Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.136.7ON1023102344940.0
Skud_5.346.7ON1019102038400.0
Smik_5.326.7ON1020102137740.0
YEL055C (POL5)6.7ON1022102536490.0
NCAS0F001806.7ON1018103823440.0
KNAG0E009706.7ON1004103518940.0
KLLA0D00792g6.7ON1020104717430.0
ACR020C6.7ON1002104416400.0
NDAI0K029106.7ON106373616030.0
Kwal_56.223346.7ON1008104515900.0
ZYRO0F00440g6.7ON103971115560.0
TDEL0G046406.7ON101771015300.0
KLTH0C11594g6.7ON1006105114760.0
Kpol_1045.806.7ON101970714380.0
KAFR0L003306.7ON102873314390.0
SAKL0E00770g6.7ON104773813301e-166
CAGL0B03553g6.7ON102171612221e-150
TPHA0J002506.7ON102471712161e-149
Ecym_30096.7ON102773511531e-140
TBLA0A072106.7ON104172810401e-124
KLTH0A02684g8.69ON2140116870.16
KAFR0B065803.478ON39984762.1
Smik_9.87na 1ON63288762.2
Ecym_47435.291ON36648743.8
TBLA0A095505.637ON27647733.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.13
         (1023 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...  1735   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...  1483   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...  1458   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...  1410   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   907   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   734   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   676   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   636   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   622   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   617   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   603   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   593   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   573   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   558   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   558   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   516   e-166
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   475   e-150
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   473   e-149
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   448   e-140
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   405   e-124
KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa] ...    38   0.16 
KAFR0B06580 Chr2 (1366815..1368014) [1200 bp, 399 aa] {ON} Anc_3...    34   2.1  
Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...    34   2.2  
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    33   3.8  
TBLA0A09550 Chr1 complement(2356084..2356914) [831 bp, 276 aa] {...    33   3.9  

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score = 1735 bits (4494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/1023 (86%), Positives = 885/1023 (86%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
            SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RGI            NEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 181  LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
            LFQTIKMLLPTMNESTAAEI            NEGLSTYLLLKYESDKDLVPSTLGLKNL
Sbjct: 181  LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300

Query: 301  GSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360
            GSGKLENAEHIS          VPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA
Sbjct: 301  GSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360

Query: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420
            TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL
Sbjct: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420

Query: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHTHFV 480
            SAMLFGPHGSINFDKLTKTSITSKLIAIKELPAT              EKKDDLPHTHFV
Sbjct: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDDLPHTHFV 480

Query: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540
            LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE
Sbjct: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540

Query: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600
            LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK
Sbjct: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600

Query: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEIXXXXXXXXX 660
            SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEI         
Sbjct: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEILLSLLAQKK 660

Query: 661  XXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXXXXXXXXXXXXXXXXXX 720
                    IIWQQFIGDVGLKELQILLDVLKTRENKQGFALL                  
Sbjct: 661  ALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLFEGEGEFEEVDEEESAVE 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATSALIKALNLPDNIVNDKGEVD 780
                                          VVNIDKEATSALIKALNLPDNIVNDKGEVD
Sbjct: 721  DESKSESESDSDSESNDDEERDEEDEANEDVVNIDKEATSALIKALNLPDNIVNDKGEVD 780

Query: 781  MDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVEVK 840
            MDQLEGIS                         QLSEIFKRRKEALSSISTGNQRKVEVK
Sbjct: 781  MDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKVEVK 840

Query: 841  ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET 900
            ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET
Sbjct: 841  ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET 900

Query: 901  LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA 960
            LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA
Sbjct: 901  LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA 960

Query: 961  CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV 1020
            CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV
Sbjct: 961  CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV 1020

Query: 1021 EKK 1023
            EKK
Sbjct: 1021 EKK 1023

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score = 1483 bits (3840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 749/1020 (73%), Positives = 819/1020 (80%), Gaps = 5/1020 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSD+EEWSYVLNRLIKGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
            SARLGFSLCLTEV+NL +NMPSGQRPKGLES N+FLDTLS ILDI VN+  KKPVKGKDE
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RGI            NEPLFS IFV+D+K+GNTEF+IRFMEQLIDLALRKNWI+EPCL+S
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 181  LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
            LFQTIKMLLP MNESTA +I            NEGLSTYL+LKYESD+ L+PSTL L+N 
Sbjct: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            GWKNNDPLARGNLPLLTKVLRDS+V PDTNGK QD  KKQKN NWNPRLHFVW++LLPLF
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQD-AKKQKNANWNPRLHFVWDVLLPLF 299

Query: 301  GSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360
            GSGKLEN EHI+          V +SIQFPEFW+MAVDESFFNEKASSERKYLGFLIIDA
Sbjct: 300  GSGKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359

Query: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420
            TFKTVPGSCIG CFS+NVMRTLINQSIDSQRILNKIAQITL+SI+KACEEDP+ KLVPCL
Sbjct: 360  TFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCL 419

Query: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHTHFV 480
            +AMLFGPHGSINFDKLTK++I SKLIAIKELP+               EK+ DLPHTHF+
Sbjct: 420  NAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFI 479

Query: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540
            LDSLLHIIRAHK EINDV IIKPVL+PI++MAFFKHATD++E EQLHELAKERLYSILGE
Sbjct: 480  LDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGE 539

Query: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600
            LTINKE+ SEDPQINSWQ+LTL LILD+EKS+K DL NPLDE LEK KNEAISSL EISK
Sbjct: 540  LTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISK 599

Query: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEIXXXXXXXXX 660
            SNT+QSWGLSTLLSMCLIQLYAGETDSISVIEELCEF K +N+SMVGITEI         
Sbjct: 600  SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKK 659

Query: 661  XXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXXXXXXXXXXXXXXXXXX 720
                    IIWQQFI DVGL+ELQILLDVLK RENKQGFA L                  
Sbjct: 660  ALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFEGEGEFEEINEEENANE 719

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATSALIKALNLPDNIVNDKGEVD 780
                                          VVNIDKEAT ALIKAL+LPDNIVNDKGEVD
Sbjct: 720  GDSKSESESESESDSDESNEKDEEDEANEDVVNIDKEATGALIKALHLPDNIVNDKGEVD 779

Query: 781  MDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVEVK 840
            M+QL G+S                         QLSEIFKRRKEALS+ISTGNQRKVEVK
Sbjct: 780  MNQLGGLS----DDDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVK 835

Query: 841  ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET 900
            ESRENVI+FKHRIVDMLT+YVK+CEKLAIANK E S  + GPLS LVYFI+PM+KCI+ET
Sbjct: 836  ESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRET 895

Query: 901  LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA 960
            LD+PLADKISKLLKGKIFKI+ + FK LDK IEL++LLKS H+ MLTSKPGQHA+VFFSA
Sbjct: 896  LDKPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSA 955

Query: 961  CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV 1020
            CSTSSLFLSKLY +I GN+  D+LIDLYA+TTK+W  KGKF  N+FIDF NWLSSKK+ V
Sbjct: 956  CSTSSLFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNV 1015

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score = 1458 bits (3774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1021 (71%), Positives = 823/1021 (80%), Gaps = 4/1021 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDLQEERLHAAVALI+DLSAL LPSD+EEW YVLNRL+KGLASDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
            SARLGFSLCLTEVINLA+NMPSGQRPKGLES NDFL+TLS +LD+NVN+ GKK VKGKDE
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RGI            NEPLFS IF+++ + GNT+F IRF E+LIDLAL+KNWIKEPC ++
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 181  LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
            LFQTIKMLLP ++ES AA+I            NEGLSTYLLLKY  DK+L+PSTL LKNL
Sbjct: 181  LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            GWK++DPLARGNLPLLTKVLRDS+V PDT+GK++D TKKQKNTNWNPRLHFVW+ILLPLF
Sbjct: 241  GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRD-TKKQKNTNWNPRLHFVWDILLPLF 299

Query: 301  GSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360
            GSGKLEN EH+S          V +SIQFPEFW+MA+DESFFNEKASSERKYLGFLIIDA
Sbjct: 300  GSGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLIIDA 359

Query: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420
             FKTVPGS IG CFS+NVMRTLINQSIDSQR+LNKIAQITL SI+KACEED  NKLVPCL
Sbjct: 360  AFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVPCL 419

Query: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHTHFV 480
            ++MLFGPHGS+NFDKLTK+S  SKLIAIKELP+T              + K DL HTHF+
Sbjct: 420  NSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDLTHTHFI 479

Query: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540
            LDS+LHIIRAHK EI+D++++KP+L+PI+YMAFFK ATDD+E EQLHELAKERL+SILGE
Sbjct: 480  LDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERLFSILGE 539

Query: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600
            LT+NKE+ SEDP+INSWQFLTL+LILDMEKSH+G L NPLDE LEKTK EAISSL EIS+
Sbjct: 540  LTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAISSLAEISR 599

Query: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEIXXXXXXXXX 660
            S+T+Q+WGLSTLLSMCLIQLYAGETDSISVIEELCEF+KD+N+SMVGITEI         
Sbjct: 600  SSTAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKDKNNSMVGITEILLSLLAQKK 659

Query: 661  XXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXXXXXXXXXXXXXXXXXX 720
                    IIWQQFI DVGL+ELQ+LLDVLK RENKQGFA L                  
Sbjct: 660  ALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQLFEGEGEFEEIKEEESASE 719

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATSALIKALNLPDNIVNDKGEVD 780
                                          VVNIDKEATSAL+KALNLPDNIVNDKGEVD
Sbjct: 720  DESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEATSALVKALNLPDNIVNDKGEVD 779

Query: 781  MDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVEVK 840
            +DQLEG+S                         QLSEIFKRRKEALS+ISTGNQRKVEVK
Sbjct: 780  IDQLEGLS---DDDEDDEDEESMDDEKMMELDGQLSEIFKRRKEALSNISTGNQRKVEVK 836

Query: 841  ESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKET 900
            ESRENVI+FKHRIVDMLT+YVK+CEKLA+ANK E S  IG PLS LVYFIIP++KCI ET
Sbjct: 837  ESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIGSPLSKLVYFIIPILKCINET 896

Query: 901  LDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSA 960
            LDRPLADKISKLLKGKIFKI+ +AFK++DK IE++DLLKS HK +LTSKPGQH  VF+SA
Sbjct: 897  LDRPLADKISKLLKGKIFKIKVNAFKEMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSA 956

Query: 961  CSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKEGV 1020
            CSTSSLFLSKLYV+I+GNDK D+LIDLYA+TTK+WT +GKFGAN+FIDFINWLSSKK+ V
Sbjct: 957  CSTSSLFLSKLYVEIHGNDKLDELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKKQNV 1016

Query: 1021 E 1021
            E
Sbjct: 1017 E 1017

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score = 1410 bits (3649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1025 (69%), Positives = 800/1025 (78%), Gaps = 6/1025 (0%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            MTGKVNRDLFFKLASDL+EERLHAAVALIKDLSAL+LP D+EEWSYVLNRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
            SARLGFSLCLTEVINLA+NMP GQRPKGLES N+FL TLS IL++NVNE  KK +KGKDE
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RGI            NEPLFS IFV+DL++GNTEF IRF EQLIDLAL+KNWIKEPC ++
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 181  LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
            LFQT+KMLLP M+ES+A +I            NEGLSTYLLLKYE D+ L+PS L LKN 
Sbjct: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240

Query: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            GWK+NDPLARGNLPLLTKVLR+S+V PD NG  ++ TKKQKNTNWNPRLHFVW++LLPLF
Sbjct: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKE-TKKQKNTNWNPRLHFVWSVLLPLF 299

Query: 301  GSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360
            G+GKLEN  HIS          V +SIQFPEFW+MAVDESFFNEKASSERKYLGFLIIDA
Sbjct: 300  GNGKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359

Query: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420
             FK VPGS IG+CFS+NVMRTLINQSIDSQR+LNKI+Q+TLDSI+KACEED  N+LVPCL
Sbjct: 360  AFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCL 419

Query: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHTHFV 480
            +AMLFGPHGSINFDKLTK+   SKLIAIKELP+T              +KK  L HT F 
Sbjct: 420  NAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVLSHTLFA 479

Query: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540
            LDS+LHI+RAHK EIND++I+KPVL PIVYMAFFKH +DD + EQLHELAKERLYSILGE
Sbjct: 480  LDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGE 539

Query: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600
            LTINKE+R +DP+INSWQ+LTL+LILD+E SH GDL NPLDE LE  KNEAIS L+++ +
Sbjct: 540  LTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCR 599

Query: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEIXXXXXXXXX 660
            S T+QSWGLSTLLSMCL+QLYAG+TDSISVIEELCEF+K EN+SMVGITEI         
Sbjct: 600  SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEILLSLLAQKK 659

Query: 661  XXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXXXXXXXXXXXXX--XXX 718
                    IIWQQFI +VGL+ELQILLD+LK RENKQGFA L                  
Sbjct: 660  ALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFEGEEEFEEIKEENDASE 719

Query: 719  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATSALIKALNLPDNIVNDKGE 778
                                            ++NIDKEATSAL+KALNLPDNIVNDKGE
Sbjct: 720  DESKTGSESESESESDSDDADEKDEEDEANEDILNIDKEATSALVKALNLPDNIVNDKGE 779

Query: 779  VDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVE 838
            VD+DQLEG+S                         QLSEIFKRRKEALSSISTGNQRK E
Sbjct: 780  VDLDQLEGLS---DDGGDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKFE 836

Query: 839  VKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIK 898
            VK+SRENVI+FKHR+VDML +YVK+CEKL +ANK E S  +GG LS LVYFIIPM+KC+ 
Sbjct: 837  VKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVN 896

Query: 899  ETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFF 958
            ETLDRPLADKISKLLKGKIFKI+ +AFKD++K IEL+DLLK  HK MLTSKPGQHA VF+
Sbjct: 897  ETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFY 956

Query: 959  SACSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018
            S CSTSSLFLSKLYV+I GNDK D+LIDLY +TTK+W QKGK G NIFIDFINWLSSKK+
Sbjct: 957  SMCSTSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQ 1016

Query: 1019 GVEKK 1023
             V  K
Sbjct: 1017 TVMDK 1021

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1038 (49%), Positives = 663/1038 (63%), Gaps = 41/1038 (3%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            M  KVNRDLF+KLASDLQEER  AA++L+K+L+ L LP ++EEW+YV+NRLIKGLASDR+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLS--FILDINVNETGK-KPVKG 117
            SARLGFSLCLTEVINLA++M     P+GL++++DFL  LS    LD N NE G  K  KG
Sbjct: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSGIFV--EDLKRGNTEFIIRFMEQLIDLALRKNWIKE 175
            +DERG+            NEP+FS +F+  +D K   T F  +FM +++DLAL+KNWIKE
Sbjct: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179

Query: 176  PCLYSLFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKY--ESDKDLVPS 233
             CL++LFQTI+ LLP  N+ T   I            +EGL+ YL + Y   +D  L  S
Sbjct: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239

Query: 234  TLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293
            ++  KN GWKNNDPL+RGNLPLLT+VLRDS+V   + G   +N+KKQ  +NWNPRLHFVW
Sbjct: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG--YENSKKQNASNWNPRLHFVW 297

Query: 294  NILLPLFGSGK---LENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSER 350
            +ILLP+  SGK     N +HIS          +P  I+FPEFWQM VDESFFNEKASSER
Sbjct: 298  DILLPILISGKHTTASNTQHISKKRKKNNNE-LPKHIEFPEFWQMVVDESFFNEKASSER 356

Query: 351  KYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEE 410
            KYLGFLI   T K V  + +  CFS N MR+LINQS DS+R+L+K++Q  L++II+ C+E
Sbjct: 357  KYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQE 416

Query: 411  DPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEK 470
            D  NKLV C++AM+FGP GSINFDKLTK+   SKLI+I  L                 EK
Sbjct: 417  DSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEK 476

Query: 471  KDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELA 530
             ++     +VLD+LLHI+R HK  +    I+ P+L P++  AFF      KE+E L+ELA
Sbjct: 477  SENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA-----KENEPLNELA 531

Query: 531  KERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNE 590
            KER  SIL ELT    +  ++P  +SWQ+  L +IL  E++ K +L N LDE L K KN+
Sbjct: 532  KERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKND 587

Query: 591  AISSLTEISKSNTS-QSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD-----ENSS 644
            A   + +I KS  S Q  GL +LLSMCL+QL++GET+S+S IEEL EF K+     E++S
Sbjct: 588  ACDVIVKIIKSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTS 647

Query: 645  MVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXX 704
            +VGITEI                 ++W+QFI +VG +EL ILLDVLK RENKQGFA L  
Sbjct: 648  LVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFE 707

Query: 705  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXVVNIDKEATSAL 762
                                                            V NIDKEATSAL
Sbjct: 708  GADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNIDKEATSAL 767

Query: 763  IKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXX-XQLSEIFKR 821
             KALNLP+NIVNDKGEVD+ +LE +S                          QLSEIFKR
Sbjct: 768  AKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQLSEIFKR 827

Query: 822  RKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGG 881
            RKEALS+ STGNQRK+E KESRENVIAFK R+VD+LT+YVK+ EKL  A+  +       
Sbjct: 828  RKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQ------- 880

Query: 882  PLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSA 941
               NL+ F+ PM+ C+++TLD+ LADK+SKLLK +IFKI++S FK+    +E+L+ LK  
Sbjct: 881  KFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVEVLEYLKKL 940

Query: 942  HKEMLTSKPGQHANVFFSACSTSSLFLSKLYV--DINGNDKFDDLIDLYASTTKQWTQKG 999
            H+++LT KPGQH  ++++  S++SLF SK+YV    +  + ++ LID Y++TTK W  K 
Sbjct: 941  HEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKS 1000

Query: 1000 KFGANIFIDFINWLSSKK 1017
            KFG N F DF NWL+S+K
Sbjct: 1001 KFGPNFFADFFNWLASRK 1018

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1035 (41%), Positives = 616/1035 (59%), Gaps = 50/1035 (4%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP+  +EWSYV+NRLIKGL+SDRN
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
             ARLGFSLCLTEV++LA+ M   + P+ L+SM+ FL  LS    I+  +  KK    + E
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKE-E 119

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RG+            NEPLFS IF++D K   T+F  +F+++L++LA RKNWIK+PCL++
Sbjct: 120  RGLMFGKLFALQALLNEPLFSDIFIKDGKI--TKFTTKFIDELVNLASRKNWIKQPCLFT 177

Query: 181  LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
            L+QTI+ LLP  ++S    +            NEGL+ YLL   +     + S + + N 
Sbjct: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLS-INVTNK 236

Query: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            GWK N+PL +GNL L+++V+R+SAV  D      DN  K  N NW+P+LHFVW+ILLP+ 
Sbjct: 237  GWKYNNPLLKGNLSLVSEVVRESAVVVD------DNETKTNNANWHPKLHFVWDILLPIL 290

Query: 301  GSGKLENA---EHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLI 357
             +   E     +                +I+FPEFW+  VDE++F++KASSERK+LG LI
Sbjct: 291  YNDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLI 350

Query: 358  IDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLV 417
                  TVP   I  CFS+N+MR LINQ  DS+R L+KIA+  L SI+K CE DP +KLV
Sbjct: 351  FLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLV 410

Query: 418  PCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHT 477
            P + A+LFG +GSINFD+LTK+   +KLIA K L                  +K++    
Sbjct: 411  PVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-AVL 469

Query: 478  HFVLDSLLHIIRAHKAEINDVEI----IKPVLSPIVYMAFFKHATDDKESEQLH--ELAK 531
            HF+LD+LLHI+R+HK  +    I    +  +L P+V + FF HAT+    ++++  E+A+
Sbjct: 470  HFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFF-HATETSPEDKINVSEIAR 528

Query: 532  ERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEA 591
            ER+YSIL EL+    + + D   +SWQF  L  +  +E  ++  LTN LDE L   K+  
Sbjct: 529  ERIYSILSELS---SVPTGDA--HSWQFHILNELTTVE--NELTLTNALDEDLTTVKDTG 581

Query: 592  ISSLTEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENS-----SMV 646
            +S +  +S  N   S G+ +LL+MCL+QLY+GE DS++ I+E+C++  +E S     S+V
Sbjct: 582  LSVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLV 641

Query: 647  GITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLXXXX 706
            GITEI                 ++W+Q I DVG  EL ++LDVL  RENK+GF+ L    
Sbjct: 642  GITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYL--FE 699

Query: 707  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKEATSALIKAL 766
                                                        V NID++   AL KAL
Sbjct: 700  GAEEYEKVSGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAKAL 759

Query: 767  NLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSEIFKRRKEAL 826
             LP+N+VN+ GEV  ++++ +                          QL++IFKRRK+AL
Sbjct: 760  KLPENVVNEDGEVKFNEIDDLE------DESSDDESMDDEAMMALDGQLADIFKRRKDAL 813

Query: 827  SSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNL 886
            S + TGN RK+EV++SRE+VI FK R++DMLTIYVK+ EKL + +K  +       L  +
Sbjct: 814  SHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMK----EKLQTV 869

Query: 887  VYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTS-AFKDLDKTIELLDLLKSAHKEM 945
              F+ PM+KC++ TLDRPLADKI KLLK KIFK++   + +D ++ +E L  +   +  +
Sbjct: 870  STFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDGERFVESLQRIHGTY--L 927

Query: 946  LTSKPGQHANVFFSACSTSSLFLSKLYVDI--NGNDKFDDLIDLYASTTKQWTQKGKFGA 1003
            L  K GQ+  +++S CS++S+F  KL ++   N +   +++ID+YA TTK+W  K KF  
Sbjct: 928  LAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPT 987

Query: 1004 NIFIDFINWLSSKKE 1018
            ++F DF NWLSSK++
Sbjct: 988  SVFFDFYNWLSSKRQ 1002

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1047 (40%), Positives = 588/1047 (56%), Gaps = 64/1047 (6%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE---EWSYVLNRLIKGLAS 57
            +  +VNRDLFFK+AS+L++ERL AA+ LI ++S ++     +   EW YV+ RL+KGLAS
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRNSARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKG 117
            +R  ARLGFS+CLTEVI LA+     +R   L S+  FL+ L   L       G     G
Sbjct: 66   NRGGARLGFSMCLTEVIALAL-----ERRDILPSIYAFLNQLEQTL-----PAGTAFKNG 115

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSGIFVE-DLKRGNTEFIIRFMEQLIDLALRKNWIKEP 176
            K+ERG+            NEP+FS +F+  D    N EF++ ++ +LI LAL K W++EP
Sbjct: 116  KEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREP 175

Query: 177  CLYSLFQTI-KMLLPTMNESTAAE-IXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPST 234
            CLYS++QTI K      N+ TA   I            NEGLS YL+  + + +D   S+
Sbjct: 176  CLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLM--FNAQRDTYSSS 233

Query: 235  LGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWN 294
            L + N GWKNNDPL++GN+ LL  VL+D  V P      + +  KQK T W PRLH+VW+
Sbjct: 234  LVIHNSGWKNNDPLSKGNVQLLASVLKD--VVP-----VEKSDLKQKGT-WAPRLHYVWD 285

Query: 295  ILLPLF---GSGKLENAEHISXXX---XXXXXXXVPSSIQFPEFWQMAVDESFFNEKASS 348
            ILLPL    GS       HIS                 IQFP+FWQ  VDESFFNEK+S+
Sbjct: 286  ILLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSN 345

Query: 349  ERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKAC 408
            ERKYLGFLI++   K      I    S+N++R +INQS DSQR+LNKI+   L SI+  C
Sbjct: 346  ERKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAEC 405

Query: 409  EEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXX 468
            E  P  K+VP +    FG +GSINFDKL K+ + + LI+   L                 
Sbjct: 406  ERSPA-KVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLP 464

Query: 469  E---KKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQ 525
            +    KD    T F+ D+ LHI RAHK  + +   +KP+LS I+  AFF  + + K    
Sbjct: 465  QDQSTKDSFNLTRFIFDTFLHITRAHKTRL-ESHWVKPLLSAIIKAAFFNESDNSK---- 519

Query: 526  LHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLE 585
            L ELAKERLYSILGEL       S D  I++W ++ L++IL +E S    L+  LDE LE
Sbjct: 520  LSELAKERLYSILGELISEPSKSSGD--ISTWPYIALQIILKIEGSG-STLSIDLDEDLE 576

Query: 586  KTKNEAISSLTE---ISKSNTSQSW-GLSTLLSMCLIQLYAGETDSISVIEELCEFAKD- 640
              +  AI SL +    +K+NT+    GL  LLS+ ++QLYAG+ +S+S++++L  F ++ 
Sbjct: 577  SVRKSAIKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEEC 636

Query: 641  --ENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQG 698
              E++ +VGITEI                 I+W+ F+ D+G  EL +LL  L  RENKQG
Sbjct: 637  DKESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQG 696

Query: 699  FALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDK-- 756
            FA L                                                   ++K  
Sbjct: 697  FADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIE 756

Query: 757  -EATSALIKALNLPDNIVNDKGEVDMDQ---LEGISXXXXXXXXXXXXXXXXXXXXXXXX 812
             EATSAL KALNLPD+IV + G+V +      +                           
Sbjct: 757  KEATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLD 816

Query: 813  XQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANK 872
             QLSEIFKRRKEAL S+ TGN+RKVEV+ESRENVI+FKHR+VDML IYVK  ++ A+A +
Sbjct: 817  DQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDR-AVA-R 874

Query: 873  GELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTI 932
               SI      +NL   I+P++KC++ TLD+ LADK +KL+K ++ K++ +  K+ +KT+
Sbjct: 875  NNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE-EKTV 933

Query: 933  --ELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDKFDDLIDLYAS 990
              E+  LL+  HK ++T+KPGQ   +FFS CS +SLFLSKLY+   G+   ++LIDLYA 
Sbjct: 934  TSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGS--HENLIDLYAD 991

Query: 991  TTKQWTQKGKFGANIFIDFINWLSSKK 1017
            T+K W + GK   N FIDF NWL +K+
Sbjct: 992  TSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1044 (38%), Positives = 575/1044 (55%), Gaps = 72/1044 (6%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L +  + +EW YVL RL++GLAS   
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
            SARLGFSLCLTEV   A+   +G     + S  ++L+ L   L ++      K   GK+E
Sbjct: 61   SARLGFSLCLTEVAAAALE--NGH----IGSAEEYLERLEAALPVD------KVKNGKEE 108

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
            RG             NEPLFS +FV    +    F  +FM++L+ LAL K W+++PCL++
Sbjct: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168

Query: 181  LFQTIKMLLPTMNEST-AAEIXXXXXXXXXXXXNEGLSTYLLLKYES-------DKDLVP 232
            L+Q I+ L P   ++     +            +EGL+ YL L+ +        D+  + 
Sbjct: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228

Query: 233  STLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFV 292
              L L    WK ++PLA+GN   L  VL+D A+        + +  KQK   W PRLHFV
Sbjct: 229  DALPLVK-RWKADNPLAKGNAKALASVLKDDALI-------EGDGPKQKGV-WTPRLHFV 279

Query: 293  WNILLPLFGSGKLENAEHISXXXXXXXXXXVPSS----IQFPEFWQMAVDESFFNEKASS 348
            W++LLPL    K+    H+             S+    + F EFWQ+ VDESFF+EKASS
Sbjct: 280  WDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASS 339

Query: 349  ERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKAC 408
            ERKYLG LI++   ++VP S +   FS+N +RTLINQS ++ R L+K++   L +I+ AC
Sbjct: 340  ERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSAC 399

Query: 409  EEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXX 468
            E D  +K+VP L+A+ FGP+G+INFDKLTK+  T  L+  K L AT              
Sbjct: 400  ETD-ASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLE 458

Query: 469  EKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATD-DKESEQLH 527
             +  D+    F+LD+LLH+IRAHK + + +    P+L  +V  AFF   +   ++SE++ 
Sbjct: 459  HENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEII 517

Query: 528  ELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKT 587
             L++ERL+S+LGEL     +   D    SW + TL L+L  ++ H   L   LD  LE  
Sbjct: 518  TLSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLLQEKEKHP--LALQLDAELETV 572

Query: 588  KNEAISSLTEI------SKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---- 637
             + A+  L +I      S +   Q +GL  LLS+ ++Q++AG+ DS S +EEL  F    
Sbjct: 573  TSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESA 632

Query: 638  AKDENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQ 697
             +  ++ +VGITEI                 ++W+ FI  VG +EL++LL+ L  RENK 
Sbjct: 633  TQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKA 692

Query: 698  GFALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDKE 757
            GFA L                                                V  IDKE
Sbjct: 693  GFAQL----FEGADEYEELGSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKIDKE 748

Query: 758  ATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLSE 817
            ATSAL  AL LPDNI+++ G V  ++                              QLSE
Sbjct: 749  ATSALAHALRLPDNILDEDGNVGFEE---------MDDEEEEEESMDDEAMMELDGQLSE 799

Query: 818  IFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSI 877
            IFKRRK+AL+ I TGNQRK+E KESR++VIAFKHR+VDML IY K+ E+    NK +LS 
Sbjct: 800  IFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK-KLSA 858

Query: 878  EIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTI---EL 934
             +    +N++    PM+K I++TLDRPLA+KISKLLK  + K++ +A+K+    I    +
Sbjct: 859  TMS---ANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESI 915

Query: 935  LDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLIDLYASTTK 993
            L  L++ H  +L+ KPGQ   +FFSACS++SLFLSK+ + +  +    + +I +Y++T K
Sbjct: 916  LTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMK 975

Query: 994  QWTQKGKFGANIFIDFINWLSSKK 1017
             W   GKFG N FIDFINWL+SKK
Sbjct: 976  HWNVSGKFGPNFFIDFINWLASKK 999

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/736 (47%), Positives = 463/736 (62%), Gaps = 40/736 (5%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
           M GKVNRDLF+KLASDL+EERL +AV+LIK+LS L +P D EEW+YVLNRLIKGLASDRN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINV------NETGKKP 114
           SARLGFSLCLTE INLA+ M     P+G++S+N+FLD LS  L I+       N+T  K 
Sbjct: 61  SARLGFSLCLTEAINLALGM-GDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119

Query: 115 VKGKDERGIXXXXXXXXXXXXNEPLFSGIFV-EDLKRGNTEFIIRFMEQLIDLALRKNWI 173
            KG+DERGI            NEPLFS IF+ ED K+ ++   IR++++L  L  +KNWI
Sbjct: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179

Query: 174 KEPCLYSLFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYES-DKDLVP 232
           +E C ++L+QTI+ LLP  +      +             EGL+ YLL+ Y S +K  + 
Sbjct: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239

Query: 233 STLG---LKNLGWKNNDPLARGNLPLLTKVLRDSAVAP-DTNGKAQDNTKKQKNTNWNPR 288
            TL    L N  WK+N+PLARGNLP LT +LRDS V     + K      KQ   NW PR
Sbjct: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWAPR 299

Query: 289 LHFVWNILLPLF---GSGKLENAEHISXXXXXXXXXXVPSS---IQFPEFWQMAVDESFF 342
           LHFVW+ILLP+     + +  N++                S   I+FPEFWQMA+DESFF
Sbjct: 300 LHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDESFF 359

Query: 343 NEKASSERKYLGFLIIDATFKTVP---GSCIGYCFSRNVMRTLINQSIDSQRILNKIAQI 399
           NEKASSERKYLGFLI   T +++       I  CF+RN MR+LINQS D++R+L+K++QI
Sbjct: 360 NEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMSQI 419

Query: 400 TLDSIIKACEEDPVNKLVPCLSAMLFGPH--GSINFDKLTKTSITSKLIAIKELPATXXX 457
            +D+I+K CE+DP NKL+PCL A+LF  +  GSINFDKLTK+   SKLI+IK L ++   
Sbjct: 420 AIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSSTLR 479

Query: 458 XXXX---XXXXXXXEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFF 514
                          +K+      F LD++LH++R+HK+E +   +++P+L+P+V +AFF
Sbjct: 480 QLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLAFF 539

Query: 515 KHATDDKESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKG 574
                 K++E L+ELAKERLYSIL ELT            +SW + TL+LIL++EKS   
Sbjct: 540 -----SKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQ 594

Query: 575 DLTNPLDEGLEKTKNEAISSLTEISKSN----TSQSWGLSTLLSMCLIQLYAGETDSISV 630
           +L N LD  LE  KN  +  L EIS +N    T QS GL  LLSMC++QL++G+T+S+S 
Sbjct: 595 ELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLST 654

Query: 631 IEELCEF----AKDENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQIL 686
           IEEL EF     ++E++S+VGITEI                  +W+ FI D+G  EL +L
Sbjct: 655 IEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVL 714

Query: 687 LDVLKTRENKQGFALL 702
           L VL  RENKQGFA L
Sbjct: 715 LAVLPVRENKQGFAHL 730

 Score =  270 bits (689), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 188/284 (66%), Gaps = 25/284 (8%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXX 810
            + NIDKEATSAL KALNLP+NIVN+KGEVD+ +LE +S                      
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 811  XXX------QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHC 864
                     QLSEIFKRRKEALS+ISTGNQRK+EVKESRENVIAFKHR++DML IY+K+ 
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 865  EKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSA 924
            E L       L+ E G    NL+ FI PMIKC+K+TLD+ LADK+ KL+K K+FKI++S 
Sbjct: 907  EGLT------LTTENGEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSN 960

Query: 925  FK------DLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN 978
            F+      D D+ +E   LL+  H+ +LTSK GQ  ++++S CST S+FL K+ V +  N
Sbjct: 961  FQIESLNADDDRVME---LLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESN 1017

Query: 979  DK---FDDLIDLYASTTKQWT-QKGKFGANIFIDFINWLSSKKE 1018
            DK   +  LIDLY  TTK W   KGKFG N F DF NWLSS+++
Sbjct: 1018 DKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1045 (37%), Positives = 562/1045 (53%), Gaps = 75/1045 (7%)

Query: 4    KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSAR 63
            ++NRDLF+KLASDL EERL A + L+  LS LE   DS EW YVL+RLIKGL+S RN AR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 64   LGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVK-GKDER 121
            LGFSLCLTEV+ LA+        KG L  ++ ++  L       ++   K+ VK GK+ER
Sbjct: 63   LGFSLCLTEVVALALE-------KGVLARVDQYMHLL-------ISALSKENVKNGKEER 108

Query: 122  GIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSL 181
            G+            NEPLFS +F  D  + N E +  +M  LID+AL K WI+E  L++L
Sbjct: 109  GLLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTL 168

Query: 182  FQTIKMLLPTMNESTAAE-IXXXXXXXXXXXXNEGLSTYLLLKYESD-------KDLVPS 233
            FQ ++ L P +      + +            +EGL+ YL L +          K     
Sbjct: 169  FQAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLD 228

Query: 234  TLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293
             L LKN  WKNNDPL RGNLP ++  L+DS       G   D +  QK   W PRLHF W
Sbjct: 229  ELNLKN-PWKNNDPLKRGNLPAISNALKDS-------GARDDPSLTQKGV-WAPRLHFAW 279

Query: 294  NILLPLFGSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYL 353
            +I+L      +      +             + I+FPEFW+  VDESFFNEK+SSERKYL
Sbjct: 280  DIVLQTLLHAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYL 339

Query: 354  GFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPV 413
            G L+ + TF+  P   +   FS+N++R LINQ   ++R L+KI+Q  L +I++ C+  P 
Sbjct: 340  GILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQP- 398

Query: 414  NKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDD 473
             K  P    + FG +G+INFD LTKT   + L++ K L +                   +
Sbjct: 399  EKTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKE 458

Query: 474  LPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHA--TDDKESEQ----LH 527
            L    F+LD++LH++RAHKA  ++V  +KPVL  +V + FF+ +   D K+S++    L 
Sbjct: 459  LSRARFILDAILHLVRAHKAHADEV-WLKPVLKALVCLGFFQQSELKDVKDSQESFHSLS 517

Query: 528  ELAKERLYSILGE-LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEK 586
             +A ERL+SIL + LT+ ++  S       W F+ ++L+     +++  L   +DE L  
Sbjct: 518  SIASERLFSILADLLTVEQDTYSV-----CWPFIAVQLL--KTDTNQKTLLQSMDEELGD 570

Query: 587  TKNEAISSLTEISK----SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD-- 640
              + +++ L+ IS+    +N SQ  GL  L S+ ++Q YAGE +SISV+E+L  F  +  
Sbjct: 571  ILDSSMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFE 630

Query: 641  ---ENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQ 697
               +++ + G  EI                 + W+ F+ DV  K+L +LL+VL TRENK+
Sbjct: 631  DGAKSAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKE 690

Query: 698  GFA-LLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVNIDK 756
            GF+ L                                                 +  IDK
Sbjct: 691  GFSNLFEGGSESEGDSEEDEEMNDEEEPEKDASDDEIEESDNNVSEDDSSSDDDMGKIDK 750

Query: 757  EATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXXQLS 816
            EATSAL KALNLPD+IV+DKGEV                                  QLS
Sbjct: 751  EATSALAKALNLPDSIVDDKGEVRF-----EDLGDTDEEEEESEEDLDDEKMMELDGQLS 805

Query: 817  EIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELS 876
            EIFKRRKEALS I TGN+RK EVKESRENVIAFKHR+VDML I V+  E   +   G + 
Sbjct: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIES-KMKKDGHIE 864

Query: 877  IEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIR---TSAFKDLDKTIE 933
              +   L  +   I+P++ CI+ TLD+PLA+KI+KLLK KI K++   +S  + +DK   
Sbjct: 865  KSV---LDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLKPSFSSTTEKVDKK-A 920

Query: 934  LLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLIDLYASTT 992
            +L LL+S H+ ML  K GQ   ++FS CST+S+FL++L VD     + +++L  +Y  T 
Sbjct: 921  VLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKTL 980

Query: 993  KQWTQKGKFGANIFIDFINWLSSKK 1017
              W   GKFG ++F++F+NWLS KK
Sbjct: 981  DGWFVTGKFGVSMFVEFLNWLSVKK 1005

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/711 (46%), Positives = 458/711 (64%), Gaps = 30/711 (4%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
           M GKVNRD F++LASDLQ+ER+ AAV+LI++LSALELP+ +EEWSYVL RLI GLAS RN
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
           SARLGFSLCL+EV+ +A++  +   P+ L S + +L+ LS  L  +     KK +KGKDE
Sbjct: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119

Query: 121 RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
           RGI            NEPLF+ IF  D +   + F +RF ++L +LA++KNW++E CLY+
Sbjct: 120 RGILFGKMFGLQAILNEPLFTSIFF-DQEGKVSPFALRFAQELAELAVKKNWLRESCLYT 178

Query: 181 LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKD-----LVPSTL 235
           LFQT++ L+P M     + I            NEGL+ YLLL +   +       VPS+L
Sbjct: 179 LFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238

Query: 236 GLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNI 295
            L+   WKNNDPL++GNLP L++VLRD   AP  + +  D +   K+ NWNPRLHFVW+I
Sbjct: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRD---APANDSEVADGSHP-KSANWNPRLHFVWDI 294

Query: 296 LLPLFGSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGF 355
           L+P+   GK  + E  S              I+FPEF+Q AVDE+FF+EKASSERKYLGF
Sbjct: 295 LIPILAPGK-SDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGF 353

Query: 356 LIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNK 415
           L+     + V    I  CF++N MRTLINQS DS+R+LNKI+Q  LD+I+KACE+D   K
Sbjct: 354 LVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEK 413

Query: 416 LVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXX-XXXXXXXXXEKKDDL 474
           +  CL AMLFGPHG+I+FDKLTK+   SKL+AIK++ ++               E++ + 
Sbjct: 414 IALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNK 473

Query: 475 PHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERL 534
            H  FVLD++LH +R H+ EI+   I  P+L  IV +AFF      K+ E + +LA+ERL
Sbjct: 474 QHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFF-----SKKGEDISDLARERL 528

Query: 535 YSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISS 594
           +SIL ELTI K+ +       SWQ  TL+LIL  E +   +  N LDE L+  + EA+  
Sbjct: 529 FSILSELTIQKDGQ-------SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDI 580

Query: 595 LTEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD---ENSSMVGITEI 651
           L  IS S++ QS GL  LLS CL+QLY+G+++S+S++EELC F ++   E++S+VGITEI
Sbjct: 581 LQNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEI 639

Query: 652 XXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702
                            ++W+QF+ +VG +EL+ILL+VL  RENK+GFA L
Sbjct: 640 LLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKL 690

 Score =  273 bits (697), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 185/282 (65%), Gaps = 15/282 (5%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEG-----------ISXXXXXXXXXXX 799
            V  ID+EATSAL KALNLP+NIVNDKGEVD+++LE                         
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 800  XXXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTI 859
                          QLS+IFKRRKEALS ++TGN+RKVEVKE+RENVI FKHRIVDML  
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 860  YVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFK 919
            Y+KH +++A+ +  +          NL  F+ PMI+C++ TLD+PLADKISKLLKG+++K
Sbjct: 875  YIKHADRIALQDNND-EANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933

Query: 920  IRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGND 979
            I+ SAFK    +  LL+ L+  HK +LTSKPGQ   ++FS CST+SLFL K+ V+ N  D
Sbjct: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSED 993

Query: 980  ---KFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018
                +  +IDLYA TTK+W   GKFGAN+F DF NWL S+K+
Sbjct: 994  PAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/710 (47%), Positives = 451/710 (63%), Gaps = 29/710 (4%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
           MTG+VNRD F+KLASDLQEER+ AAVALI++LSAL+LP  + EWSYVL RLI GL+S RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61  SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVN-ETGKKPVKGKD 119
           SARLGFSLCLTEVINLA+N+  G RP+ L S++ FLD LS  L +  + +  KK +KGKD
Sbjct: 61  SARLGFSLCLTEVINLALNL-EGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKD 119

Query: 120 ERGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLY 179
           ERG+            +EPLF  +F+   ++G ++F +RFM++L  LA+ K+W++EPCL+
Sbjct: 120 ERGLLFGKMFGLQALLSEPLFEKVFISK-EKGISDFALRFMDELCQLAVFKSWLREPCLF 178

Query: 180 SLFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGL-- 237
           +LFQ  + +LP  +  TA  +            NEGL+ YLLL Y+S +D   S L +  
Sbjct: 179 TLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDF 238

Query: 238 KNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILL 297
           ++  WK+NDPLARGNLPLL++VLRDS+VA +       +    K +NW PRLHFVW+ILL
Sbjct: 239 ESKSWKSNDPLARGNLPLLSQVLRDSSVATE-------DESSPKASNWTPRLHFVWDILL 291

Query: 298 PLFGSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLI 357
           P+                         ++IQFPEFWQMAVDES FNEKAS+ERK+LG +I
Sbjct: 292 PIITQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVI 351

Query: 358 IDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLV 417
                +  P   +G CFS+NVMRTLIN + DS+R+L KI+   L+SI+  C++ P  KLV
Sbjct: 352 FQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLV 411

Query: 418 PCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKK-DDLPH 476
           PCLSA+LFGPHGSINFDKLTK+   + L+A+  L  T              E    +  +
Sbjct: 412 PCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKN 471

Query: 477 THFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYS 536
             F+LD++LH +R+HK+E+N   I+  +L PI+ +AFF       + E    LAKER YS
Sbjct: 472 QQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFT-----VKDEHTSNLAKERFYS 526

Query: 537 ILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLT 596
           IL E+T    + +E P   S+Q + L +I D E +   +LT  LD+ LE  K+EA+ +L 
Sbjct: 527 ILSEIT---HLNNEGP---SYQNMALDIIRD-EIAAGKELTTKLDDTLEDVKSEALRTLQ 579

Query: 597 EISKSNTS-QSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAK--DENS-SMVGITEIX 652
            IS +  + Q  GL  L+SMCL+QLY+GE++++SVIEELC F +  DENS S+VGITEI 
Sbjct: 580 AISNNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDENSTSLVGITEIL 639

Query: 653 XXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702
                             WQQF+ ++G  EL+ LLDVL  RENK+GF+ L
Sbjct: 640 LSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQL 689

 Score =  251 bits (642), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 180/280 (64%), Gaps = 20/280 (7%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQ----------LEGISXXXXXXXXXXXX 800
            V  IDKEATSAL KALNLPDNIVNDKGEVD++                            
Sbjct: 745  VAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDE 804

Query: 801  XXXXXXXXXXXXXQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIY 860
                         QLS+IFKRRK+ALS+ISTGNQRK E KESRE+VIAFK R++DML IY
Sbjct: 805  DSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIY 864

Query: 861  VKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKI 920
            VK  EK ++        E    +S+ +  + PMIKCI++T D+ LA++I+KLL+ K+FK+
Sbjct: 865  VKFVEKQSLKE------ENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKL 918

Query: 921  RTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK 980
            +TSAF       EL+++L+  H+++ T KPGQH  +++S CST+SLFL+K+ ++ N + K
Sbjct: 919  KTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIE-NSDSK 977

Query: 981  ---FDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKK 1017
                 D+IDLYA T KQW   GKFG NIFIDF NWLSS+K
Sbjct: 978  DAAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1051 (36%), Positives = 554/1051 (52%), Gaps = 83/1051 (7%)

Query: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
            +  +V+RDLF+KLASDL EERL A + L+  LS +E   +S EW YVLNRLIKGL+S RN
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59

Query: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120
             ARLG+ LCLTEV+  A+        K + +  D      ++  +    + +    GK+E
Sbjct: 60   GARLGYCLCLTEVVASALE-------KSVLAHAD-----EYLRLLLSTLSRENIKNGKEE 107

Query: 121  RGIXXXXXXXXXXXXNEPLFSGIF-VEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLY 179
            RGI            NEPLFS +F  ED    N EF++ ++  LID+AL K WI+E  ++
Sbjct: 108  RGILFGKLFGLQVLLNEPLFSQVFKAED--EINLEFMLTYVGTLIDVALAKTWIRESSMF 165

Query: 180  SLFQTIKMLLPTM-NESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLK 238
            +L+Q I+ L P M ++     +            +EGL+ YL L ++S      +T  L+
Sbjct: 166  TLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKS----FITTGALR 221

Query: 239  NLG----------WKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPR 288
              G          WKNNDPL++GNLP +   L++          ++D + KQK   W PR
Sbjct: 222  KKGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEI-------NSSEDLSVKQKGI-WMPR 273

Query: 289  LHFVWNILL-PLFGSGKLEN-AEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKA 346
            LHFVW+I+L   F  G+ E+ A   +              I+FPEFW+  VDESFFNEK+
Sbjct: 274  LHFVWDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKS 333

Query: 347  SSERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIK 406
            SSERKYLGFL+ +  F   P S      S+N+ R LINQ   S+R L+K++Q  L +I+ 
Sbjct: 334  SSERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVD 393

Query: 407  ACEEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXX 466
             C+  P  K  P    +    HGSI+FD+LTK+   + L++ K L               
Sbjct: 394  VCKNQP-EKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNH 452

Query: 467  XXEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESE-- 524
                  D     F+LD++LH++RAHK+  + V  + P+L  +V   FF+   +D++ E  
Sbjct: 453  LFTSLRDHSRVRFLLDAMLHLVRAHKSAADKV-WLAPLLDSLVQQGFFELDENDRQPEVG 511

Query: 525  ----QLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPL 580
                 + +LA ERLYSIL +L I+ + +SE      W   T+ ++  M K  K  L NP+
Sbjct: 512  DETFTVSKLAVERLYSILADL-ISADYKSEKV---CWPRFTVEIL--MSKLKKNKLLNPM 565

Query: 581  DEGLEKTKNEAISSLTEISK-----SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELC 635
            DE L +  N +I +   I           Q+ G   + S+ ++Q Y+GETDSI V+++L 
Sbjct: 566  DEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLN 625

Query: 636  EFAK----DENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLK 691
             F +    +++ S  G  EI                 ++W+ F+G+    ++ +LL++L 
Sbjct: 626  SFHQTLEENKSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILP 685

Query: 692  TRENKQGFALLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV 751
             RENK+GF+ L                                                +
Sbjct: 686  ARENKEGFSKLFEGDDEGGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGEDTEQI 745

Query: 752  VNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXX 811
               DKEATSAL+KALNLP++IVND GEV                                
Sbjct: 746  ---DKEATSALVKALNLPESIVNDNGEVHF------EDLEDTEDEEISDEDLDDEKMMEL 796

Query: 812  XXQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCE-KLAIA 870
              QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHR+VDML I+V+  E +L   
Sbjct: 797  DGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQG 856

Query: 871  NKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDK 930
             + E S+      S ++  I+P+I C++ TLD+PLA+K++KLLK KI K++ +    LD 
Sbjct: 857  GRPEKSV-----TSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDG 911

Query: 931  TIELL--DLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLIDL 987
              E L  + LKS H+ ML  K GQ  N++FSACST+S+FL+KL+V  +   + +  L ++
Sbjct: 912  LEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEV 971

Query: 988  YASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018
            Y  T  +W   GKF AN+FI+F+NWLS KK+
Sbjct: 972  YHKTLNEWFVGGKFSANLFIEFLNWLSIKKQ 1002

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/707 (44%), Positives = 443/707 (62%), Gaps = 36/707 (5%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE-EWSYVLNRLIKGLASDRNSA 62
           KVNRD F+KLASDL EER+ +AVALIKDLSAL+ PS+ E E+ YVLNRLI GL+S+RNSA
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALK-PSEVEKEFEYVLNRLISGLSSNRNSA 61

Query: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDERG 122
           RLGFSLCLTEV+NLA++    Q    L S++DFLD +   L ++   TGKK  KGKDERG
Sbjct: 62  RLGFSLCLTEVVNLALDRKD-QPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERG 120

Query: 123 IXXXXXXXXXXXXNEPLFSGIFVEDLKRGN-TEFIIRFMEQLIDLALRKNWIKEPCLYSL 181
           I            NEPLF+ +F++  K G  ++F IRF  QL++LA+ KNW++EPCL++L
Sbjct: 121 IMFGRMFALQALLNEPLFAKVFID--KNGKISKFAIRFQTQLVELAVLKNWLREPCLFTL 178

Query: 182 FQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNLG 241
           +QT++  +P ++ S    +            NEGL+ YL L + + K  + S+L L++ G
Sbjct: 179 YQTVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQG 237

Query: 242 WKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLP-LF 300
           WK NDPLA+GNLP LT+VL +S +        Q  T +    NW+PRLHFVW+ILLP L 
Sbjct: 238 WKLNDPLAKGNLPTLTQVLLNSNIN-------QSETPQGNAANWSPRLHFVWDILLPILL 290

Query: 301 GSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360
           G     N EH+S            +SI+F  FW+M VDESFFNEK+SSERKYLGFLII  
Sbjct: 291 GQDSTTNDEHVSKKQKSKTTS--STSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQK 348

Query: 361 TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420
           + + VP   +   F +NV+R++INQS D++R+L+KI+Q  L+SII+ACE+D   K+ P +
Sbjct: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKD-TTKITPIV 407

Query: 421 SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDDLPHTHFV 480
             +LFG +G+ NFDKLTKT   +K+++IK L                    + +    FV
Sbjct: 408 KVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQFV 467

Query: 481 LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540
           LD++LH++R HK E+N   II  +L+P++ +AFF      KE+E++  +AKER +S+L E
Sbjct: 468 LDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFL-----KENERISNIAKERFFSLLSE 522

Query: 541 L-TINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEIS 599
           L  I    R       SWQ+  L LI + E S    L   +D+ L   K + I  L E++
Sbjct: 523 LAAITTSTR-------SWQYTALELISNKEASG-SPLNQEMDQDLIAIKEKGIECLKEVT 574

Query: 600 -KSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF---AKDENSSMVGITEIXXXX 655
            KS+T Q  GL  LLSM L+QLYAG+ DS+S++E+LC F    +D++ S+VGITEI    
Sbjct: 575 KKSDTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLAL 634

Query: 656 XXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702
                        + W+QF+  +G +E+++L+DVL  RENK+GFA L
Sbjct: 635 LAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQL 681

 Score =  254 bits (650), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 182/275 (66%), Gaps = 11/275 (4%)

Query: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXX 813
            I+KE TSAL KALNLPDNI+N+ GEVD+D LEG+S                         
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 814  -----QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLA 868
                 QLSEIFKRRKEALSS+++GNQRK++VKESRENVIAFKHRI+D+L  Y+K+ EK+ 
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 869  IANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFK-- 926
                 +  I     L+ +   +  M++CI+ TLDRPLADKISKLLK K+FKI  + F   
Sbjct: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918

Query: 927  DLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK----FD 982
            ++     +L  LK+ H+ ++TSKPGQHA+++FS CSTSSLFLSKL ++    D+    F 
Sbjct: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978

Query: 983  DLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKK 1017
             LID+Y   +K+W  KG+FG  +F+DF NWL+SKK
Sbjct: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/733 (44%), Positives = 446/733 (60%), Gaps = 43/733 (5%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
           M+GKVNRDLF+KLAS+L EERL AAV++I++LSAL+LP  +EEW+YVL RLIKGL+SDR 
Sbjct: 4   MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61  SARLGFSLCLTEVINLAMNMPS-GQRPKGLESMNDFLDTLSFILDINV-NETGKKPVKGK 118
            ARLGFSLCLTEVINLA+++   G     L +++ +L  LS  L I+  N+   K +KGK
Sbjct: 64  GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 119 DERGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCL 178
           DERG+            NEPLFS  F+ + K+  + F  RFM +L+DLA RKNWI+EPCL
Sbjct: 124 DERGLLFGKMFGLKALLNEPLFSKTFLPN-KKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 179 YSLFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKY---ESDKDLVPST- 234
           ++LFQT++ LLP  +      +            NEGL+ YLLL +   E  K+      
Sbjct: 183 FTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIK 242

Query: 235 -LGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293
            L LKN  WK NDPLARGNLP LT+VLR+S++A      +++   +  + NW PRLHFVW
Sbjct: 243 LLVLKNSSWKLNDPLARGNLPRLTQVLRESSLA------SEEKKVEVMSANWQPRLHFVW 296

Query: 294 NILLPLFGSGKLENAE-HISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKY 352
           +ILLP   + +  + E H+S            + I+FPEFWQM VDESFFNEKASSERKY
Sbjct: 297 DILLPTVSTIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKY 356

Query: 353 LGFLIIDATFKTVPGSCIG-YCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEED 411
           LGF I +     V        CFS+N MR+LINQS D+ R+L+KI+   +++I+KACEE 
Sbjct: 357 LGFSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEES 416

Query: 412 PVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELP-ATXXXXXXXXXXXXXXEK 470
           P  KL+P + ++LF  +GS NFDKLTK+   SKLI+I  L   T                
Sbjct: 417 PSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGT 476

Query: 471 KDDLPHTHFVLDSLLHIIRAHKAEINDV--------EIIKPVLSPIVYMAFFKHA----T 518
            +D   T F+LDSLLHI+R+HK +I D          IIK  ++P+V +AFF        
Sbjct: 477 SEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKK 536

Query: 519 DDKESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTN 578
           +D+   Q+ ELAKERL+S+L ELT      + + Q++SWQ+ TL  I+D E  +   L N
Sbjct: 537 EDESDNQVDELAKERLFSVLSELTT-----TTNKQLHSWQYYTLLEIIDRENENPNSLIN 591

Query: 579 PLDEGLEKTKNEAISSLTEIS----KSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEEL 634
            +D+ L+  ++ AI  +  I+    K+ +S   GL +LLSMCL+QLY+G+ DS++ IEEL
Sbjct: 592 KMDDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEEL 651

Query: 635 CEFAK-----DENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDV 689
             F       +E  +MVGITEI                 ++W+QF+ ++    L +LLDV
Sbjct: 652 ITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDV 711

Query: 690 LKTRENKQGFALL 702
           L  RENKQGFA L
Sbjct: 712 LPARENKQGFAEL 724

 Score =  251 bits (640), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/271 (50%), Positives = 183/271 (67%), Gaps = 24/271 (8%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXX 810
            +  IDKEATSAL KALNLPD+I+N+ GEV+ D L   S                      
Sbjct: 775  IAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMELDD--- 831

Query: 811  XXXQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIA 870
               QL+EIFKRRKEALSS+STGNQRK+EVKESRE+VIAFKHR+ D+L+IY+KH E     
Sbjct: 832  ---QLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAE----- 883

Query: 871  NKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDK 930
               EL      P    + FI PM+KC+++TLD+ LADKISKLLK K++K++T   +++  
Sbjct: 884  -DSEL------PAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITA 936

Query: 931  TIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK---FDDLIDL 987
              ++ D + S H+ +LTSKPGQ+   F+S CS++S+FLSKL + ++ NDK   +  ++D+
Sbjct: 937  E-QVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVS-NDKEEAYGKIVDI 994

Query: 988  YASTTKQWTQK-GKFGANIFIDFINWLSSKK 1017
            Y+ TTK+W  K  KFG+NIFIDF NWLSSKK
Sbjct: 995  YSETTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  516 bits (1330), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 309/738 (41%), Positives = 437/738 (59%), Gaps = 71/738 (9%)

Query: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60
           M  K+NRDLF+KLASDLQEER+ AA++LIK+L++LE  ++  EW YVLNRLIKGL+S+RN
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVKGKD 119
           SARLGFSLCLTEV+++A+        KG L S+ +++  L   L   + ET K    GK+
Sbjct: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL---LKETVKN---GKE 105

Query: 120 ERGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLY 179
           ERG+            NEPL S IF++     N  F++ FM +L+ +AL K WI+EPCL+
Sbjct: 106 ERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLF 165

Query: 180 SLFQTIKMLLPTMNESTAAE-IXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLG-- 236
           +LFQ ++ L P +N++   E I            NEGL+ YL L +     L P T    
Sbjct: 166 TLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIH-----LCPGTSKFI 220

Query: 237 -----LKNL----GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNP 287
                LKNL     WKNNDPL +GNLP L+ VL+D  V+P      +D+  KQK + W P
Sbjct: 221 KKSGLLKNLELNSQWKNNDPLTKGNLPTLSAVLKD--VSP-----VEDSGLKQKGS-WAP 272

Query: 288 RLHFVWNILLPLFG---SGKLENAEHISXXXXXXXXXXVP-SSIQFPEFWQMAVDESFFN 343
           RLHFVWNI+LP+       +  + EHI+          V    I+FPEFW+  VDESFFN
Sbjct: 273 RLHFVWNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFN 332

Query: 344 EKASSERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDS 403
           EK+S ERKYLGFLI++A FK VP S +   FS+N+MRTLINQS DS+RIL+KI+Q  L S
Sbjct: 333 EKSSGERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLAS 392

Query: 404 IIKACEEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKEL-PATXXXXXXXX 462
           I++ CE  P +K VP + AMLF  +G+INFDKLTKT     L+A   + P          
Sbjct: 393 ILELCESHP-DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLF 451

Query: 463 XXXXXXEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHA----- 517
                 +  ++   T F+LDS+LH++R HK  ++D   +KP+++ ++ M FFK +     
Sbjct: 452 VSHLPDDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVD 510

Query: 518 ---TDDKESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKG 574
               DD  ++     A+ERLYSIL +L     +  +     SW ++TL+++L  E+S   
Sbjct: 511 QENQDDDHTDGFEFQARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQEQSK-- 565

Query: 575 DLTNPLDEGLEKTKNEAISSLTEISKS-----NTSQSWGLSTLLSMCLIQLYAGETDSIS 629
           +L +PLD+GL K K +A++ L  I +      + SQ +GL  LLSM ++Q+Y G+T+S+S
Sbjct: 566 ELIHPLDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLS 625

Query: 630 VIEELCEFA-----KDENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQ 684
           V+E+L  F        E +S++G+ EI                 ++W+ F+  VG  EL+
Sbjct: 626 VLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELE 685

Query: 685 ILLDVLKTRENKQGFALL 702
           +L D+L  RENK+GF  L
Sbjct: 686 VLFDILSARENKEGFTAL 703

 Score =  226 bits (577), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/273 (47%), Positives = 172/273 (63%), Gaps = 11/273 (4%)

Query: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXX 813
            IDKE TSAL KALNLPD I+N+ GEV+ ++L   S                         
Sbjct: 782  IDKETTSALAKALNLPDGIINENGEVNFNELS-ESDDEDESEEDEDEESMDDEKMMELDD 840

Query: 814  QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKG 873
            QLS+IF+RRKEALS ISTGN+RK+E KESRENVIAFKH++VDML ++VK  E+ +  NK 
Sbjct: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTS-KNK- 898

Query: 874  ELSIEIG-GPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTI 932
                E G   L ++     P+IKC+++T D+ LADK+SKL+K ++ K++     +    I
Sbjct: 899  ----ECGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDI 954

Query: 933  ELLDL--LKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK-FDDLIDLYA 989
            E L +  L + H+ ML  K GQ  N++FS CS  SLFLSKL V  + ND  +D LID+Y 
Sbjct: 955  EELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYL 1014

Query: 990  STTKQWTQKGKFGANIFIDFINWLSSKKEGVEK 1022
            ST K+W  KGKFG + F DFINWL+SKK+   K
Sbjct: 1015 STMKKWFSKGKFGTSFFFDFINWLASKKQTSSK 1047

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  475 bits (1222), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 301/716 (42%), Positives = 432/716 (60%), Gaps = 42/716 (5%)

Query: 3   GKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSA 62
            KVNRD F+KLASDL EERL AAV +IKDLSALE+P + EEW+Y +NRL+KGL S RNSA
Sbjct: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDERG 122
           RLGFS+CL+E +NLA+++   + P+GL S+ ++L  L+  L  + +E  K+  KGKDERG
Sbjct: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFDEGKKR--KGKDERG 118

Query: 123 IXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSLF 182
           I            NEPLFS +FV   K G + F+  F++++I+L+  KNWI+EP L+SL+
Sbjct: 119 ILFGKLFGLQALLNEPLFSNVFVT--KDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176

Query: 183 QTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDK--DLVPSTLGLKNL 240
           QT++ L+  +++S    +            NEGL+ YLLL  ES+K      + + L+N 
Sbjct: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236

Query: 241 GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDN-TKKQK-NTNWNPRLHFVWNILLP 298
           GWK+NDPLA+GNLP LTKVL D+    D    A+DN  +KQK   NWNPRLHFVW  LL 
Sbjct: 237 GWKSNDPLAKGNLPSLTKVLLDN----DGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLS 292

Query: 299 LF--GSGKLENAE--HISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLG 354
               GS  L N E  H+S            +SI+F EFWQM VDE++FN+KASSERKYLG
Sbjct: 293 TIINGSHSL-NVEDKHVSKKRKKNNTI---ASIKFHEFWQMVVDETYFNDKASSERKYLG 348

Query: 355 FLIIDATFKTVPG-SCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPV 413
           FLI    F  +     +     +N +R+LINQ  + +R LNKIA  T++ I+++CE D  
Sbjct: 349 FLIFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCEND-T 407

Query: 414 NKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXXEKKDD 473
            K++P    + FG  GSI FD+L+KT + S+L+ IK +                  K ++
Sbjct: 408 TKILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEE 467

Query: 474 LPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKER 533
              + F+LDS+LH++R  KAE++ + + + VL  IV +AFF   T D E+  L E++KER
Sbjct: 468 KSFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF---TGDNET--LQEMSKER 522

Query: 534 LYSILGELTINKEMRSEDPQINSWQFLTLRLILD-MEKSHKGDLTNPLDEGLEKTKNEAI 592
           L+SIL EL  N    SE  +I   Q++ ++L+   +E   K  +T+ LD+ L +T++ A+
Sbjct: 523 LFSILSEL--NSLHLSESQEIP--QYVVIKLVQQHIEGGEK--MTSELDDELRETESSAL 576

Query: 593 SSLTEISKSNTSQSW--GLSTLLSMCLIQLYAGETDSISVIEELCEFAK----DENSSMV 646
             L EI+K+ T + +  GL +L + CL+QLY G+++S+  ++EL +  +    D+   + 
Sbjct: 577 RILAEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLS 635

Query: 647 GITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702
            ITEI                  +W+Q +  V   EL +LLD+L  RENKQGFA L
Sbjct: 636 SITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQL 691

 Score =  233 bits (594), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 130/272 (47%), Positives = 183/272 (67%), Gaps = 10/272 (3%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXX 810
            V NIDKE TSAL KAL+LP +I+N  GEVD+++L                          
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKL---EMQSDDDEDDEDDESMDDEQMMD 809

Query: 811  XXXQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIA 870
               QLSEIFKRRKEALS+I TGN+RK EVKESRE+VIAFKHRIVD+L +Y+KH EK+ I 
Sbjct: 810  LDDQLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKM-IQ 868

Query: 871  NKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDK 930
             +          L+ L+ F IPMIKCIK+TLD+ LA+K++KLLK ++FKIR +  K LD 
Sbjct: 869  REDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIK-LD- 926

Query: 931  TIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGNDK---FDDLIDL 987
            T ++++  +  H++ L +KPGQ   +++S CS++SL+ SK+ VD N + +   ++ L+D 
Sbjct: 927  TADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVD-NADYQQGVYETLVDT 985

Query: 988  YASTTKQWTQKGKFGANIFIDFINWLSSKKEG 1019
            Y++T K+W +  KF  +IF+DF+NWL+SKK+G
Sbjct: 986  YSTTIKEWLKDTKFPHSIFLDFVNWLASKKQG 1017

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  473 bits (1216), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 280/717 (39%), Positives = 415/717 (57%), Gaps = 53/717 (7%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE-EWSYVLNRLIKGLASDRNSA 62
           +V+RDLF+KLASD+ EER+ + V ++ +L  L +  + E EW YV++RL+KGL S+RNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63  RLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTL--SFILDINVNETGKKPVKGKDE 120
           RLGFS+CLTE ++L ++    +RP+ L+ + D+L  +   F L        K  VKGKDE
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 121 RGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180
           RG             NEPLFS +F       + +F+I F E++I L   KNW+ EPC +S
Sbjct: 122 RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 181 LFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPSTLGLKNL 240
           L+Q I+ LLP +++  A               NEGLS YLLL     K    S   L+N 
Sbjct: 175 LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230

Query: 241 GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300
            WK NDPL +GNL ++ KV+ D+ V         D      N NW PRLH++W+I+L  F
Sbjct: 231 AWKANDPLQKGNLSVMAKVMLDTNV---------DGANSNTNKNWAPRLHYIWDIILREF 281

Query: 301 GSGKLE--NAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLII 358
              +    +A+H+            P  ++F  FWQ  VDESFFN+KAS ERKY G+LI 
Sbjct: 282 FDNEQHGSDAKHVYQKKKHDKSKN-PQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIF 340

Query: 359 DATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVP 418
               ++VP S + YCF++N+MR++INQ+ DS+R+LNK++Q TL++++  CE +P  KL P
Sbjct: 341 QKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTP 399

Query: 419 CLSAMLFGPHGSINFDKLTKTSITSKLIAIKE-----LPATXXXXXXXXXXXXXXEKKDD 473
            L+A+LF   GS+NFD LTK+   S+L+A K+     L                  + ++
Sbjct: 400 VLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEE 459

Query: 474 L-PHTHFVLDSLLHIIRAHKAEI-NDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAK 531
           L P   F+LDSLL++IR+ KA +  D EI+  +L   + +AFF+     K++E ++ +AK
Sbjct: 460 LNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ-----KDNEYINNIAK 514

Query: 532 ERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEA 591
           ERL S+L EL +   + S D    SW +L L +I+  EKS    L + LD+ L   K E+
Sbjct: 515 ERLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAES 566

Query: 592 ISSLTEIS--KSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF----AKDENSSM 645
           +  L +IS  KS +SQ  G+ +L+SM LIQLY+G+ +SI +IE+L  F    +  E ++ 
Sbjct: 567 LDILKKISELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANF 626

Query: 646 VGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702
            G+TEI                 ++W+QFI  +G +E+ +LL+ L  RENK+GF++L
Sbjct: 627 TGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVL 683

 Score =  246 bits (628), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 186/278 (66%), Gaps = 10/278 (3%)

Query: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXX 810
            +  IDKE TSAL KALNLPDNI+N+ GEV+++ LEG+                       
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKM 803

Query: 811  XXX--QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLA 868
                 QLSEIFKRRK+ALS++STGNQRK++VKESRENVIAFKHRI+DML IY+KH E+L+
Sbjct: 804  MELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLS 863

Query: 869  I--ANKGEL--SIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSA 924
            +  A+ G++  + +    L+ ++  +     C+++TLD+PL +KI KL KG+  KIR + 
Sbjct: 864  LNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923

Query: 925  FKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDIN----GNDK 980
            F+D++ + E+++ L+  H  + T+KPGQ +  ++  CS++SL+L +  +D          
Sbjct: 924  FEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKM 983

Query: 981  FDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018
            F+ L+D+YA+TTK W Q+GK+GA IF+DF NWL+SKK+
Sbjct: 984  FEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  448 bits (1153), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 282/735 (38%), Positives = 413/735 (56%), Gaps = 67/735 (9%)

Query: 4   KVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSAR 63
           +VNRDLF++LASD++EER+ AAV ++ +LS +    + +EW YVL RLIKGLAS R  AR
Sbjct: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64  LGFSLCLTEVINLAMNMPSGQRPKG-LESMNDFLDTLSFILDINVNETGKKPVK-GKDER 121
           LGFS+CL+EV+ L +        KG LES+  ++  L         +     VK GK+ER
Sbjct: 63  LGFSMCLSEVVTLGLE-------KGRLESVEVYIGQL-------FEKLADGHVKNGKEER 108

Query: 122 GIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYSL 181
           G+            NEPLF  IF+ D K  + +F + FM+ L+ LAL K W++EPCL++L
Sbjct: 109 GLVFGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTL 167

Query: 182 FQTIKMLLPTMNESTAAE-IXXXXXXXXXXXXNEGLSTYLLLKYESD-------KDLVPS 233
           +Q I+ L     E    E I            NEGL+ YLLL YE         K  + S
Sbjct: 168 YQLIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILS 227

Query: 234 TLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVW 293
            + L++  WKNNDPL++GN+ +L+ VL+D  + P      +DN  KQK + W PRLHFVW
Sbjct: 228 KITLRSC-WKNNDPLSKGNVTILSSVLKD--IIP-----VEDNVMKQKGS-WAPRLHFVW 278

Query: 294 NILLPLFGS-----GKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASS 348
           +IL+P+        G  E+               V + + F EFWQ+ VDESFFN KASS
Sbjct: 279 DILIPILCRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASS 338

Query: 349 ERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKAC 408
           ERKYLG LII+   + VP S +   FS+N+MRTLINQS +S R L+KI+   L +I+  C
Sbjct: 339 ERKYLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSIC 398

Query: 409 EEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXX 468
           E DP  K++P ++++ FGP+GSINFD LTK+     +IA++ L +               
Sbjct: 399 ESDP-TKVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEID 457

Query: 469 EKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDD-------- 520
           ++   +    ++LD LLHI++AHK +  D+   KP+LS IV ++FF     D        
Sbjct: 458 KESSPVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDA 516

Query: 521 -----KESEQLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGD 575
                 ES+++  L++ERL+SILG+L    +   + P   +W ++TL++++  E  H+  
Sbjct: 517 HADADAESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIVIAEE--HRRS 571

Query: 576 LTNPLDEGLEKTKNEAISSLTEISKSN-----TSQSWGLSTLLSMCLIQLYAGETDSISV 630
           L   LDE L++TK  A+ ++ +I K +      S+  GL  LL + ++Q+Y+G+ +S S+
Sbjct: 572 LIFKLDEELQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASI 631

Query: 631 IEELCEFAKDENS---SMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILL 687
           +EEL  F K  ++    +VGITEI                 I+W+  I  +   EL +L 
Sbjct: 632 LEELTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLF 691

Query: 688 DVLKTRENKQGFALL 702
           D+L  RENKQGFA L
Sbjct: 692 DILSVRENKQGFAAL 706

 Score =  219 bits (558), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 122/267 (45%), Positives = 169/267 (63%), Gaps = 13/267 (4%)

Query: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXX 813
            I+KE TSAL  AL LP+N++++ G+V      G                           
Sbjct: 768  INKETTSALADALKLPENMIDENGDV------GFEDFDDGDEEEEEEESMDDEAMMELDG 821

Query: 814  QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKG 873
            QLSEIFKRRKEALS + TGN+RK+EV+ESRE+VI+FKHR++DML IY K+  +LA    G
Sbjct: 822  QLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLA----G 877

Query: 874  ELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKD-LDKTI 932
            +        L N+   I P++KCI++T+DRPLA+K +KLLK  I K++   FK  +D+  
Sbjct: 878  KSQQCEASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVS 937

Query: 933  ELLDL-LKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGND-KFDDLIDLYAS 990
            E++ L L++ H  ML  KPGQ   ++F ACSTSSLFL K+ V    ++  ++ +ID+Y+ 
Sbjct: 938  EIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQ 997

Query: 991  TTKQWTQKGKFGANIFIDFINWLSSKK 1017
            + K WT KGKFG N FIDFINWL+SK+
Sbjct: 998  SIKNWTVKGKFGPNFFIDFINWLASKR 1024

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
           YEL055C
          Length = 1041

 Score =  405 bits (1040), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 275/728 (37%), Positives = 402/728 (55%), Gaps = 56/728 (7%)

Query: 5   VNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSE-------EWSYVLNRLIKGLAS 57
           VNRD+F++LASDL+EERL + V L+K+L  L+  +  E       EW+YV+NRLI GLAS
Sbjct: 4   VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58  DRNSARLGFSLCLTEVINLAMNMP-SGQRPKGLESMNDFLDTLSFILDINVNETG--KKP 114
           +R  ARLGFSLCLTEV+NLA++       P  L  ++ FL  +S  L I  ++ G  +K 
Sbjct: 64  NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 115 VKGKDERGIXXXXXXXXXXXXNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIK 174
           +KGKDERG+            N+P+F  IF +D    N   +  F+ +LI L+  KNWIK
Sbjct: 124 LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKD----NKAILFEFIYELIALSNLKNWIK 179

Query: 175 EPCLYSLFQTIKMLLPTMNESTAAEIXXXXXXXXXXXXNEGLSTYLLLKYESDKDLVPST 234
           EP L++LF  I+ ++  ++ S   ++            NEGLS Y+ L Y ++  + P  
Sbjct: 180 EPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIY-TNPHISPED 238

Query: 235 LGL---KNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHF 291
           + +    N  WKNNDP  + N+ LL+KVL +++ A  +        K   N NW PRLH+
Sbjct: 239 IQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSE-------KHTSNANWTPRLHY 291

Query: 292 VWNILLPLFGSGKLENAEHISXXXXXXXXXXVPSSIQFPEFWQMAVDESFFNEKASSERK 351
           VW+++LP+  + K  +++ +               I+F EFW+  +DESFFNEKAS ERK
Sbjct: 292 VWDVILPILLNPK--SSDKLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERK 349

Query: 352 YLGFLIIDATFKTV-PGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEE 410
           YLGFLII  TF  +   + I   F+ N++R++INQ  DS+R LNKI+  T+D I+  C+ 
Sbjct: 350 YLGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQS 409

Query: 411 DPVNKLVPCLSAMLFGPH--GSINFDKLTKTSITSKLIAIKELPATXXXXXXXXXXXXXX 468
           +   +L+P L+  LF      SINFDKLTKT   S+LI +++L +T              
Sbjct: 410 NSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDL-STDTLSKLFFLFTSKL 468

Query: 469 EKKDDLPHTHFVLDSLLHIIRAHKAE-INDVEIIKPVLSPIVYMAFFKHATDDKESEQLH 527
           +         F+LDS+LHIIR+HK++ I   + + PVL PI+ + FFK   D      + 
Sbjct: 469 DSFTTTTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETAD----VSIS 524

Query: 528 ELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKT 587
            + K+RL SIL +LT   E  S      S Q+LTL LI+++ +  K  L    D+ L + 
Sbjct: 525 NILKDRLISILNDLTTVGENSS------SIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEV 578

Query: 588 KNEAISSL---TEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF------- 637
           K+ AI++L    E SK ++     L +LLS+ +IQLY  + DSI+ I++LC+F       
Sbjct: 579 KDSAITTLKRAIEHSKRDSRLK-SLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSN 637

Query: 638 ---AKDENSSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIGDVGLKELQILLDVLKTRE 694
                D+N   +GI EI                  +W+ FI  + L E   + DVL TRE
Sbjct: 638 TIMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRE 697

Query: 695 NKQGFALL 702
           NK+GFA L
Sbjct: 698 NKEGFARL 705

 Score =  222 bits (565), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 173/275 (62%), Gaps = 11/275 (4%)

Query: 754  IDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISXXXXXXXXXXXXXXXXXXXXXXXXX 813
            IDKEATSAL KAL LPDNI+NDKGEVD+ +LE IS                         
Sbjct: 760  IDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQM 819

Query: 814  -----QLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLA 868
                 QLS+IF RRKEALS+I TGN+RK++VKESRENVIAFKHRIVDM+ +Y+KH E + 
Sbjct: 820  MELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEIIT 879

Query: 869  IANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDL 928
             +++          L+++   I  ++ CI++TLDR LA+KISKLLK K+FKI+   FKD 
Sbjct: 880  KSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFKDC 939

Query: 929  -DKTIE-LLDLLKSAHKE-MLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDL 984
             D T E +L+ + + H E +L  K GQ+  ++F  CS SSLF  +++ + + N D +D L
Sbjct: 940  GDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNADLYDSL 999

Query: 985  IDLYASTTKQWTQKG--KFGANIFIDFINWLSSKK 1017
            IDLY  TTK W +    K    IF DF NWLSSK+
Sbjct: 1000 IDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa]
           {ON} similar to uniprot|P43583 Saccharomyces cerevisiae
           YFL007W BLM3 Protein involved in assembly of proteasomal
           core particles in the nucleus required for normal
           resistance to bleomycin may be involved in protection
           against oxidative damage
          Length = 2140

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 17/116 (14%)

Query: 7   RDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGL----------- 55
           R L F +      E L     L+K +     PS++  W+ V+ + + G            
Sbjct: 489 RPLVFSMNGSRNHEFLDKLQGLVKSIETFAHPSNNGPWTKVIAKFVHGFIKMYHERVKME 548

Query: 56  ----ASDRNSARLGFSLCLTEVINLAMNMPS-GQRPKGLESMNDFLDTLSFILDIN 106
               A+ R   +L  S C T V+N+   +   G + K  E  N ++  L+++LDIN
Sbjct: 549 KNPKANHRCHLKLN-SACHTRVVNIFQEVIFLGAQNKNSEMANYYISCLAYLLDIN 603

>KAFR0B06580 Chr2 (1366815..1368014) [1200 bp, 399 aa] {ON}
           Anc_3.478 YPR140W
          Length = 399

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 503 PVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILG-ELTINKEMRSEDPQINSWQFLT 561
           P++ PI    F K A +DKE + L     + LY+ +G E+ I      +D  I+S++   
Sbjct: 212 PIVVPIFTTGFEKLAPEDKEDQSL----LKNLYNAIGTEINITVGKPIDDEVIDSYRSKW 267

Query: 562 LRLILDMEKSHKGDLTNPLDEGLE 585
           + LI+      + DLT+ L  G E
Sbjct: 268 MDLIIATHAEQETDLTDELKNGTE 291

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 27  ALIKDLSALELPSDSEEWSYVLNRLIKGLASDRNSARLGFSLCLTEVINLAMNMPSGQRP 86
           A +KD  + +  +DS   + + NRLI   A+D+    +G  +   +  N A N P+  RP
Sbjct: 342 AYLKDTKSQQY-ADSATSNLINNRLISCTATDK---LIGGKVVTMKNENTAYNEPTDGRP 397

Query: 87  KGLESMNDFL--DTLSFILDINVNETGK 112
             LE+ N  +  +TL F+   +  E GK
Sbjct: 398 SSLENRNRAVKENTLQFMSSNSFKECGK 425

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 890 IIPMIKCIKETLDRPLADKISKLLKGK-IFKIRTSAFKDLDKTIELLD 936
           ++P      E+ ++PLA K+SK LK K +  I TS   DL K I+LL+
Sbjct: 36  LLPGKSSYPESYNKPLAYKVSKFLKLKPVTSITTSEAYDLPKVIDLLN 83

>TBLA0A09550 Chr1 complement(2356084..2356914) [831 bp, 276 aa] {ON}
           Anc_5.637 YDR272W
          Length = 276

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 513 FFKHATDDKESEQLHELAKER-----LYSILGELTINKEMRSEDPQI 554
           F+K+  D+KE ++L E  K        +++L ELT N  +R +DP I
Sbjct: 201 FYKNVGDNKEFDELEEFVKTNEVTTGQFTLLNELTYNPYLRLDDPYI 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,833,217
Number of extensions: 3815737
Number of successful extensions: 11563
Number of sequences better than 10.0: 36
Number of HSP's gapped: 11542
Number of HSP's successfully gapped: 60
Length of query: 1023
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 903
Effective length of database: 39,721,479
Effective search space: 35868495537
Effective search space used: 35868495537
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)