + + +G++I+  +V    ++ +G     +G   + ++  ++ S+ 
Sbjct: 139 LGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIGRIVAGIGCGLIAILSPMLISEV 198

Query: 188 SNLNWR 193
           S  N R
Sbjct: 199 SPKNMR 204

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 19/102 (18%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQA------ 156
           S  +LL     + TV    GQ+ F  L+D+ GR  I  + +I   V TI++  A      
Sbjct: 90  STTTLLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAV 146

Query: 157 -----VTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
                +T  R  +G     +G+ G   +  +I S+FS   WR
Sbjct: 147 NFVAILTTYRIVMG-----IGIGGDYPLSSIITSEFSTTKWR 183

>CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {ON}
           highly similar to uniprot|P38695 Saccharomyces
           cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3
          Length = 588

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVIL 178
           A+G I  ++L DI+GR   LV  V+ Y++G +I+  ++    ++ +G     LG+ G+ +
Sbjct: 145 AIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFIGRIISGLGVGGIAV 204

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S    R
Sbjct: 205 LSPMLISEVSPKQLR 219

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 30/231 (12%)

Query: 123 QIFFARLSDIF-GRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILE 181
           Q  + +LSD+  GR    +I+  F+ +G II   A  +T+FA+G     +G  GV  +  
Sbjct: 92  QPLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSS 151

Query: 182 VIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLG 241
           +  SD      R +      + F     +   +   + T   W   ++A  +P+A     
Sbjct: 152 IAVSDICTAKERGMYQGYANIVFGSGQLLGAPLGGLLITTIGWR-AIFAIQVPMAL---- 206

Query: 242 LCM-LHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIG-LLLVTAFFGCVL 299
            CM L  R +  K A    R E  TL NL            +LDL+G   LV +  G + 
Sbjct: 207 FCMFLTGRNVNIKLAHLPSRNERFTLKNLS-----------RLDLLGSCTLVLSISGLL- 254

Query: 300 VPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
             F  +  +   W +A  I        V   +++  E  +++  + P+DL+
Sbjct: 255 --FLFSTSMNRTWISAFTI--------VTFAIFIYNERFWAKERIIPFDLL 295

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE--SQAVTIT 160
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I   + TI++  + +    
Sbjct: 136 STATLLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGI 192

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
            F     FY+    +G+ G   +  +I S+FS   WR
Sbjct: 193 NFVAVLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR 229

>ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 592

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 14/113 (12%)

Query: 120 AVGQIFFARLSDIFGRFSILVIS-----VIFYSVGTIIESQAVTITRFAVGGCFYQLGLT 174
           A   I +A LS+++GR  +LVIS     +  ++V T  + Q + I RF  G     +G  
Sbjct: 202 AASPIIYAPLSELYGRRGVLVISSFGFAIFHFAVATAKDLQTIMICRFFAG----FIGAA 257

Query: 175 GVILILEVIASDF-SNLNWRLLALFVPALPFIVNTWISGDVTSAI--GTNWKW 224
            + ++       F +N   +++ALF  AL   V   I   + S I   T W+W
Sbjct: 258 PMAVVPAAFTDMFDTNFRGKVMALF--ALGVFVGPIIGPVMGSYIVQHTTWRW 308

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 89/212 (41%), Gaps = 18/212 (8%)

Query: 75  FSIFLIAYAYGLDGGI----RYTFQAYATSSYSQHSLLSTVN----CIKTVIAAVGQIFF 126
           F  F++ +  G  GG      +  +  +T+ Y +H L          I  +  A+G +  
Sbjct: 74  FGGFMMGWDIGTIGGFIAQPDFKRRFGSTNKYGEHYLSKARTGLLVSIFNIGCAIGSVTL 133

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIAS 185
             + DI+GR   L+I+ I +  G +IE  ++    ++ +G     +G+  V+++  ++ S
Sbjct: 134 GNIGDIYGRRLGLIIATIIFVAGVVIEIASIDKWYQYFIGRIISGVGMGVVVILSPMLIS 193

Query: 186 DFSNLNWR-----LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           + S    R        L +    F+ +    G    +  T W+ G+G+  F   L C+  
Sbjct: 194 EVSPKELRGAMVSSFQLMITLGMFLGDCTEYGTKKYSNSTQWRVGLGL-QFAWSL-CMVG 251

Query: 241 GLCML--HMRYLARKHAKDKLRPEFETLNNLD 270
           G+  +    R+L  K   ++ +      N L+
Sbjct: 252 GMLFVPESPRFLVEKGKIEEAKRSVAISNKLN 283

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT 150
           R+  QA   S Y        +  I  +  A+G +   RL D++GR   L+  +  Y VG 
Sbjct: 95  RFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGI 154

Query: 151 IIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
           +I+ S   T  ++ VG     LG+ G+ ++   + S+
Sbjct: 155 VIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGT 150
           R+  QA   S Y        +  I  +  A+G +   RL D++GR   L+  +  Y VG 
Sbjct: 95  RFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGI 154

Query: 151 IIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIASD 186
           +I+ S   T  ++ VG     LG+ G+ ++   + S+
Sbjct: 155 VIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 81  AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D G    F++       + ++S S    LS V       +  +  A+G  F  R
Sbjct: 75  GYISGWDSGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNIGQAIGCFFLGR 134

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAV 157
           L D++GR   ++++ I + VGT+I+  +V
Sbjct: 135 LGDMYGRRIAIIVASIIFIVGTVIQIASV 163

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 9/95 (9%)

Query: 105 HSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAV--TITRF 162
            +LL     + TVI   GQ  F  L+DI GR  I  + +I   V TI+++         F
Sbjct: 104 QTLLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINF 160

Query: 163 AVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
                FY+    +G+ G   +  +I S+F+   WR
Sbjct: 161 VAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCF 168
           S V+ +  + A  G I     S++ GR + LVIS  FY++G II + A+ +     G  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVIL 178
           A+G +  ++L DIFGR   L+  V  Y VGTII+ S +    ++ +G   Y  G+ GV +
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSV 185

Query: 179 ILEVIAS 185
           +  ++ S
Sbjct: 186 LAPMLIS 192

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTI 151
           + ++S S    LS V       +  +  A+G  F  RL D++GR   ++++ I + VGT+
Sbjct: 32  FGSTSGSGKRYLSKVRTGLLTSMFNIGQAIGCFFLGRLGDMYGRRIAIIVASIIFVVGTV 91

Query: 152 IESQAV 157
           I+  +V
Sbjct: 92  IQIASV 97

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII 152
           S V+ +  + A  G I     S+ FGR   L IS +FY+VG I+
Sbjct: 140 SLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIV 183

>Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081W
           (REAL)
          Length = 588

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 89/222 (40%), Gaps = 37/222 (16%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIF 125
           F  FL  +  G+  G       +  F +Y  S+   Y  +  +  +  + +V  A+G + 
Sbjct: 84  FGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLI 143

Query: 126 FARLSDIFGRFSILVISVIFYSVGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIA 184
           FARL+D  GR   +VI V+ Y VG II+ S      ++ VG   Y LG  G  ++  ++ 
Sbjct: 144 FARLADTLGRRLAIVIVVLVYIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLL 203

Query: 185 SDFSNLNWR--LLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGL 242
           S+ +  + R  L++L+   + F +         S  GT        W        IP+GL
Sbjct: 204 SEIAPKDLRGGLISLYQLNMTFGIFL----GYCSVYGTRKYDNTAQWR-------IPIGL 252

Query: 243 CML--------------HMRYLARKHAKDKLRPEFETLNNLD 270
           C L                RYL      ++ R     +N + 
Sbjct: 253 CFLWALIIIIGMLLVPESPRYLIESEKHEEARTSIAKVNKVS 294

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 3/29 (10%)

Query: 403 VIVGTILGFILIKVRRTKPFILFGISCWI 431
           VIVGT++GF++  + R     LFG+SCWI
Sbjct: 95  VIVGTVMGFLVGTIYRAG---LFGMSCWI 120

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 91/223 (40%), Gaps = 34/223 (15%)

Query: 75  FSIFLIAYAYGLDGGIR--YTFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQI 124
           F+ F+  +  G  GGI    +FQ +  +++   S        L+  +  I  +  A+G +
Sbjct: 66  FAGFIFGWDVGTIGGITNMVSFQNFFGTNFDSSSNTHYFPKLLIGLIVSIFNISCALGGL 125

Query: 125 FFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGCFYQLGLTGVIL 178
           F  +++DI GR   +  ++  YS+GT+I     +        RF  G     +G T V++
Sbjct: 126 FLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFISG---LGVGATAVMI 182

Query: 179 ILEVIASDFSNLNWRLLALFVPALPF------IVNTWISGDVTSAIGTNWKWGIGM---W 229
            + +  S   N+   ++ L+   +        ++N      +       WK  +G+   W
Sbjct: 183 PMFIAESAPINIRGAMVVLYQLMITLGILLGNVINYCCRSTLHETDNATWKIPVGLGNVW 242

Query: 230 AFILPLAC--IPLGLCMLHMRYLARKHAKDKLRPEFETLNNLD 270
           A I+ L    +P     L  R  +   AK      F  +NNLD
Sbjct: 243 AAIVALGVHFMPESPVFLTKRLGSALKAK----AAFAHMNNLD 281

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 9/107 (8%)

Query: 73  LFFSIFLIAYAYGLDGG-IRYTFQAYATS-----SYSQHSLLSTVNCIKTVIAAVGQIFF 126
           L F   L  + +G D G I    Q+  T      +Y     +++   +  +IAA+G    
Sbjct: 69  LTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGAGIC 128

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL 173
           A   D+FGR   ++ S I + VGT+++  A    +  VG      G+
Sbjct: 129 A---DLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGI 172

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITR---FAVGGCFYQLGLTG 175
            A+G I  ++  D++GR   L+I V  Y VG +I  Q  TI +   + +G     LG+ G
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVI--QIATINKWYQYFIGRIISGLGVGG 177

Query: 176 VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPL 235
           + ++  ++ S+ S  + R     V     ++   I     +  GT        W      
Sbjct: 178 ISVLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR----- 230

Query: 236 ACIPLGLC 243
             +PLGLC
Sbjct: 231 --VPLGLC 236

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 83/218 (38%), Gaps = 24/218 (11%)

Query: 75  FSIFLIAYAYGLDGGIRYT---FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFF 126
           F  F++ +  G  GG        Q + T +      LST+       I  +  A+G +F 
Sbjct: 82  FGGFMMGWDIGTIGGFMAQTDFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFL 141

Query: 127 ARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGCFYQLGLTGVILIL 180
            +L D++GR   L+     + VG II+  +V+      I R   G     + +   +LI 
Sbjct: 142 GKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLIS 201

Query: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG---MWAFIL--PL 235
           EV   +          L +    F+ N    G  +      W+  +G   +W  I+   +
Sbjct: 202 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQFLWCIIMVSGM 261

Query: 236 ACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKS 273
             +P        RYL +++  ++ +      N L  +S
Sbjct: 262 TFVP-----ESPRYLVQQNMFEEAKESIAISNKLSKES 294

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 100 SSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI 159
           S Y  +  +  +  I  V AA+G +  AR  D++GR   L+  V  Y+VG +I+  ++  
Sbjct: 125 SHYLSNVRMGLLVSIFNVGAAIGGVMLARTGDMWGRRLGLITVVSIYTVGIVIQIASIDK 184

Query: 160 -TRFAVGGCFYQLGLTGVILILEVIASD 186
             ++ +G     LG+ G+ ++  ++ S+
Sbjct: 185 WFQYFIGRIISGLGVGGIAVLAPMLISE 212

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTIT 160
           +Y    +++    +  +I+AV        +DI+GR   L+IS +F+ +G +++  A T  
Sbjct: 108 TYGDKEIITAATSLGALISAVAA---GTCADIWGRKPCLMISNLFFVIGAVLQVSASTFW 164

Query: 161 RFAVG 165
           + AVG
Sbjct: 165 QMAVG 169

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 283 LDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH 342
           +D IG +L     G +L  F    G    W+ A+IIV  ++  V+ L  + V+E+KY++ 
Sbjct: 272 MDWIGSVL--GVIGLILFNFVWNQGPIVGWEKAYIIVLLIVS-VIFLIAFFVYEIKYAKV 328

Query: 343 PLTP 346
           PL P
Sbjct: 329 PLLP 332

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350
           V A  G +L  F         W  A+IIV  V+  V  L  + V+E+KY+  PL P  + 
Sbjct: 271 VLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVS-VFFLVAFFVYEIKYAEVPLLPHAVT 329

Query: 351 KDR 353
           K+R
Sbjct: 330 KNR 332

>Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072W
           (REAL)
          Length = 487

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 82/200 (41%), Gaps = 31/200 (15%)

Query: 91  RYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYS 147
           +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +VI V+ Y 
Sbjct: 5   KMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLVYI 64

Query: 148 VGTIIE-SQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR--LLALFVPALPF 204
           VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   + F
Sbjct: 65  VGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNMTF 124

Query: 205 IVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGLCML--------------HMRYL 250
            +         S  GT        W        IP+GLC L                RYL
Sbjct: 125 GIFL----GYCSVYGTRKYDNTAQWR-------IPIGLCFLWALIIIIGMLLVPESPRYL 173

Query: 251 ARKHAKDKLRPEFETLNNLD 270
                 ++ R     +N + 
Sbjct: 174 IESEKHEEARTSIAKVNKVS 193

>TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 5/106 (4%)

Query: 89  GIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSV 148
           G R+T   Y  S      ++S  N    V  A+G I  ++L DI+GR   L+  V+ Y V
Sbjct: 101 GSRHTDGTYYLSKVRTGLVVSIFN----VGCAMGGIILSKLGDIYGRKIGLMTVVVIYIV 156

Query: 149 GTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASDFSNLNWR 193
           G +I+  +     ++ +G     LG+ G+ ++  ++ S+ S  + R
Sbjct: 157 GILIQICSFDKWYQYFIGRIISGLGVGGIAVLSPMLISESSPKHLR 202

>Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C
           (HXT1) - High-affinity hexose (glucose) transporter
           [contig 156] PARTIAL
          Length = 238

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVIL 178
           A+G I   +L +++GR   L I V+ Y+VG II+  ++    ++ +G     LG+  + +
Sbjct: 126 AIGGIVLGKLGEVYGRRLGLTIVVVIYAVGIIIQIASIDKWYQYFIGRIISGLGVGAITV 185

Query: 179 ILEVIASDFSNLNWRLLALFVPALPFIVNTWI 210
           +  ++ S+ S  + R     V    F+V   I
Sbjct: 186 LSPMLISEVSPKHLR--GTLVSCYQFMVTGGI 215

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 63/162 (38%), Gaps = 22/162 (13%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVT------ITRFAVGGCFYQLGL 173
           A G +   + +D++GR   + I+ +FY VGT+I   ++       I R   G     L +
Sbjct: 147 AFGGLILTKPADVYGRKLAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSLAV 206

Query: 174 TGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGM---WA 230
              +LI EV           +  L V A  F+      G  T      W+  +G+   WA
Sbjct: 207 LSPMLISEVAPKQLRGTLVSIYQLMVTAGIFLGYCANYGTKTYDNSVQWRVPLGLNFAWA 266

Query: 231 FIL----------PLACIPLGLCMLHMRYLARKHAKDKLRPE 262
            ++          P   + +G      R L+R    +K+ PE
Sbjct: 267 ILMVAGMTFVPESPRYLVQIGKVQEAKRSLSR---SNKVSPE 305

>NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON}
           Anc_8.858
          Length = 571

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 15/97 (15%)

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTII-----ESQAVTIT 160
           +LL     + TVI   GQ+ F  L+D+ GR  I  + +I   +  I+     ES+A+   
Sbjct: 90  TLLKVSTSVGTVI---GQLGFGTLADVVGRKKIYGLELIIMIITAILQCTTGESKAINFV 146

Query: 161 RFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
                  FY+    +G+ G   +  +I S+F+   WR
Sbjct: 147 AILT---FYRIVMGIGIGGDYPLSSIITSEFATTKWR 180

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 22/117 (18%)

Query: 120 AVGQIFFARLSDIFGRFSILVIS-----VIFYSVGTIIESQAVTITRFAVGGCFYQLGLT 174
           AV  + +A LS+I+GR  +LVIS     +  ++V T    Q + I RF  G     +G  
Sbjct: 249 AVSPVIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSG----VIGSA 304

Query: 175 GVILILEVIASDF-SNLNWR---LLALFV---PALPFIVNTWISGDVTSAIGTNWKW 224
            + ++    A  F +NL  +   L +LFV   P L  +  +++      A  T W+W
Sbjct: 305 PMAVVPAAFADMFDTNLRGKAICLFSLFVFVGPILSPVFGSYM------AQRTTWRW 355

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%)

Query: 90  IRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVG 149
           IR+  +    + Y        +  I  V  A+G +   RL D++GR   L+I+ I + VG
Sbjct: 100 IRFGTRRADGTYYLSKVRTGLIVSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVG 159

Query: 150 TIIESQAV 157
            +IE  +V
Sbjct: 160 NVIEIASV 167

>KNAG0M02690 Chr13 (502232..503911) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 89  GIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSV 148
           G+R+    Y  S+     +++  N    + AA+G I ++RL +I+GR   L +  + Y++
Sbjct: 89  GLRHKDGTYYMSNVRTGLIVAFFN----IGAAIGGIVWSRLGNIYGRKLSLALVTVVYTI 144

Query: 149 GTIIESQAVT 158
           G +I+  +++
Sbjct: 145 GLVIQIASIS 154

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 23/133 (17%)

Query: 120 AVGQIFFARLSDIFGRFSILVIS-----VIFYSVGTIIESQAVTITRFAVGGCFYQLGLT 174
           A+  I +A LS+I+GR  +LVIS     +  ++V T    Q + I RF  GG    +G  
Sbjct: 177 AISPIVYAPLSEIYGRRGVLVISSFGFCLFQFAVATAENLQTIMICRF-FGGL---MGAA 232

Query: 175 GVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIG------TNWKW---G 225
              ++   +A D  + N R  A+ +    F +  +++  V+  +G      T W+W    
Sbjct: 233 PFAVVPAAMA-DMFDTNTRGKAICL----FTIGVFVAPVVSPVMGSYMAQRTTWRWLEYV 287

Query: 226 IGMWAFILPLACI 238
           IG++A +L  A +
Sbjct: 288 IGIFAGVLTAAVV 300

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 79/186 (42%), Gaps = 22/186 (11%)

Query: 75  FSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG 134
           F++F+ +Y   LD  I  T      S     + +S +     +  +  Q  + +LSD+FG
Sbjct: 36  FALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFG 95

Query: 135 RFSILVISVIFYSVGTIIESQAVT-------ITRFAVGGCFYQLGLTGVILILEVIASDF 187
           R  +L+ S + +  G I+     T       I RF  G     +G  G+  +  +  SD 
Sbjct: 96  RKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAG-----VGGGGLNSLSTITTSDI 150

Query: 188 SNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIG-MWAFILPLACIPLGL--CM 244
             L  R +   +  + F +    SG   S IG   +  IG  WAF   L  +PL L  C 
Sbjct: 151 IPLRQRGVYQGMGNIVFALGC-ASG---SLIGAFLQQRIGWRWAF---LCQVPLSLLSCS 203

Query: 245 LHMRYL 250
           L M++L
Sbjct: 204 LIMKFL 209

>KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVIL 178
           A+G I F++L D +GR   LVI  I Y VG +I   ++    ++ +G     LG+ G+ +
Sbjct: 127 AIGGIAFSKLGDQYGRRIALVIVTIVYIVGIVISIASIDKWYQYFIGRIIAGLGVGGIAV 186

Query: 179 ILEVIASDFSNLNWR 193
              +  S+ S  + R
Sbjct: 187 YSPLFISEISPKHLR 201

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 13/119 (10%)

Query: 81  AYAYGLDGGIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y YG D G    F A       Y          LS V       I  +  A+G + ++R
Sbjct: 81  GYVYGWDTGTISGFVAQTDYVRRYGQKKKDGTYYLSKVRTGLLLAIFNIGCAIGGLLWSR 140

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTI-TRFAVGGCFYQLGLTGVILILEVIASD 186
           L D++GR   LV     Y +G II   AV    ++ +G     LG+ G+ +   ++ S+
Sbjct: 141 LGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLLISE 199

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 283 LDLIGLLLVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRH 342
           +D IG ++     G +L  F    G    W  A+IIV  +I  V+ L  ++V+E+KY   
Sbjct: 259 MDWIGSII--GVVGLILFNFVWNQGPVAGWDKAYIIVLLIIS-VLFLVAFVVYELKYPIS 315

Query: 343 PLTPWDLIKD 352
           PL P ++ K+
Sbjct: 316 PLLPVEVTKN 325

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 120 AVGQIFFARLSDIFGRFSILVISVIFYSVGTIIE 153
           A+G  F  RL D++GR   L+++ + + VG II+
Sbjct: 128 AIGCFFLGRLGDMYGRRIGLIVAAVIFIVGNIIQ 161

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 59/134 (44%), Gaps = 8/134 (5%)

Query: 293 AFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKD 352
           A  G +L  F         W  A+IIV  ++  V  L  + V+E+KY+  PL P  + K+
Sbjct: 274 AVLGLILFNFVWNQAPIAGWGEAYIIVLLILS-VFFLIAFFVYEIKYAEVPLLPHAVTKN 332

Query: 353 RGVXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRI-TALYSFVSVIVGTILG- 410
           R +             W   G  ++T   V+   +++  + + T    FV VI G+I   
Sbjct: 333 RHM---IMILLAVFLGWGSFG--IWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAF 387

Query: 411 FILIKVRRTKPFIL 424
           F+   ++R  P IL
Sbjct: 388 FVAFSIKRLGPAIL 401

>KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.858
           YML123C
          Length = 586

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 11/98 (11%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR---FSILVISVIFYSVGTIIESQAVTI 159
           S  +LL     + TVI   GQ+ F  L+DI GR   + + +I +IF +V       +  I
Sbjct: 96  STATLLKVSTSVGTVI---GQLGFGILADIVGRKKIYGLELIVMIFCTVLQCTLGHSPGI 152

Query: 160 TRFAVGGCFYQ----LGLTGVILILEVIASDFSNLNWR 193
              AV   FY+    +G+ G   +  +I S+FS   WR
Sbjct: 153 NFVAV-LTFYRVVMGIGIGGDYPLSSIITSEFSTTKWR 189

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 11/141 (7%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTIT 160
           +Y +  +++    +  +I +   IF    +DIFGR   L+ S + + +G I++  A T  
Sbjct: 124 TYGEKEIVTAATSLGALITS---IFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFW 180

Query: 161 RFAVGGCFYQLGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGD--VTSAI 218
           + AVG      G+    LI  +  S+ +    R        L  I + W++G   V    
Sbjct: 181 QMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIR------GRLTVINSLWLTGGQLVAYGC 234

Query: 219 GTNWKWGIGMWAFILPLACIP 239
           G    +    W  ++ L+ IP
Sbjct: 235 GAGLNYVNNGWRILVGLSLIP 255

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 14/128 (10%)

Query: 119 AAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITR---FAVGGCFYQLGLTG 175
            A+G I  ++  D++GR   L+I ++ Y  G +I  Q  TI +   + +G     LG+ G
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLLIVLVIYIAGIVI--QIATINKWYQYFIGRIISGLGVGG 177

Query: 176 VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPL 235
           + ++  ++ S+ S  + R     V     ++   I     +  GT        W      
Sbjct: 178 ISVLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR----- 230

Query: 236 ACIPLGLC 243
             +PLGLC
Sbjct: 231 --VPLGLC 236

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 22/117 (18%)

Query: 120 AVGQIFFARLSDIFGRFSILVIS-----VIFYSVGTIIESQAVTITRFAVGGCFYQLGLT 174
           A   + +A LS+I+GR  +LVIS     +  ++V T  + Q + I RF  G     +G  
Sbjct: 187 AASPVIYAPLSEIYGRRGVLVISSFGFALFNFAVATAKDLQTIMICRFFAG----FIGAA 242

Query: 175 GVILILEVIASDF-SNLNWRLLALFV------PALPFIVNTWISGDVTSAIGTNWKW 224
            + ++    A  F +N+  + + LF       P L  ++ ++I+        T W+W
Sbjct: 243 PLAVVPAAFADMFDTNIRGKAICLFSLGVFVGPILAPVIGSYITQH------TTWRW 293

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 3/120 (2%)

Query: 49  LIDPGVRNIEIYAEQYSR---PLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQH 105
           LI P  R+ E    +Y R    L +  +  S++L ++   LDG I           + + 
Sbjct: 8   LIPPESRDEESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEES 67

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVG 165
                +     +     Q  + +LSDI GR   L+ +  F+ +G ++   A ++ +FA+ 
Sbjct: 68  DKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALA 127

>Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON}
           (34471..36069) [1599 nt, 533 aa]
          Length = 532

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 75  FSIFLIAYAYGLDGGI------RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFAR 128
           F  F+  +  G  GGI      +  F        S   ++  V  I  + +A+G +  A+
Sbjct: 63  FGGFIFGWDIGTIGGIVNMPSFQLNFGLSVDGPSSDTWIIGLVVSIFNIGSAIGGLTLAK 122

Query: 129 LSDIFGRFSILVISVIFYSVGTIIE 153
           L D+FGR + L  ++ FY++G  I+
Sbjct: 123 LGDLFGRKAGLFTALGFYNIGLFIQ 147

>TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858
           YML123C
          Length = 581

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQA--VTIT 160
           S ++LL     + TVI   GQ+ F  ++DI GR  I  + +I     TI++  A      
Sbjct: 99  SSNTLLKVSTSVGTVI---GQLGFGMMADIIGRKKIYGVELIIMIAATILQCTAGHAPGV 155

Query: 161 RFAVGGCFYQLGLTGVIL----ILEVIASDFSNLNWR 193
            F     FY++ +   I     +  +I S+FS   WR
Sbjct: 156 NFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 192

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 124/315 (39%), Gaps = 50/315 (15%)

Query: 73  LFFSIFLIAYAYG---LDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIA-AVGQIFFAR 128
           +  SI +IA AYG   + GG+   F        SQ   +S + C   VI  ++G + ++ 
Sbjct: 201 ILLSILVIAVAYGSACITGGL---FTVSDKFHVSQE--VSILTCSLMVIGFSLGPLIWSP 255

Query: 129 LSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGL---TGVILILEVIAS 185
           +SD+FGR     +S+  Y +  I  + A  I    V  C +  G+   +G+ L+   IA 
Sbjct: 256 VSDLFGRRVAYFVSLGLYVIFNIPCALAPNIGCLLV--CRFLCGVWSSSGLCLVGGSIAD 313

Query: 186 DF-SNLNWRLLALFV------PALPFIVNTWISGDVTSA---IGTNWKWGIGMWAFILPL 235
            F      R +A F       P    +VN +IS            N  +   MW   L +
Sbjct: 314 MFPPETRGRAIAFFAYAPYCGPVFGPLVNGFISVSTHRMDLIFWVNMAFAGVMW---LVV 370

Query: 236 ACIPLGLCMLHMRYLARKHAKDKLRPEF------------ETLNNLDWKSFSIDIVFWKL 283
           ACIP     + ++  A K  ++   P+             E +N    +   + +    L
Sbjct: 371 ACIPETFAPVILKRRAAKLRRETGNPKIMTEQEAQGLSVGEMVNACVLRPLYLAVTEPVL 430

Query: 284 DLIGLL------LVTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEV 337
           DL+         L+ AFF    V F    G K+      +++P +IG  VAL      E 
Sbjct: 431 DLMCFYVCLIYSLLYAFFFAYPVIFGELYGYKDNL-IGLMLIPILIGASVALATTSFCET 489

Query: 338 KY----SRHPLTPWD 348
           +Y     R   TP D
Sbjct: 490 QYLKITKRRNPTPED 504

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,716,541
Number of extensions: 2300859
Number of successful extensions: 7776
Number of sequences better than 10.0: 399
Number of HSP's gapped: 7631
Number of HSP's successfully gapped: 401
Length of query: 627
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 511
Effective length of database: 40,180,143
Effective search space: 20532053073
Effective search space used: 20532053073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)