Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.126.9ON40140120760.0
Skud_5.336.9ON40140018700.0
YEL056W (HAT2)6.9ON40140118340.0
Smik_5.316.9ON42740118150.0
NDAI0K029006.9ON43841112911e-177
NCAS0F001906.9ON41140512501e-171
ZYRO0F00462g6.9ON39340011921e-162
TDEL0G046206.9ON39239811901e-162
KNAG0E009806.9ON41440011811e-160
Kpol_1045.786.9ON39240111631e-158
Ecym_30126.9ON39739011361e-154
SAKL0E00814g6.9ON39839511121e-150
KLLA0D00814g6.9ON40840110951e-148
ACR017W6.9ON42340010851e-146
CAGL0B03575g6.9ON41939910761e-144
KAFR0L003206.9ON39140410721e-144
TPHA0M001906.9ON39140110701e-144
KLTH0C11550g6.9ON39838610541e-141
Kwal_56.223456.9ON39638910031e-134
TBLA0A071206.9ON4074149831e-131
TBLA0H036508.548ON4194163203e-32
KLTH0E12694g8.548ON4184113168e-32
Ecym_70428.548ON4144073142e-31
CAGL0M05291g8.548ON4194233142e-31
TPHA0L017208.548ON4194203132e-31
SAKL0H09900g8.548ON4254133081e-30
YBR195C (MSI1)8.548ON4224223072e-30
NDAI0C055108.548ON4194193028e-30
Kpol_1024.398.548ON4174173011e-29
Suva_4.4498.548ON4244223002e-29
Smik_2.3358.548ON4224222983e-29
KLLA0E23541g8.548ON4174122965e-29
AEL250C8.548ON4174122957e-29
ZYRO0A13068g8.548ON3974062912e-28
NCAS0B021708.548ON4144162904e-28
KAFR0I008408.548ON4134172904e-28
Kwal_27.120708.548ON4184232861e-27
KNAG0A036708.548ON4264192861e-27
Skud_2.3218.548ON4224152862e-27
TDEL0B029808.548ON4124132808e-27
KAFR0A003802.401ON5164081604e-11
Suva_13.3112.401ON5103991552e-10
CAGL0K03861g2.401ON5134111542e-10
TDEL0G033402.401ON5144131543e-10
KLLA0E08449g2.283ON4222081444e-09
AAR078W7.356ON5621621445e-09
YMR131C (RRB1)2.401ON5113991436e-09
YLR196W (PWP1)7.356ON5761511401e-08
Skud_13.2912.401ON5094091392e-08
KLLA0E19515g7.356ON5721551392e-08
Sklu_YGOB_Anc_2.4012.401ON5204201373e-08
KAFR0L015207.356ON5841571348e-08
Kwal_56.246617.356ON5611551348e-08
Smik_13.3292.401ON5094041339e-08
SAKL0F11506g7.356ON5681561331e-07
KLLA0F17237g2.401ON5234311321e-07
TPHA0G026502.401ON5164081312e-07
Skud_12.2617.356ON5801511312e-07
TDEL0C019207.356ON5631511293e-07
Kpol_1060.246.276ON4861991283e-07
Suva_10.2927.356ON5801351283e-07
Kpol_1041.202.401ON5152421284e-07
NCAS0G011206.276ON4941811275e-07
NCAS0F019702.401ON5114141275e-07
TBLA0B092502.401ON5264111275e-07
Smik_12.2567.356ON5761511276e-07
KNAG0E021802.401ON5174061258e-07
ZYRO0E08184g6.276ON5063451258e-07
Kwal_47.178272.401ON5234071259e-07
ZYRO0A08690g2.401ON5164091251e-06
NDAI0H027502.401ON5124031241e-06
CAGL0A04037g7.356ON5831501232e-06
KNAG0I028406.340ON5192591222e-06
KLTH0H01122g7.356ON5791591212e-06
ZYRO0B02486g7.356ON5751481213e-06
NDAI0E044407.356ON5811511213e-06
KLTH0E09394g2.401ON5224061203e-06
YCR072C (RSA4)6.340ON5152851195e-06
Ecym_47177.356ON6031511195e-06
Kpol_530.257.356ON5741511186e-06
KNAG0B025807.356ON5801511186e-06
Skud_3.1456.340ON5152821186e-06
KLTH0C07634g3.259ON4252671177e-06
Suva_3.1096.340ON5152851177e-06
AEL269C7.534ON4551561169e-06
Smik_3.1726.340ON5152821161e-05
Kwal_33.151365.201ON4731231161e-05
Ecym_60672.401ON5222371161e-05
TPHA0F030307.356ON5821511161e-05
YPL247C6.276ON5231711152e-05
KLLA0F15598g5.201ON4781571142e-05
NCAS0E028407.356ON6071481142e-05
TBLA0C050107.356ON5721501142e-05
CAGL0D05588g5.201ON4771231142e-05
Skud_4.637.310ON12732031142e-05
Suva_16.606.276ON5262131132e-05
NDAI0F012406.276ON5241741133e-05
TPHA0E030805.201ON4881231123e-05
KLTH0B03410g5.201ON4771231123e-05
KLTH0G10296g2.283ON4262141114e-05
KAFR0J009805.201ON4801281114e-05
AAL157C5.201ON4791311114e-05
Smik_6.4516.276ON5231711115e-05
Kpol_2002.995.201ON4871301105e-05
Suva_4.537.310ON12712141115e-05
SAKL0A02970g6.276ON4152501096e-05
KNAG0B064504.309ON6341321106e-05
TBLA0A038908.316ON3622121089e-05
NCAS0B036908.288ON11451221099e-05
KLTH0A06754g6.340ON5142651089e-05
Kwal_27.115502.283ON4071811071e-04
Kwal_56.236858.288ON11021461091e-04
KAFR0H033402.283ON3671971071e-04
Skud_16.326.276ON5222181071e-04
NCAS0D027305.201ON4751181071e-04
TBLA0F041306.340ON5142601072e-04
SAKL0H16390g8.288ON11401461072e-04
Kpol_1028.416.340ON5122591062e-04
Suva_10.645.201ON4901631062e-04
KNAG0I010508.288ON11591231062e-04
CAGL0J03476g6.340ON5172821043e-04
YLL011W (SOF1)5.201ON4891301043e-04
Kwal_55.220673.25ON4511491043e-04
NDAI0I003506.340ON5152541043e-04
NDAI0J011808.288ON11341201053e-04
TBLA0B059202.283ON4031531033e-04
KNAG0I009208.316ON3812231033e-04
TDEL0D010904.309ON6421761044e-04
TDEL0A075506.340ON5152821034e-04
Smik_12.525.201ON4891281034e-04
Smik_6.3488.672ON4511391034e-04
KAFR0F010606.276ON5531841034e-04
SAKL0H06666g8.672ON4411491025e-04
KNAG0A032208.631ON4231581025e-04
TPHA0M018306.340ON5152611025e-04
KLLA0F05159g7.310ON12311891035e-04
Smik_4.457.310ON12702031035e-04
Kpol_1003.342.283ON3881811016e-04
TBLA0H020005.201ON4731211026e-04
Ecym_33212.283ON4091811016e-04
KLTH0F19294g3.25ON4511491017e-04
Ecym_24986.340ON5422691017e-04
TBLA0D040208.288ON11781231027e-04
NCAS0D046106.340ON5152571008e-04
Skud_12.565.201ON4891281009e-04
Suva_14.3112.283ON3892031009e-04
YKR036C (CAF4)1.247ON6432171000.001
Skud_14.2982.283ON3892031000.001
YPL151C (PRP46)8.672ON4511411000.001
KLLA0C08547g6.340ON5152681000.001
CAGL0H00781g6.276ON5131821000.001
NDAI0G006302.283ON397200990.001
NDAI0I021805.201ON479128990.001
TPHA0P014903.25ON459193990.001
ZYRO0D08206g6.340ON515263990.001
TDEL0A068906.276ON447356980.001
SAKL0G12892g5.201ON476128980.001
KAFR0F043506.340ON515222990.001
KAFR0B055808.288ON1120122990.002
SAKL0A01276g6.340ON515268980.002
SAKL0E07766g2.283ON398141980.002
KLTH0G13068g8.288ON1101119980.002
Skud_16.1318.672ON451139970.002
AGR067W8.288ON1125160980.002
TDEL0E042805.201ON481129970.002
KLLA0E07085g3.25ON452214970.002
Skud_11.2711.247ON646280970.003
Kwal_56.24399na 1ON369148960.003
TDEL0C023607.310ON1264202960.003
Ecym_71055.201ON484131950.003
KLLA0F19734g8.288ON1133133960.004
ZYRO0B10450g5.201ON482229950.004
AER114W4.309ON633135950.004
AFR199C2.431ON334161940.004
KNAG0M017505.201ON485131950.004
TBLA0C018408.672ON423154940.005
Ecym_28087.534ON465294940.005
SAKL0H15708g8.316ON368232930.005
KLLA0D12760g6.276ON493138940.005
KAFR0A033801.247ON666153940.006
TPHA0B005904.309ON588130940.006
NDAI0G001501.534ON722133940.006
KLTH0B00924g1.534ON714129930.007
KLTH0B01628g5.139ON790165930.007
NCAS0G043001.534ON725135930.007
Kwal_56.230353.259ON424181920.007
KNAG0A048008.377ON177126890.007
TDEL0E049005.139ON785171920.009
ADL184W3.25ON449177920.009
TBLA0E007607.534ON384122910.009
Kwal_23.64296.363ON750207920.009
Suva_16.1598.672ON451139910.010
CAGL0L02761g8.631ON419156910.010
YNL035C2.283ON389214910.010
Suva_11.2681.247ON645235920.011
YDL195W (SEC31)7.310ON1273203920.011
KLTH0F16192g5.429ON462207910.011
Ecym_42808.288ON1132126910.012
YNL317W (PFS2)3.25ON465148910.013
SAKL0D04796g1.247ON769159910.013
KNAG0D007406.276ON504165900.014
Skud_4.2833.259ON504128900.014
Suva_14.223.25ON469148900.014
KAFR0E012303.259ON369133900.014
TDEL0G021402.283ON392138890.016
Kwal_23.63246.340ON514262900.016
TDEL0A004403.25ON451187900.016
Kpol_1019.307.310ON1252204900.017
AEL314W1.247ON715172900.017
CAGL0F06853g2.663ON388126890.018
SAKL0G16962g4.309ON617172890.020
NCAS0C032608.324ON983143900.020
TPHA0D035906.276ON598334890.021
Smik_12.5254.309ON652172890.021
TPHA0C008108.324ON937120890.021
CAGL0G01628g2.283ON37689880.022
Kwal_26.75702.431ON218166870.022
KLLA0A08822g4.122ON582141890.024
Skud_14.223.25ON467148880.024
Smik_10.1261.247ON712217890.024
KLTH0H02508gna 1ON309151870.025
SAKL0E03960g2.431ON320163870.026
KAFR0I005004.309ON52794880.027
TBLA0D055601.247ON589188880.027
Smik_14.143.25ON466147880.028
TPHA0G017408.651ON448204880.028
KLTH0D15840g4.309ON697146880.029
ZYRO0G11660g5.139ON783170880.033
Kpol_1001.234.309ON610128870.034
Ecym_55285.429ON471198870.035
KLLA0E21187g5.429ON429154870.036
TBLA0F021407.310ON1300204870.037
CAGL0M04279g8.324ON940134870.037
TPHA0C033702.283ON413185870.037
KLLA0D02530g4.309ON70780870.037
KLTH0A07282g6.363ON725207870.038
Smik_14.2962.283ON389129860.044
YLR429W (CRN1)4.309ON651134860.044
TPHA0G023802.431ON318141850.045
KLTH0G12430g8.316ON367247850.047
Kpol_1036.698.324ON936120860.048
KAFR0E039005.429ON439202860.048
AER263C6.340ON513284860.049
KAFR0I028403.25ON456174860.051
TBLA0A015406.135ON724129860.051
KLTH0D04466g2.431ON319166850.052
KAFR0A056104.309ON620134860.052
ZYRO0C03124g3.25ON445149850.053
Ecym_42558.324ON937120860.053
TPHA0A031007.310ON1265289860.054
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.12
         (401 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   804   0.0  
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   724   0.0  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   711   0.0  
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   703   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     501   e-177
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   486   e-171
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   463   e-162
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   462   e-162
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   459   e-160
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   452   e-158
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   442   e-154
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   432   e-150
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   426   e-148
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   422   e-146
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   419   e-144
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   417   e-144
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   416   e-144
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   410   e-141
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   390   e-134
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   383   e-131
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   127   3e-32
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   126   8e-32
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   125   2e-31
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   125   2e-31
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   125   2e-31
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   123   1e-30
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   122   2e-30
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   120   8e-30
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   120   1e-29
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   120   2e-29
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   119   3e-29
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   118   5e-29
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   118   7e-29
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   116   2e-28
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   116   4e-28
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   116   4e-28
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   114   1e-27
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   114   1e-27
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   114   2e-27
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   112   8e-27
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    66   4e-11
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    64   2e-10
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    64   2e-10
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    64   3e-10
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    60   4e-09
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    60   5e-09
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    60   6e-09
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    59   1e-08
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    58   2e-08
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    58   2e-08
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    57   3e-08
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    56   8e-08
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    56   8e-08
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    56   9e-08
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    56   1e-07
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    55   1e-07
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    55   2e-07
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    55   2e-07
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    54   3e-07
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    54   3e-07
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    54   3e-07
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    54   4e-07
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    54   5e-07
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    54   5e-07
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    54   5e-07
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    54   6e-07
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    53   8e-07
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    53   8e-07
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    53   9e-07
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    53   1e-06
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    52   1e-06
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    52   2e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    52   2e-06
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    51   2e-06
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    51   3e-06
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    51   3e-06
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    51   3e-06
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    50   5e-06
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    50   5e-06
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    50   6e-06
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    50   6e-06
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    50   6e-06
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    50   7e-06
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    50   7e-06
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    49   9e-06
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    49   1e-05
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    49   1e-05
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    49   1e-05
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    49   1e-05
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    49   2e-05
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    49   2e-05
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    49   2e-05
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    49   2e-05
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    49   2e-05
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    49   2e-05
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    48   2e-05
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    48   3e-05
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    48   3e-05
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    48   3e-05
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    47   4e-05
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    47   4e-05
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    47   4e-05
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    47   5e-05
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    47   5e-05
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    47   5e-05
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    47   6e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    47   6e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    46   9e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    47   9e-05
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    46   9e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    46   1e-04
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    47   1e-04
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    46   1e-04
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    46   1e-04
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     46   1e-04
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    46   2e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    46   2e-04
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    45   2e-04
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    45   2e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    45   2e-04
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    45   3e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   3e-04
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    45   3e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       45   3e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    45   3e-04
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    44   3e-04
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    44   3e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    45   4e-04
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    44   4e-04
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    44   4e-04
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    44   4e-04
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    44   4e-04
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    44   5e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    44   5e-04
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    44   5e-04
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    44   5e-04
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    44   5e-04
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    44   6e-04
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    44   6e-04
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    44   6e-04
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    44   7e-04
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    44   7e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    44   7e-04
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     43   8e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    43   9e-04
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    43   9e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    43   0.001
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    43   0.001
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    43   0.001
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    43   0.001
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    43   0.001
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    43   0.001
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    43   0.001
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    43   0.001
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    43   0.001
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    42   0.001
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    42   0.001
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    43   0.001
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    43   0.002
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    42   0.002
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    42   0.002
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    42   0.002
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    42   0.002
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    42   0.002
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    42   0.002
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    42   0.002
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    42   0.003
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    42   0.003
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    42   0.003
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    41   0.003
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    42   0.004
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    41   0.004
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    41   0.004
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    41   0.004
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    41   0.004
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    41   0.005
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    41   0.005
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    40   0.005
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    41   0.005
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    41   0.006
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    41   0.006
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    41   0.006
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    40   0.007
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    40   0.007
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    40   0.007
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    40   0.007
KNAG0A04800 Chr1 complement(688282..688815) [534 bp, 177 aa] {ON...    39   0.007
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    40   0.009
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    40   0.009
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               40   0.009
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    40   0.009
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    40   0.010
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    40   0.010
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    40   0.010
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    40   0.011
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    40   0.011
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    40   0.011
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    40   0.012
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    40   0.013
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    40   0.013
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    39   0.014
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    39   0.014
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    39   0.014
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    39   0.014
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    39   0.016
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    39   0.016
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    39   0.016
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    39   0.017
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    39   0.017
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    39   0.018
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    39   0.020
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    39   0.020
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    39   0.021
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    39   0.021
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.021
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    39   0.022
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    38   0.022
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    39   0.024
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    39   0.024
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    39   0.024
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.025
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    38   0.026
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    39   0.027
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    39   0.027
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    39   0.028
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    39   0.028
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    39   0.029
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    39   0.033
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    38   0.034
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    38   0.035
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    38   0.036
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    38   0.037
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    38   0.037
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    38   0.037
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    38   0.037
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    38   0.038
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    38   0.044
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    38   0.044
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    37   0.045
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    37   0.047
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    38   0.048
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    38   0.048
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    38   0.049
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    38   0.051
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    38   0.051
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    37   0.052
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    38   0.052
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    37   0.053
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    38   0.053
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    38   0.054
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    37   0.055
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    38   0.055
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    37   0.059
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    37   0.061
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    37   0.062
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    38   0.062
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    38   0.062
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    37   0.064
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    37   0.067
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    37   0.072
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    37   0.073
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    37   0.075
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      37   0.075
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    37   0.076
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    37   0.077
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    37   0.078
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    37   0.079
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    37   0.080
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    37   0.080
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    37   0.080
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      37   0.082
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    37   0.084
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    37   0.084
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    37   0.085
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    37   0.089
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    37   0.090
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    37   0.092
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    37   0.095
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    37   0.095
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    37   0.096
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    37   0.097
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    37   0.097
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    37   0.097
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    37   0.10 
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    37   0.11 
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    37   0.11 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    37   0.12 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    37   0.12 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    36   0.13 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    36   0.14 
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    37   0.14 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    36   0.14 
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    36   0.14 
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    36   0.15 
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    36   0.15 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    36   0.15 
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    36   0.16 
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    36   0.17 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    36   0.17 
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    36   0.17 
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    36   0.17 
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    36   0.18 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    36   0.18 
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    36   0.18 
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    36   0.18 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    36   0.18 
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    36   0.19 
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    36   0.19 
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    35   0.20 
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    36   0.20 
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    35   0.21 
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    36   0.21 
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    35   0.21 
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    35   0.22 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    36   0.22 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    36   0.23 
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    36   0.23 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    35   0.23 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   0.24 
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    35   0.25 
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    36   0.25 
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    35   0.25 
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    35   0.25 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    35   0.26 
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    35   0.26 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    35   0.26 
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     35   0.26 
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    35   0.26 
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    35   0.26 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    35   0.27 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    35   0.27 
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    35   0.27 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    35   0.28 
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    35   0.28 
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    35   0.28 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    35   0.29 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    35   0.30 
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    35   0.30 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    35   0.31 
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    35   0.31 
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    35   0.31 
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    35   0.31 
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    35   0.32 
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    35   0.32 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    35   0.33 
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    35   0.33 
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    35   0.34 
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    35   0.34 
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    35   0.34 
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    35   0.34 
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    35   0.35 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   0.35 
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    35   0.37 
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    35   0.37 
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    35   0.37 
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    35   0.38 
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    35   0.38 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    35   0.38 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.38 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    35   0.39 
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    35   0.39 
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    35   0.40 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    35   0.40 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   0.42 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    35   0.42 
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    35   0.43 
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    35   0.43 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     34   0.45 
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    35   0.46 
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    35   0.46 
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       35   0.46 
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    34   0.46 
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    34   0.47 
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    34   0.47 
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    34   0.49 
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    34   0.49 
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    34   0.50 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    35   0.52 
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    34   0.52 
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    34   0.54 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    34   0.54 
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    34   0.54 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    34   0.57 
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    34   0.59 
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    34   0.60 
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    34   0.61 
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    34   0.62 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   0.63 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    34   0.64 
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    34   0.67 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    34   0.67 
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    34   0.68 
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    34   0.72 
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    34   0.75 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    34   0.75 
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    34   0.76 
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    34   0.77 
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    33   0.78 
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    34   0.80 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    34   0.80 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    34   0.82 
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    34   0.85 
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    34   0.86 
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    34   0.86 
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    33   0.87 
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    34   0.87 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    33   0.88 
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    34   0.89 
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    33   0.90 
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    33   0.93 
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    34   0.95 
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    33   0.95 
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    33   0.98 
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    34   0.99 
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    34   1.0  
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    33   1.0  
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    33   1.0  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    33   1.0  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    33   1.0  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   1.1  
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    33   1.1  
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    33   1.1  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    33   1.1  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    33   1.1  
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     33   1.2  
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    33   1.2  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    33   1.2  
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    33   1.2  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    33   1.3  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    33   1.3  
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    33   1.3  
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    33   1.3  
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    33   1.3  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    33   1.3  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    33   1.4  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   1.4  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    33   1.4  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    33   1.4  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    33   1.5  
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    33   1.5  
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    33   1.5  
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    33   1.5  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    33   1.5  
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    33   1.5  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   1.5  
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    33   1.5  
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    33   1.6  
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     33   1.6  
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    33   1.7  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    33   1.7  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    33   1.7  
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    33   1.7  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    33   1.7  
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    33   1.7  
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    33   1.7  
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    33   1.8  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   1.8  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    33   1.8  
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    33   1.8  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   1.9  
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    32   1.9  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    33   1.9  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    33   1.9  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    33   2.0  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    33   2.0  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    32   2.0  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   2.0  
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    33   2.0  
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    33   2.0  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    33   2.1  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    32   2.1  
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    32   2.1  
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    32   2.2  
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    32   2.2  
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    32   2.2  
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    32   2.2  
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    33   2.2  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    32   2.2  
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    32   2.2  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    32   2.3  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    33   2.3  
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    32   2.3  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    32   2.3  
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    32   2.4  
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    32   2.4  
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    32   2.4  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    32   2.4  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    32   2.4  
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    32   2.4  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    32   2.4  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    32   2.4  
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    32   2.5  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    32   2.5  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    32   2.5  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   2.5  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    32   2.6  
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    32   2.6  
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    32   2.6  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    32   2.6  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    32   2.6  
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    32   2.6  
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    32   2.7  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    32   2.7  
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    32   2.7  
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    32   2.7  
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    32   2.7  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    32   2.8  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   2.8  
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    32   2.8  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    32   2.9  
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    32   2.9  
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    32   3.0  
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             32   3.0  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    32   3.0  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    32   3.0  
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    32   3.1  
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    32   3.2  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    32   3.2  
KLLA0C08723g Chr3 (762625..765501) [2877 bp, 958 aa] {ON} simila...    32   3.2  
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    32   3.3  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    32   3.4  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    32   3.4  
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    32   3.4  
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    32   3.4  
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    32   3.5  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    32   3.5  
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       32   3.5  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    32   3.7  
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    32   3.7  
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    32   3.8  
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    32   3.8  
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    32   3.9  
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    32   3.9  
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    32   4.0  
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    32   4.1  
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    32   4.3  
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    32   4.4  
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    31   4.6  
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    31   4.7  
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    32   4.7  
TBLA0A08350 Chr1 complement(2052734..2054773) [2040 bp, 679 aa] ...    32   4.8  
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    31   4.9  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    31   4.9  
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    31   4.9  
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    31   4.9  
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    31   5.1  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    31   5.2  
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    31   5.3  
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    31   5.3  
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    31   5.4  
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    31   5.4  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    31   5.4  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    31   5.4  
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    31   5.5  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    31   5.5  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    31   5.5  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     31   5.6  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    31   5.6  
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    31   5.7  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    31   5.8  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    31   5.8  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   5.9  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    31   6.0  
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    31   6.1  
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    31   6.1  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    31   6.2  
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    31   6.2  
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    31   6.3  
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    31   6.3  
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    31   6.3  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    31   6.6  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    31   6.6  
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    31   6.6  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    31   6.7  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    31   6.7  
YLR142W Chr12 (425186..426616) [1431 bp, 476 aa] {ON}  PUT1Proli...    31   6.9  
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    31   6.9  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    31   7.0  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    31   7.2  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    31   7.2  
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    31   7.4  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    31   7.6  
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    31   7.9  
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    31   7.9  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    31   8.0  
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    30   8.2  
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    30   8.4  
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    30   8.5  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    30   8.5  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    31   8.6  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    30   8.6  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    31   8.6  
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    30   8.6  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    30   8.7  
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    30   8.8  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    31   8.9  
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    30   9.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    30   9.1  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    30   9.2  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    30   9.3  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    30   9.4  
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    30   9.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    30   9.5  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    30   9.6  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    30   9.9  

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/401 (97%), Positives = 390/401 (97%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           LEFSPH           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401
           NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/400 (85%), Positives = 370/400 (92%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ+P+GGFIKQELI
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           IGTHTSGEEENYLKFAEINLPKE+LNNE+PQE+A   DE S P PRSNI+ITAKY+HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           ITRARYMPQ+P  VATINGQGTVF+YSRS+GLQSTLKFH++NGYALSFSPL++G LLSGS
Sbjct: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DDH+VALWDV+G SDST PIRTW DLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND+R 
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           ENTT  TAKCP+PFNTLAFSHHSSN+LAAAG DSHVYLYDLRNMKEPLHHMSGHEDAVTN
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           LEFSPH           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH+SAVNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           NAQ+PWL+ASTEEENILQVWKCSHSLP+VGG PK++ D++
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/401 (84%), Positives = 365/401 (91%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQE +GGFIKQELI
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           IGTHTSGEEENYLKFAEINLPKEIL+NEDPQEEAGE+ + S PAPRSNI+ITAKY+HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           ITRARYMPQ+P  VATINGQGTVF+YSRSEGLQSTLKFH++NGYALSFS LV+G LLSGS
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DDHTVALW+V    D T+P+RTW+DLHSDI+ND+KWHNFNKDLFGTVSEDSLLKIND+R 
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            NTT  T KCP+PFNTLAFSHHSSNLLAAAG DS+VYLYDLRNMKEPLHHMSGHEDAV N
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           LEFS H           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGH+S+VNDFDL
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401
           N QIPWLVAS EEENILQVWKCSHSLP+VGGPPKV+ D+IS
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/401 (82%), Positives = 361/401 (90%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           METQEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+QE EGGFI+QELI
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           IGTHTSGEEENYLKFAEIN+PKEILNN+DPQEEA EDD+ +  AP+SNI+ITAKY HEEE
Sbjct: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           ITRARYMPQNP  VAT+NGQGTVF+YSRS GLQSTLKFH++NGYALSF+ LVEG LLSGS
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DDHTVALW+V  NS S  P+RTW+DLHSDIVND KWHNFN+ LFGTVSEDSLLKIND+R 
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            N T    KCP+PFNTLAFSHHSSNLLAAAG DSHVYLYDLRNM+EPLHHMSGHEDAVTN
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           +EFS H           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH+S+VNDFDL
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401
           NAQIPWLVAS+EEENILQVWKCSH+LP+VGGPPKV+ D+IS
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDIIS 427

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  501 bits (1291), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 247/411 (60%), Positives = 308/411 (74%), Gaps = 20/411 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQEPEGGFIKQE 58
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +QE
Sbjct: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEIL----NNEDPQEEAGEDDEVSAPAPRSNIKITAK 114
           LI+GTHTSGEE+NYLK A I+LP E++    N+   Q E  ED++     PRSNIKI  K
Sbjct: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKK 146

Query: 115 YKHEEEITRARYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSP 170
           +KHEEEITRAR+MPQN   +ATING GTVFIY++S      L STL+FH+ENGY LSF+P
Sbjct: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206

Query: 171 LVEGLLLSGSDDHTVALWDVNGNSD-STRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
             +G LLSGSDD T+ALWD+  NS  + +P++ W  +H+DIVND KW+ FN ++F +VSE
Sbjct: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266

Query: 230 DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLH 289
           DS L+++D R +NT   + K  +PFNTLAFS HS  L+AAAGTDS VYLYD RN+  PL+
Sbjct: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326

Query: 290 HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349
            M+GHED++TNLEFSPH            R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386

Query: 350 GHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           GH+SAVNDF +N  IPWL+AS EEENI+QVWKCSH LP+VGG P+VS+ ++
Sbjct: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  486 bits (1250), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 243/405 (60%), Positives = 296/405 (73%), Gaps = 16/405 (3%)

Query: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP--TPVQEPEGGFIKQEL 59
           E   K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP     Q P     +QEL
Sbjct: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPN----RQEL 71

Query: 60  IIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE 119
           IIGTHTSGEE+NYLK A I+LP +I+    P  E  ED +      +SNIKI  K+KHEE
Sbjct: 72  IIGTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGETTTKSNIKIIKKFKHEE 127

Query: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGL 175
           EITRARYMPQN   VATING G VF+Y RS+    GL ST ++H+ENGY LSF+    G 
Sbjct: 128 EITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGK 187

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           LLSGSDD T+ALW+VN NS+S+ PI  WS +HSDIVND KW NF+ ++FG+VSEDS L++
Sbjct: 188 LLSGSDDGTIALWNVN-NSNSS-PIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQL 245

Query: 236 NDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
           +D R ++T T   K   PFNTLAFS HS  L AAAGTDSHVYL+D R++  PLH M+GH+
Sbjct: 246 HDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305

Query: 296 DAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAV 355
            AVTN+EFSP             R I+WD+  IG EQ PDDAEDG PE++M+HAGH+SA+
Sbjct: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAI 365

Query: 356 NDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           NDF +N  IPWL+AS+EEENI+QVWKCSH LP VGG P VS+  +
Sbjct: 366 NDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVSVSQL 410

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  463 bits (1192), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 226/400 (56%), Positives = 289/400 (72%), Gaps = 19/400 (4%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP           +QE+I+GTH
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN-----RQEMILGTH 62

Query: 65  TSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124
           TS EE+NYLK A I LP E++ + +P+EE    +EV     +SN+KI  K++HE E+TRA
Sbjct: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEE----EEVL----KSNVKIIKKFEHENEVTRA 114

Query: 125 RYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           RYMPQ+   +ATI+G GT+++Y+R+     GL ST +FH ENGY LSF+P  +G LLSGS
Sbjct: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DD  + LWDV G S    PI T++D HSDIVND KWHNF++++FG+VSEDS L+++D R+
Sbjct: 175 DDSNIVLWDVTGKSQ--EPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
            +      +  +P+NTLAFS HS+NL AAAGTDS VYLYD R   +PLH M GHEDAVT+
Sbjct: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           LEF P             R I+WDL +IGAEQ PDDA+DG PE++M+HAGH+S++NDF +
Sbjct: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           N  IPWL A+ EEENI+QVWK S  LP +GG P V   ++
Sbjct: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/398 (57%), Positives = 281/398 (70%), Gaps = 19/398 (4%)

Query: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61
           E  +KPLS+DEEY+LW+SNVPLMYDFVSET LTWP+LT++WLP           +QELI+
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSN-----RQELIL 58

Query: 62  GTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121
           GTHTS EE NYLK A I+LP EI+  ++ +E  G          +SNIKI  K+KHE+E+
Sbjct: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG--------FTKSNIKIIKKFKHEQEV 110

Query: 122 TRARYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLL 177
           TRARYMPQ+   +ATING GTVF+Y RS    EGL S+L FHE+NGY LSF+P+ +G LL
Sbjct: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170

Query: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
           SGSDD  +ALWD+  NS  T+P+ TW   H D VND KWH  N + FG+VSED  L+++D
Sbjct: 171 SGSDDSKIALWDITTNS--TKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228

Query: 238 LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
            RV+++ T   K    FNT+AFS HS+NL AAAGTDS +YLYD R     LH MSGHE  
Sbjct: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357
           VTNLEF               R+IMWDL +IGAEQ PDDA+DG PE++M+HAGH+S VND
Sbjct: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348

Query: 358 FDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKV 395
           F +N  IPWL+AS EEENI+QVWKCS  LP VGG PKV
Sbjct: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKV 386

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  459 bits (1181), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 287/400 (71%), Gaps = 16/400 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGT 63
           + +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP     P     +QELI+GT
Sbjct: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNP---VTRQELILGT 83

Query: 64  HTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITR 123
           HTS EE+NYLK A ++LP E+ +  +  E   ++++V     RSNI++T K+KH+ E+TR
Sbjct: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTE--SDEEQV-----RSNIRVTRKFKHDSEVTR 136

Query: 124 ARYMPQNPGTVATINGQGTVFIYSRS---EGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           ARYMPQ+P  +ATI+G GTV+IY RS   +    TL++H +NGY L+F+PL++G LLSGS
Sbjct: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DD  VALWDV   SD   P++ W ++HSDIVND +WHNF K LFGTVSEDS L+I+D R 
Sbjct: 197 DDSNVALWDVT--SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR- 253

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           E+    T    +PFNTL+FSHHS NLLA  G +S VYLYD R ++EPLH MSGH DAVT+
Sbjct: 254 ESKPVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           L+FS              R+I+WD+  IGAEQ  +DAED   E++M+HAGH+S +NDF +
Sbjct: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373

Query: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           N  IPWLVAS EEENI+Q+WKCSH LP + G P V +DM+
Sbjct: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  452 bits (1163), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 291/401 (72%), Gaps = 20/401 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGT 63
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   ++      +Q +I+GT
Sbjct: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61

Query: 64  HTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITR 123
           HTSGEE +YLK A ++LP E++  E     A +D+  +    +SNIKI  K++H+ EI R
Sbjct: 62  HTSGEEVDYLKVAALDLPDEVVTGE-----ANDDNRRT----KSNIKIVKKFEHDGEINR 112

Query: 124 ARYMPQNPGTVATINGQGTVFIY----SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSG 179
           ARYMP++   +ATING+G V IY    SRS+GL++TLK+H+ENGY LSF+P V   L+SG
Sbjct: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172

Query: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239
           SDD T+ALWD++  S S  P   W ++HSDIVND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 173 SDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230

Query: 240 VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVT 299
             +    T +    FNTLAFS HS+NL AAAG D+++YLYD R   +PLH M+GHEDA+T
Sbjct: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290

Query: 300 NLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFD 359
            L+F P             R+I+WDL +IGAEQ PD+A+DG PE++M+HAGH+SA+NDF 
Sbjct: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350

Query: 360 LNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           L+  IPWL AS EE+N++QVWKCS +L  VGG P++   M+
Sbjct: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  442 bits (1136), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 283/390 (72%), Gaps = 18/390 (4%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           +E  E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+   +      +QE+I
Sbjct: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSV--DANVPLKQQEMI 64

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           +GTHTSG+E NYLK A I+LP E++   D       +D  S P  +S IK+T K++HE+E
Sbjct: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPD-------EDNSSEPV-KSMIKVTKKFEHEDE 116

Query: 121 ITRARYMPQNPGTVATINGQGTVFIY----SRSEGLQSTLKFHEENGYALSFSPLVEGLL 176
           + RARYMP+N   +ATING+G +FIY    S+SEGL  TL +H++NGY L+F+P +EG L
Sbjct: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176

Query: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           LS SDD TVALWD+N    + RP+    + H+DIVNDSKWH F++++FGTVSED  L+++
Sbjct: 177 LSASDDTTVALWDINS---TDRPVSIVMN-HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232

Query: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296
           D R  + +       +P N LAFS HS NL+AAAGTD+ VYLYDLR + EPLH M+GH+D
Sbjct: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356
           AVT++EFS H            RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGH+SA+N
Sbjct: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352

Query: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSL 386
           DF  N Q+PWL+AS EE+N++QVWK S  L
Sbjct: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  432 bits (1112), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 275/395 (69%), Gaps = 15/395 (3%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           +E + K LS++EEY+LWK+NVPLMYDFVSET+LTWPSLT+QWLP           KQE+I
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEMI 57

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           +GTHTSGE++NYLK A I LP++IL  E  +     ++       +S IKIT K KHEEE
Sbjct: 58  LGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEE 117

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLL 176
           ITRAR+MPQ+P  +ATING G VF++ RS    E L S   FH++NGY LSF+P  +G L
Sbjct: 118 ITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGEL 177

Query: 177 LSGSDDHTVALWDVNG-NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           LS SDD T+ALW+V G N+  ++ + T    H DIVND  WH FN++LFG+VSED  L+I
Sbjct: 178 LSCSDDGTIALWNVMGTNTSPSKAVTT----HEDIVNDCTWHEFNENLFGSVSEDKTLQI 233

Query: 236 NDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
           +D R  N+T        PFNTL FS HS NL AAAGTDS VYLYDLRN  + LH MSGHE
Sbjct: 234 HDKRT-NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE 292

Query: 296 DAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAV 355
           D+VT+LEFSPH            R+++WDL QIG+EQ  +DA DGVPEL+M+HAGHKSAV
Sbjct: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAV 352

Query: 356 NDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVG 390
           NDF  N  IPWL+AS EE+NI+ VWK S  L   G
Sbjct: 353 NDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  426 bits (1095), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 282/401 (70%), Gaps = 13/401 (3%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPE---GGFIKQ 57
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q  E      ++Q
Sbjct: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63

Query: 58  ELIIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKH 117
           EL+IGT T+  E NYLK A I+LP+ + +++    +  +++E+S    +S IKI  K+KH
Sbjct: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHR--QSKIKIVRKFKH 121

Query: 118 EEEITRARYMPQNPGTVATINGQGTVFIYSRS-----EGLQSTLKFHEENGYALSFSPLV 172
           E+E+TRARYMPQ+P  +AT+NG G V+I+ R+      G  ++  +H+ENGY L+F+P V
Sbjct: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
            G LLS SDD TVALWDV   ++ + P +T+ D+H+DIVND KWH F   LFGTVSED+ 
Sbjct: 182 SGQLLSASDDGTVALWDVTSTANKS-PSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNT 239

Query: 233 LKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMS 292
           L I+D   +      +     FNTLAFS  S NLLAAAGTDS+VYLYDLR +++PLH M+
Sbjct: 240 LIIHDTNSDRAIQKLS-VSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298

Query: 293 GHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHK 352
           GHED+VT+LEFSPH            R+IMWDL  IGAEQ PDDA DGVPEL M+H GH+
Sbjct: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358

Query: 353 SAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPP 393
           S VN+F  N+ +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  422 bits (1085), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 215/400 (53%), Positives = 271/400 (67%), Gaps = 25/400 (6%)

Query: 3   TQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIG 62
           T  + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+  Q PE     Q LI G
Sbjct: 37  TDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFG 91

Query: 63  THTSGEEENYLKFAEINLPKEI--LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           THT+GEE NYLK A INLP  I  L+  D ++EA +          S+  I  K+ H EE
Sbjct: 92  THTAGEEVNYLKVATINLPAGIAGLDQGDEEDEAND---------HSSFAIANKFPHIEE 142

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSR----SEGLQSTLKFHEENGYALSFSPLVEGLL 176
           + RARYMP N   +ATING+GT+ I+ R    S+   STL FH+ENGY L+F+P + G L
Sbjct: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202

Query: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           LSGSDD TVALWD+    ++ +  ++    H DIVND KWH F  ++FGTVSED  L+++
Sbjct: 203 LSGSDDTTVALWDI----EAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258

Query: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296
           D RV            PFNTL+FS HS NLLAAAG DS +YLYD+R+M  PLH MSGH+D
Sbjct: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356
           +VT +EFSPH            R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGH+S VN
Sbjct: 319 SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVN 378

Query: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVS 396
           +F  N QIPWL+ASTEE+N++Q WK S  L V   PP +S
Sbjct: 379 EFSFNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  419 bits (1076), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 206/399 (51%), Positives = 281/399 (70%), Gaps = 10/399 (2%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHT 65
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   +       +Q+LI+GTHT
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83

Query: 66  SGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRAR 125
           SGEE+NYLK   ++LP E+  N    ++  E DE       SN+KI  K+ H+ EITRAR
Sbjct: 84  SGEEQNYLKIGAVDLPVEVTEN---SKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRAR 140

Query: 126 YMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLLSGSD 181
           YMPQ+   +ATING+G +FIY RS    E L STL++H ENGY L+F+   +  LLSGSD
Sbjct: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200

Query: 182 DHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE 241
           D  +ALWD++    + +P  T+ D H+DI+ND KWH+    +FG+VSEDS +K+ D R  
Sbjct: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR-S 259

Query: 242 NTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301
           +         +P+NTLAFS  SSNL AAAGTD+ VYLYD+R++  PL+ M+GHEDAVT +
Sbjct: 260 SQIIHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319

Query: 302 EFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLN 361
           EF P+            R I+WDL++IGAEQT D+ EDG PE++M+HAGHK+++ND  +N
Sbjct: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379

Query: 362 AQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
             I WLVAS EE+NI+Q+WKCS ++P +GG P+V + ++
Sbjct: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  417 bits (1072), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 210/404 (51%), Positives = 283/404 (70%), Gaps = 20/404 (4%)

Query: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP    +P+    +QE+II
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMII 60

Query: 62  GTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121
           GTHTS +E NY+K A I LP E++   DP         VS    +SN++IT K+K E+EI
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHN-------VSDAPVKSNVRITKKFKLEKEI 110

Query: 122 TRARYMPQNPGTVATINGQGTVFIYSR--SEGLQSTLKFHEENGYALSFSPLVEGLLLSG 179
           TR+RYM Q+P  ++TI+G GTV I+ R  S+    T  +H++NGY LSF+P+ +G LLS 
Sbjct: 111 TRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSA 170

Query: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDL 238
           +DD  +A++D+N  S+   P+ TW    + I+ND KWH+F+  LFGTVSE+ + L I DL
Sbjct: 171 ADDGYIAMYDINAESED--PVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDL 228

Query: 239 RVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAV 298
           R ++  T + +  +PFN+LAFS HS NL +AAGTD +VYLYDLRN ++ LH MSGHE  V
Sbjct: 229 RTKDKVT-SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPV 287

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDF 358
           TNLEF               R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGH+S+VNDF
Sbjct: 288 TNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDF 347

Query: 359 DLNAQIPWLVASTEEENILQVWKCSHSLP-VVGGPPKVSMDMIS 401
            LN+ IPWL+ASTEEENI+QVWK S  LP +    P ++ D+I+
Sbjct: 348 SLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN 391

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  416 bits (1070), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 207/401 (51%), Positives = 273/401 (68%), Gaps = 21/401 (5%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP      +    +Q LI
Sbjct: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLP-----GDKTSTRQHLI 58

Query: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
           +GT TSG E +YLK A ++LP EI+  +            S    +SN+K+  K+ H+ E
Sbjct: 59  LGTLTSGAETDYLKIAALDLPDEIIIGKK-----------SDKVVKSNLKVVKKFAHDGE 107

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLL 176
           I RARYMPQN   +AT+NG+GT+FIY  S      L STLK+H++N Y L+F+P  EG L
Sbjct: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167

Query: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236
           +SGSDD T+ALWD   N    +PI+ W+  HSDIVND +WH FN ++FG+VSEDS L++ 
Sbjct: 168 ISGSDDSTIALWDAT-NDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226

Query: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296
           D R    +         +N++AFS  S NL AAAGT +++YLYD+RN  + LH M+GHE+
Sbjct: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356
            VT+LEFS              R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG +SA+N
Sbjct: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346

Query: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSM 397
           D   +  IPWL AS EE NI+QVWKCS  LP + G P+VS+
Sbjct: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSI 387

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 269/386 (69%), Gaps = 13/386 (3%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+  +  E     QELI+GTH
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61

Query: 65  TSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124
           TSG E+NYLK A ++LP E++++      + +D + S   P+S IKI  K++H +E+TRA
Sbjct: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121

Query: 125 RYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLLLSGS 180
           RY P NP  +ATI+G G VF+Y RS+     L +   FH+ENGY L+FS +  G LLS S
Sbjct: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           DD ++A+WDV    ++   + T    H++IVN+ KWH  +  LFG+VS+DS L I+D R+
Sbjct: 182 DDGSIAIWDVCSGKNTPVKVDT---SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238

Query: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           +       +  EP+NTLAFS HSSNL AAAGTDS V LYDLR  + P+H MSGH D+VT+
Sbjct: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           LEF+PH            R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGHKS VNDF  
Sbjct: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357

Query: 361 NAQIPWLVASTEEENILQVWKCSHSL 386
           +  IPWL+AS EEEN++Q+WK S  L
Sbjct: 358 SPNIPWLMASVEEENVVQIWKASKKL 383

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  390 bits (1003), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 211/389 (54%), Positives = 268/389 (68%), Gaps = 21/389 (5%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP      E     QEL++GTH
Sbjct: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-----QELLVGTH 61

Query: 65  TSGEEENYLKFAEINLPKEILNNEDP---QEEAGEDDEVSAPAPRSNIKITAKYKHEEEI 121
           TS  E+NYLK AEINLP+EIL+NE P    +  G D++V      S IKI  K+KHE E+
Sbjct: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVP-----SKIKIIKKFKHENEV 116

Query: 122 TRARYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLLL 177
           TRARY P +   +ATI+G GTVF+Y R++     L+    +H+ENGY L+FS    G L+
Sbjct: 117 TRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI 176

Query: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
           S SDD ++A+WD+   S  T P    S LHSDIVN+ KWH  + +++G+VSEDS L I+D
Sbjct: 177 SCSDDGSIAIWDIK--SGKTVPTSVNS-LHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233

Query: 238 LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
            R E       +  EPFNT+AFS HSSNL AAAGTD+ VYL+D R   E LH MSGH++A
Sbjct: 234 KRSEKPLQKLLQ-KEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357
           VT+LEF+ H            R+++WDL QIG EQ  +DA+DG PEL+M+HAGHKSA+ND
Sbjct: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352

Query: 358 FDLNAQIPWLVASTEEENILQVWKCSHSL 386
           F  +  +PWL+AS EEENI+Q+WK S  L
Sbjct: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  383 bits (983), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 203/414 (49%), Positives = 277/414 (66%), Gaps = 34/414 (8%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT--PVQEPEGGFIKQE 58
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+      P     +Q 
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSN---EQR 69

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHE 118
           L++GTHTSGEE+NYLK AEI LP +I+N      E  ED+  S    +SNI+I  K+KHE
Sbjct: 70  LLLGTHTSGEEQNYLKIAEITLPDQIIN------EKTEDN--SDKHVKSNIRIIKKFKHE 121

Query: 119 EEITRARYMPQNPGTVATINGQGTVFIY------SRSEGLQSTLKFHEENGYALSFSPLV 172
            E+TRA YMPQ+   +ATING GTVFIY      ++S  + S L  H+ENGY L+F+PL 
Sbjct: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +G LLS SDD +VA W++      + P+ T  +  + I+ND +W+ FN++LFG V+E S 
Sbjct: 182 KGKLLSSSDDGSVAYWNI----QKSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSC 235

Query: 233 LKINDLRVEN-----TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEP 287
           L + D+R  N      +    K P  FN +AFS HS  L+AA+G DS +YLYD RN+ +P
Sbjct: 236 LNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295

Query: 288 LHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDG-VPELIM 346
           LH+M GHED+VT+L+F               R+ +WDLKQIG EQT D+ EDG VPEL+M
Sbjct: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLM 355

Query: 347 VHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400
           +HAGH+S +NDF ++  + WL AS EE+NI+QVWK ++SL      P V+M++I
Sbjct: 356 IHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLR---EDPLVNMNVI 406

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  127 bits (320), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 104/416 (25%), Positives = 182/416 (43%), Gaps = 63/416 (15%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q+ P   +  +       L++ T TS + 
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSND----THRLLLSTFTSSQI 68

Query: 69  ---EENYLK-FAEIN-LPKEILNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEEEIT 122
              E  Y+   + +N L    LNN D  E E   D+ +  P+      I+  +  E +  
Sbjct: 69  PDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFP-EGDCN 127

Query: 123 RARYMPQNPGTVATINGQGTVFIYSRSE----------------------GLQSTLKFHE 160
           +ARYMPQNP  +   +  G ++I+ R++                       L    KF  
Sbjct: 128 KARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVI 187

Query: 161 ENG--------YALSFSPLVEGLLLSGSDDHTVALWDVNGN-SDSTRPIRT--WSDLHSD 209
           E+G         +++++P  EG LLS   +  + LWD     S   R I    W     D
Sbjct: 188 EDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDD 247

Query: 210 I-VNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFSHHSSNL 266
           +  N+  W N +  +F T  E++ + + D R E       +       N+  F++ ++ L
Sbjct: 248 LGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAML 307

Query: 267 LAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDL 325
           LA+  ++  + L+D+R + +P+ ++  H  +++ +E+SP            + L+ +WD 
Sbjct: 308 LASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD- 365

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
             I  E+ P          I +H GH   +ND   +   PWL+ S   +N +Q+WK
Sbjct: 366 --ISNEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  126 bits (316), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 183/411 (44%), Gaps = 55/411 (13%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L YD+++     WPSLT Q  P    + +    +  +++ + TS +  E
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP----DLDLATDEHRILLSSFTSSQVPE 78

Query: 70  ENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124
           +  L  A ++  K I    LNN D +E E   D+ +  P+      +  K+    +  +A
Sbjct: 79  DESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFP-AGDCNKA 137

Query: 125 RYMPQNPGTVATINGQGTVFIYSRSE--------------------GLQSTLKFHEENGY 164
           RY P NP  + + +  G+++++ R++                     L ++L+ H+    
Sbjct: 138 RYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAV 197

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDV---NGNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
           +L+++   +GLL +      V +WD+   + NS +       S +     N+  W   + 
Sbjct: 198 SLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHD 257

Query: 222 DLFGTVSEDSLLKINDLRVENTTTGTAKCPEP-----FNTLAFSHHSSNLLAAAGTDSHV 276
            L    SED+L+ I D+R  N   G +    P      NT  F++H   LL +A +   +
Sbjct: 258 SLLAYCSEDNLVGIMDIR--NPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRI 315

Query: 277 YLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPD 335
            L+D+RN  +PL  +  H D+++ L+++P              L+ +WDL Q   +    
Sbjct: 316 NLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ---- 370

Query: 336 DAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
                  ELI  H GH   VND   +    W++ S   +N +QVW+ S+SL
Sbjct: 371 -------ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 107/407 (26%), Positives = 187/407 (45%), Gaps = 53/407 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+Y++++     WPSLT Q++P    + +    K  +++ + TS
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP----DMDIASDKHRILLSSFTS 73

Query: 67  GE--EENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEE 119
            +  E+  +  +EI+  K I    LNN   +E E   D++V       N+  T K +  E
Sbjct: 74  AQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKL---SKNLTETIKIQFPE 130

Query: 120 -EITRARYMPQNPGTVATINGQGTVFIYSRSEG-------LQSTLKFHEE---------- 161
            +  RARYMPQNP  +A+ +  G+V+I+ R++        L +T K+  E          
Sbjct: 131 GDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNY 190

Query: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI----VNDSKWH 217
              +L+++    G+L +   D  V +WD+    +  +P  T  DL   +     N+  W 
Sbjct: 191 EASSLAWNYQRSGILAASYSDGDVKIWDIT-KYNKAQPQLTVPDLRWQVDKEGANEVSWM 249

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENT-TTGTAKC-PEPFNTLAFSHHSSNLLAAAGTDSH 275
             +  +     E + L I D R   T +T    C     N + F++ +  LL +A ++  
Sbjct: 250 VHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGT 309

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
           + + D+R ++ P+   S H DAV+ ++++P            + L+ +WDL Q   E  P
Sbjct: 310 LNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ---EDDP 365

Query: 335 DDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
                    L+ +H GH   VND   N   PW++ S   +N + +WK
Sbjct: 366 ---------LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 107/423 (25%), Positives = 194/423 (45%), Gaps = 64/423 (15%)

Query: 2   ETQEKPLS-----VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIK 56
           + +E+P+S     V   Y  WK N  L+YD+++     WPSLT Q+ P    + +    +
Sbjct: 8   DIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTSSDQ 63

Query: 57  QELIIGTHTSGE--EENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNI 109
             L++ + TS +  E+  +  ++I+  K +    LNN D  E E   D  V  P      
Sbjct: 64  HRLLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTT 123

Query: 110 KITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGY----- 164
           +++ ++ + +   R+RY+PQNP  +A  +  G+V+I+++++   S L+    + +     
Sbjct: 124 EVSIRFPNGD-CNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLF 182

Query: 165 ----------------ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDS----TRPIRTWS 204
                           +LS++   EG+L          +WDV   S S    ++P  T +
Sbjct: 183 SGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVT 242

Query: 205 DLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV----ENTTTGTAKCPEPFNTLAFS 260
              S+  ND  W   +  +F    E + L + D+R+    E  +    K  +  NT  F+
Sbjct: 243 -FDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFN 301

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
             +S L+A+A T   + L+D+R + +EP+  M  H  +++ +E++P+           + 
Sbjct: 302 PGNSLLVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDG 360

Query: 320 LI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQ 378
           L+ +WD   +G E             I VH GH   VND   +   PWL+AS   +N +Q
Sbjct: 361 LVKLWD-ASVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQ 406

Query: 379 VWK 381
           +W+
Sbjct: 407 IWR 409

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 106/420 (25%), Positives = 187/420 (44%), Gaps = 71/420 (16%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSG-- 67
           + E Y  WK N  L+YD+++     WPSL+ Q+     Q+         +++ + TSG  
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF----QDVNTKNDSHRILLSSFTSGLM 78

Query: 68  ---EEENYLKFAEI-NLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE--- 120
              E  N +  + + ++P   LNN D  E   +        P +N+K+  K  H E+   
Sbjct: 79  PEQESINIMSISTLKHVPWASLNNFDMDEMEFK--------PDNNLKLPPKNLHTEQTIT 130

Query: 121 -----ITRARYMPQNPGTVATINGQGTVFIYSRSE---GLQSTLKFHE--------EN-- 162
                  RARY+PQN   +A  +  GTV+I++R++    L+ T  F          EN  
Sbjct: 131 FPNGDCNRARYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTV 190

Query: 163 ---------GYALSFSPLVEGLLLSGSDDHTVALWDV----NGNSDSTRPIRTWSDLHSD 209
                      ++ ++   EGLL +   D  +  WD+    N N+  T P  +   + ++
Sbjct: 191 QSVDSNPNEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIM-MDTN 249

Query: 210 IVNDSKWHNFNKDLFGTVSEDSLLKINDLR--VENTTTGTAKCPEPFNTLAFSHHSSNLL 267
             ND  W   +  L     E + L I D+R   E+TT  +    +  N   F++ ++ ++
Sbjct: 250 GANDVTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIV 309

Query: 268 AAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLK 326
           A+A T  +V+++D+R   E +  +  H  +++ +E++P+           + L+ +WD+ 
Sbjct: 310 ASADTVGNVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVT 368

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
                           ELI  H GH   VND   N   PWL+ S   +N +Q+W+ +H+L
Sbjct: 369 D--------------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 103/413 (24%), Positives = 186/413 (45%), Gaps = 51/413 (12%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P  V   Y  WK N  L+YD+++     WPSLT Q+ P    + +    +  L++ + TS
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTNDQHRLLLSSFTS 82

Query: 67  GE--EENYLKFAEIN----LPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
            +  E+  +  + ++    LP   LNN D  E   + D  S    ++ IK         +
Sbjct: 83  SQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGD 142

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSE-GL-----------------QSTLKFHEEN 162
              ARY+PQNP  +A  +  G+++++ R++ GL                  S+L+ H+E 
Sbjct: 143 CNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQE- 201

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI----VNDSKWHN 218
             +L+++   EGLL +      V +WDV   S +  P+   +D   +      ND  W  
Sbjct: 202 VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNF-PVIDKADYTHNADPRGCNDVSWMV 260

Query: 219 FNKDLFGTVSEDSLLKINDLRVE----NTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDS 274
            +  +     E + + + D R +    ++T  T       N+  F++H+  LL +  +  
Sbjct: 261 NHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG 320

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 333
            V L+D+R+++ PL  +  H  +++  +++P+           + L+ +WD+ Q   E  
Sbjct: 321 RVNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-- 377

Query: 334 PDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
                    EL+ VH GH   VND   N   PWL+ S   +N +Q+W+ + +L
Sbjct: 378 ---------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 183/422 (43%), Gaps = 61/422 (14%)

Query: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61
           E    P+ + E Y  WK N  L+YD+++     WPSLT Q+ P    + +    +  +++
Sbjct: 11  EASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTSDEHRILL 66

Query: 62  GTHTSGE--EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKY 115
            + TS +  E+  +  ++I+    I    LNN D  E   + +  +    +  +   + +
Sbjct: 67  SSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIF 126

Query: 116 KHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTL-----------KFHEENGY 164
               E  RARY+PQNP  +A  +  G ++I+ R++   + +           K    +G 
Sbjct: 127 FPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGV 186

Query: 165 ------------------ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRT-WSD 205
                             +L+++   E LLLS   +  V +WD+   S     I      
Sbjct: 187 IQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVS 246

Query: 206 LHSD--IVNDSKWHNFNKDLFGTVSEDSLLKINDLRV--ENTTTGTAKCPEPFNTLAFSH 261
           ++SD   VND  W   +  LF   +E + + + DLR   E   +   K     N+  F++
Sbjct: 247 INSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNY 306

Query: 262 HSSNLLAAAGTDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
            +S +LA+A ++  + L+D+RNM K P+  M  H  +V+ LE+SP+           + L
Sbjct: 307 KNSLILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGL 365

Query: 321 I-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQV 379
           + +WD                  E I  H GH   VND   +A  PWL+ S   +N + +
Sbjct: 366 VKLWDT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHI 411

Query: 380 WK 381
           WK
Sbjct: 412 WK 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  120 bits (302), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 103/419 (24%), Positives = 185/419 (44%), Gaps = 59/419 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+YD+++     WPSLT Q+ P    + +       ++I + TS
Sbjct: 14  PNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFP----DLDTTSDTHRILISSFTS 69

Query: 67  GE--EENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEE 119
            +  E+  +  ++I+  K +    +NN D  E E   D  +  P+      +T K+ + +
Sbjct: 70  SQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFPNGD 129

Query: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLK---------------------F 158
              RARY+PQNP  +A  +  G+V+I+ R++   S ++                      
Sbjct: 130 -CNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEEL 188

Query: 159 HEENGYALSFS--PLVEGLLLSGSDDHTVALWDV----NGNSDSTRPIRTWSDLHSDI-- 210
           HE    A+S +     EG L S      V +WD+    + N    +P+    ++  D   
Sbjct: 189 HENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVL---NIQFDALG 245

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFSHHSSNLLA 268
           VND  W   +  LF    E   L + D R+    +  A+       N+  F++ ++ LLA
Sbjct: 246 VNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLA 305

Query: 269 AAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQ 327
           +A ++  V ++D+RN+ +       H  +++ +E++P+           + L+ +WD+  
Sbjct: 306 SADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVSN 365

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
              E            L+ VH GH   VND   +    WL+ S   +N +Q+WK +H+L
Sbjct: 366 TDNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 176/417 (42%), Gaps = 58/417 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q+ P    + +       +++ + TS
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDS----HRILLSSFTS 73

Query: 67  G--EEENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE- 119
               E+  L    I+  K +    LNN D  E   + D  +   P  N+      +    
Sbjct: 74  SLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNG 133

Query: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLV------- 172
           +  RARY+PQNP  +A  +  G+V+I+ R++    T     ++G+  S+   +       
Sbjct: 134 DCNRARYLPQNPDLIAAASSDGSVYIFDRTK--HGTAMHSRQSGFTQSYQAKLAVNNNSQ 191

Query: 173 -----------------EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWS---DLHSDIVN 212
                            EG L+    D  V  WD+     S   I+       L     N
Sbjct: 192 SLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCN 251

Query: 213 DSKWHNFNKDLFGTVSEDSLLKINDLRVENTTT--GTAKCPEPFNTLAFSHHSSNLLAAA 270
           D+ W   +  LF   SED+ L + D R E+      T+      N   F+  +S LLA+ 
Sbjct: 252 DAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASG 311

Query: 271 GTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIG 329
            +  ++ L+D+R  + P++ +  H  +++ +E++P+           + L+ +WD     
Sbjct: 312 DSIGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA---- 366

Query: 330 AEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
                     G  + + +H GH   VND   N   PWL+ S  ++N +Q+WK +H+L
Sbjct: 367 ----------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  120 bits (300), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/422 (23%), Positives = 184/422 (43%), Gaps = 61/422 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P+ + E Y  WK N  L+YD+++     WPSLT Q+ P    + +    +  +++ + TS
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILLSSFTS 71

Query: 67  GE--EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120
            +  E+  +  ++I+    I    LNN D  E   + +  +   P   +   + +    +
Sbjct: 72  SQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGD 131

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEEN------------------ 162
             RARY+PQNP  +A  +  G ++I+ R++   + ++  + +                  
Sbjct: 132 CNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVE 191

Query: 163 -----------GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRT-WSDLHSDI 210
                        +L+++   E LLLS   +  V +WD+   S     I +    + SD 
Sbjct: 192 AMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDA 251

Query: 211 --VNDSKWHNFNKDLFGTVSEDSLLKINDLRV--ENTTTGTAKCPEPFNTLAFSHHSSNL 266
             VND  W   +  LF   +E +++ + DLR   E   +         N+  F++ +S +
Sbjct: 252 SGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLV 311

Query: 267 LAAAGTDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWD 324
           LA+A ++  + L+D+R M E P+  M  H  +++ LE++P+           + L+ +WD
Sbjct: 312 LASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWD 370

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSH 384
             +               E I  H GH   VND   +   PWL+ S   +N + +WK + 
Sbjct: 371 TAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAE 416

Query: 385 SL 386
           +L
Sbjct: 417 NL 418

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 104/422 (24%), Positives = 184/422 (43%), Gaps = 61/422 (14%)

Query: 2   ETQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII 61
           E    P ++ E Y  WK N  L+Y++++     WPSLT Q+ P    + +    +  +++
Sbjct: 11  EASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILL 66

Query: 62  GTHTSGE--EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKY 115
            + TS +  E+  +  ++I+    I    LNN D  E   + +  +   P+  +   + +
Sbjct: 67  SSFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIF 126

Query: 116 KHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTL-----------KFHEENGY 164
               E  RARY+PQNP  +A  +  G ++I+ R++   + +           K    +G 
Sbjct: 127 FPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGV 186

Query: 165 ------------------ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRT-WSD 205
                             +++++   E LLLS   +  V +WD+   S     I      
Sbjct: 187 IQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVS 246

Query: 206 LHSDI--VNDSKWHNFNKDLFGTVSEDSLLKINDLRV--ENTTTGTAKCPEPFNTLAFSH 261
           ++SD   VND  W   +  LF   +E + + + DLR   E   +         N+  F++
Sbjct: 247 INSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNY 306

Query: 262 HSSNLLAAAGTDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
            +S +LA+A ++  + L+D+RNM + PL  M  H  +V+ LE+SP+           + L
Sbjct: 307 RNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGL 365

Query: 321 I-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQV 379
           + +WD  +               E I  H GH   VND   +A  PWL+ S   +N + +
Sbjct: 366 VKLWDTSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHI 411

Query: 380 WK 381
           WK
Sbjct: 412 WK 413

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  118 bits (296), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 98/412 (23%), Positives = 188/412 (45%), Gaps = 53/412 (12%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE- 68
           V + Y  WK N  L+YD+++     WPSL+ Q+ P      +    KQ +++ + TS + 
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTND----KQRILLSSFTSQQL 75

Query: 69  -EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE---- 119
            ++  +    I+    +    +NN D  E   + D        +++K+  K   EE    
Sbjct: 76  PQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLD--------NSLKLNDKTLEEEVRIT 127

Query: 120 ----EITRARYMPQNPGTVATINGQGTVFIYSRSE---GLQSTLKFHEE---NG------ 163
               +  R RYMPQNP  + T +  G+V+I+ R++    + +  KF  E   NG      
Sbjct: 128 YPDGDCNRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDE 187

Query: 164 -YALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTR----PIRTWSDLHSDIVNDSKWHN 218
             +L+++  +EG L +   +  V +WD+     S +    P R  S + ++ VND  W  
Sbjct: 188 SLSLAWNYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERE-SVMDANGVNDVSWMV 246

Query: 219 FNKDLFGTVSEDSLLKINDLRVENT--TTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHV 276
            +  +  +  E +++ + D+R +    T       +  N + F++ +  +L    +   +
Sbjct: 247 NHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQL 306

Query: 277 YLYDLRNMKEPLHHMS-GHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
            ++D+R+ KEP+     G +D ++ ++++P            + L+ +WD      EQ  
Sbjct: 307 KIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQED 363

Query: 335 DDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
            +AE+ +  L+ VH GH   VND   +   PW + S   +N + +WK + +L
Sbjct: 364 SNAENNM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  118 bits (295), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 104/412 (25%), Positives = 178/412 (43%), Gaps = 54/412 (13%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q++P  ++ P     K  L++ + TS + 
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPD-LEVPTD---KHRLLLSSFTSSQL 76

Query: 69  -EENYLKFAEIN----LPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE-EIT 122
            E+  +  +E++    +P   LNN D  E   + D   A  P  N+  T + +    +  
Sbjct: 77  PEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDN-QAKLPNKNLVETVRIQFPSGDCN 135

Query: 123 RARYMPQNPGTVATINGQGTVFIYSRSE---------GLQSTLKFH-----------EEN 162
           RA YMPQNP  +  I   G V I+ R++         G  ++ +                
Sbjct: 136 RACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAE 195

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPI-----RTWSDLHSDIVNDSKWH 217
             +L+++    G++ S   +  + +WD+     S   I     R   D      ND  W 
Sbjct: 196 ALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG--TNDVSWM 253

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEP--FNTLAFSHHSSNLLAAAGTDSH 275
             +  +     E + + + D R  +    T   P     N L F++ +  LL AA ++  
Sbjct: 254 VHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGG 313

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTP 334
           + L+D R   +PL  +  H D+V+ L+++P+           + LI +WD       + P
Sbjct: 314 IALWDCRAFSKPLS-VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSREP 367

Query: 335 DDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
           +D+      L+ VH GH   VND   N   PWL+ S   +N + VWK + +L
Sbjct: 368 EDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  116 bits (291), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 172/406 (42%), Gaps = 51/406 (12%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE--E 69
           + Y LWK N  L+YD+++     WPSL+ Q+ P    + +       L+  + TS +  +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFP----DLDTSSDTHRLLFTSFTSSQLPQ 65

Query: 70  ENYLKFAEIN----LPKEILNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124
           +  +  A I+    +P   LNN D  E E   D     P     I++T  + H  +  RA
Sbjct: 66  DENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRA 124

Query: 125 RYMPQNPGTVATINGQGTVFIYSRSEGLQSTLK----------FHEENG------YALSF 168
            Y+PQNP  ++T +  G+V+I+ R++  +S +               NG       AL +
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 169 SPLVEGLLLSGSDDHTVALWDVNG----NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           +  +EG+L S   +  + +WD+      N   ++P   + D  S   ND  W   +  L 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDL 281
               ED+++ + D R       T          N   F+     L+A A  D  V L+D+
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 282 RNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAEDG 340
           R +  P+  ++  E  ++ LE++P            + L+ +W            +A +G
Sbjct: 305 RKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 341 VPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
             +L+  H GH   VND   +    WL+ S   +N   +WK +  L
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  116 bits (290), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 100/416 (24%), Positives = 182/416 (43%), Gaps = 56/416 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+YD+++     WPSLT Q+      + +       +++   TS
Sbjct: 15  PEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF----HDLDTTSDTHRILLSAFTS 70

Query: 67  GE--EENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNIKITAKYKHEE 119
            +  E+  +  A+++  K +    +NN D  E E   ++ +  P+      I+ ++  + 
Sbjct: 71  SQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFP-DG 129

Query: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSE------GLQSTLKFHEENGYA-------- 165
           +   ARY+PQNP  +A  +  G+++I+ R++           LK +E   Y         
Sbjct: 130 DCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENV 189

Query: 166 --------LSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRT---WSDLHSDIVNDS 214
                   +S++   EGLL S      + LWD+   S+S   + T     D  +  VND 
Sbjct: 190 ENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDV 249

Query: 215 KWHNFNKDLFGTVSEDSLLKINDLRV--ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT 272
            WH  +  +     E +++ + D R+  E   +         N+  F+ H  +LL +  +
Sbjct: 250 NWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDS 309

Query: 273 DSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGA 330
           +  + L+DLR +  EP+  +  H  +++ LE++P+           + L+ +WD+     
Sbjct: 310 EGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV----- 363

Query: 331 EQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
                       EL+  H GH   VND   N    WL+ S   +N +QVWK +H+L
Sbjct: 364 ---------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  116 bits (290), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 179/417 (42%), Gaps = 56/417 (13%)

Query: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60
           +E    P  + E Y  WK N  L+Y +++     WPSLT Q+ P    + +       ++
Sbjct: 7   IEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFP----DLDTTTDTHRIL 62

Query: 61  IGTHTSGE--EENYLKFAEINLPKEI----LNNEDPQE-EAGEDDEVSAPAPRSNIKITA 113
           + T TS +  E+  L  A ++    +    LNN D  E E   D+    P+   N+ I+ 
Sbjct: 63  LSTFTSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISI 122

Query: 114 KYKHEEEITRARYMPQNPGTVATINGQGTVFIYSR----SEGLQSTLKFHEENGYA---- 165
            + + +   RARY+PQNP  +A  +  G+++I++R    S  L S  +  E   Y+    
Sbjct: 123 PFPNGD-CNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKM 181

Query: 166 ------------LSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIR---TWSDLHSDI 210
                       ++++    G L S     ++ +WD+   S S   +R          + 
Sbjct: 182 DENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEG 241

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRVE----NTTTGTAKCPEPFNTLAFSHHSSNL 266
            N+  W   +  +F   SE + L + D+R +      T          N+  F++++  L
Sbjct: 242 CNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDML 301

Query: 267 LAAAGTDSHVYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWD 324
           LA+A +   + ++D+R + KEP+     H  +++ LE++P+           + L+ +WD
Sbjct: 302 LASADSTGKINMWDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVKIWD 360

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
                             + I VH GH   VND   +   PWL++S   +N + VWK
Sbjct: 361 TAN--------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWK 403

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 104/423 (24%), Positives = 181/423 (42%), Gaps = 69/423 (16%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q  P    + +    +  +++ + TS
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP----DLDLAGDEHRILLSSFTS 73

Query: 67  GE--EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEE- 119
            +  E+  +  A ++  K I    LNN D  E   + D  S   P  NI    + K    
Sbjct: 74  SQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDN-SLKLPPKNIVEDLRIKFPAG 132

Query: 120 EITRARYMPQNPGTVATINGQGTVFIYSRSE--------------------GLQSTLKFH 159
           +  +ARY P NP  +++ +  G+V+++ R++                     L ++L+  
Sbjct: 133 DCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEER 192

Query: 160 EENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIV------ND 213
           +     L+++   +GLL +      V +WD+    D   P  T  D HS ++      ND
Sbjct: 193 QNEALNLAWNWQQQGLLATCYSGGEVCVWDL-AKYDKASP--TLIDPHSSLLADPQGSND 249

Query: 214 SKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPF---------NTLAFSHHSS 264
             W   +  L     E + L + D R+      T + P+ F         N   F+++  
Sbjct: 250 ISWMVNHDSLLAYCGEGNALGVLDTRI------TKQPPQSFSNPHHSNGVNACQFNYYKD 303

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MW 323
            LL +A +   + L+D+R+   P+  +  H  +V+ L+++PH           + L+ +W
Sbjct: 304 LLLCSADSAGRINLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIW 362

Query: 324 DLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCS 383
           DL Q      P D E     L   H GH   VND   +   PW++ S   +N +Q+WK S
Sbjct: 363 DLSQ------PVDQE-----LKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPS 411

Query: 384 HSL 386
            +L
Sbjct: 412 QNL 414

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 179/419 (42%), Gaps = 72/419 (17%)

Query: 13  EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE--EE 70
            Y  WK N  L+YD+++     WPSLT Q+ P    + +       +++ ++TS +  E+
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP----DVDANTDTHRILLSSYTSCQLPED 73

Query: 71  NYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPR---SNIKITAKYKHEEEITR 123
             +  A I+    +    LNN D  E   + D  +   P+   +N+ IT       +  R
Sbjct: 74  ENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNR 130

Query: 124 ARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFH------------------------ 159
           ARYMPQNP  +A  +  G V++++R++     ++ H                        
Sbjct: 131 ARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEA 190

Query: 160 -----EENGYALSFSPLVEGLLLSGSDDHTVALWDVNG-NSDSTRPIRT-W--SDLHSDI 210
                +    +L+++   EG L        V +WD+   N D+T    T W  S+  S  
Sbjct: 191 RRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRG 250

Query: 211 VNDSKWHNFNKDLFGTVSEDS-LLKINDLRVENTTTGTAKCPEPF-----NTLAFSHHSS 264
           VND  W + +  +     E S  L + D R +N     AK    F     N   F+  ++
Sbjct: 251 VNDVSWMSQHDSILAACGERSDSLALFDTRAQN---AVAKIRNQFKSEGINACKFNWENN 307

Query: 265 NLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-M 322
            LLA+  +     L+D+R +  EP+ H   H  +V+ LE++PH           + LI +
Sbjct: 308 LLLASTDSTGRTNLWDVRKLSAEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKI 366

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           WD        T  + ED   + I VH+GH   VND   +   PWL+ S   +N + VWK
Sbjct: 367 WD--------TSLEIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWK 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  114 bits (286), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 98/415 (23%), Positives = 175/415 (42%), Gaps = 63/415 (15%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE- 68
           + E Y  WK N  L+YD+++     WPSLT Q+ P    + +    +  +++ + TS + 
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLNEHRILLSSFTSSQK 74

Query: 69  -EENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITR 123
            E+  +  + I+    I    LNN D  E   + +  +    +  +     +    E  R
Sbjct: 75  PEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNR 134

Query: 124 ARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHE----------------------- 160
           ARY+PQNP  +A  +  G ++I+ R++   + ++  +                       
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMD 194

Query: 161 ------ENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDST----RPIRTWSDLHSDI 210
                     +L+++   E LLLS   +  + +WD+   S        P+ +  D     
Sbjct: 195 TSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMS-IDSDGSS 253

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRV--ENTTTGTAKCPEPFNTLAFSHHSSNLLA 268
           VND  W   +  LF   +E + + + DLR   E   +         N+  F++ +S +LA
Sbjct: 254 VNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILA 313

Query: 269 AAGTDSHVYLYDLRNMKE-PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLK 326
           +A ++  + L+D+RNM E P+  M  H  +V+ LE+SP+           + L+ +WD  
Sbjct: 314 SADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTT 372

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           +               E I  H GH   VND   +   PWL+ S   +N + +WK
Sbjct: 373 R--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  112 bits (280), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 97/413 (23%), Positives = 179/413 (43%), Gaps = 61/413 (14%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L+YD+++     WPSLT ++ P    + +       L++ + TS +  E
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP----DLDTTTDSHRLLLSSFTSSQLPE 72

Query: 70  ENYLKFAEINLPKEI----LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRAR 125
           +  +  + I+  K +    LNN D  E   + +  +   PR+     +      +  RAR
Sbjct: 73  DESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRAR 132

Query: 126 YMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGY--ALSFSPLVE---------- 173
           Y+PQNP  ++  +  G+++I+ R++   +  +      Y   L  +P VE          
Sbjct: 133 YLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVS 192

Query: 174 --------GLLLSGSDDHTVALWDVN----GNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
                   G+L S      + +WD++     N     PI +  D      ND  W   + 
Sbjct: 193 LDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHD 252

Query: 222 DLFGTVSEDSLLKINDLRVENTTTGTAKCPEP------FNTLAFSHHSSNLLAAAGTDSH 275
            L     E + + I D R ++  +      +P       N+  F+ H+  LLA+A +   
Sbjct: 253 SLLAACGESNTVAIYDTRSKSQVSKI----QPGLHNGGINSCDFNAHNDYLLASADSIGT 308

Query: 276 VYLYDLRNM-KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 333
           V+++D+R + ++P+  +S H  +++ ++++P+           + L+ +WD         
Sbjct: 309 VHMWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD--------- 358

Query: 334 PDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSL 386
              A +G  +LI  H GH   VND   NA  PWL+ S   +N + +W+ S  L
Sbjct: 359 ---ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 96/408 (23%), Positives = 164/408 (40%), Gaps = 62/408 (15%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEINL 80
           P +YD +    + WP LT+  +P  +      + +  L+   T  S ++EN L    ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 81  PKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEIT------RARYMP--QNPG 132
             + L          +DDEV++     +   T      E I+      R R  P  Q+  
Sbjct: 179 LAKTL--------VKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNK 230

Query: 133 TV--ATINGQGTVFIYS---RSEGLQS--------------TLKFHEE-NGYALSFSPLV 172
            V  AT++  G V+I+    +S+   S              T+K H    GYAL +SPL+
Sbjct: 231 EVLTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLI 290

Query: 173 E-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDS 231
           + G LL+G     + L   N  S      + ++  ++  V D +W      +F +   D 
Sbjct: 291 KTGALLTGDCSGQIYLTQRN-TSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDG 349

Query: 232 LLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR------- 282
            ++I D R +               N ++++     LLA+   +    ++DLR       
Sbjct: 350 YVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNI 409

Query: 283 NMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQT 333
           N  +P+     H+ A+T++ F+P            N + +WDL         KQ  AE  
Sbjct: 410 NNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK 469

Query: 334 PDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
             + E   P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 470 --ELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/399 (22%), Positives = 166/399 (41%), Gaps = 45/399 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  LPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATING 139
           L K +L +++ +++   +DE        N  I  +            +       AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 140 QGTVFIY---SRSEGLQS--------------TLKFHEE-NGYALSFSPLVE-GLLLSGS 180
            G V+IY   ++S+   +              T+K H    GY L +SPL++ G LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
               + L   + +   T   ++++  +++ + D +W      +F T + D  ++I D R 
Sbjct: 294 CSGQIYLTQRHTSRWVTDK-QSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRS 352

Query: 241 EN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK-------EPLHHM 291
           +               N +++S     LLA+   +    ++DLR          +P+   
Sbjct: 353 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 412

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGVP 342
             H+ A+T++ F+P            N + +WDL         KQ  AE    + +D  P
Sbjct: 413 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQDIPP 470

Query: 343 ELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           +L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 471 QLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 167/411 (40%), Gaps = 43/411 (10%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI-IGTH 64
           +PL  DE  +      P +Y+ +    + WP L++  +P  +      + +  L+   T 
Sbjct: 107 RPLGPDEVLEA----DPTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQ 162

Query: 65  TSGEEENYLKFAEI-NLPKEILNNEDPQ---------EEAGEDDEVSAPAPRSNIKITAK 114
            S ++EN L    + NL K +L +E+ +         E   E++ ++     + IK++  
Sbjct: 163 ASKKKENELMVLSLSNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPF 222

Query: 115 YKHEEEITRARYMPQNPGTVATINGQGTVF------IYSRSEGLQSTLKFHEE-NGYALS 167
               +E+  A         +  I  Q   F      I  +S+    T++ H    GY L 
Sbjct: 223 ASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLD 282

Query: 168 FSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           +SPL++ G LLSG     + L   +  S      + +S  ++  + D +W      +F T
Sbjct: 283 WSPLIKSGALLSGDCSGQIYLTQRH-TSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFAT 341

Query: 227 VSEDSLLKINDLRVE--NTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNM 284
              D  +++ D R +               N ++++     LLA+   +    ++DLR  
Sbjct: 342 AGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQF 401

Query: 285 K-------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-----AEQ 332
                   +P+   + H+ A+T++ F+P            N + +WDL          +Q
Sbjct: 402 TPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQ 461

Query: 333 TPDDAE--DGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           T +  E  +  P+L+ VH   +  + D   + QIP  + ST  +  L +WK
Sbjct: 462 TEETKELKEIPPQLLFVH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/382 (20%), Positives = 145/382 (37%), Gaps = 70/382 (18%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEI-N 79
           P +Y+ +    + WP L++  +P  +      + +  L+   T  S ++EN L    + N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 80  LPKEILNNEDPQ---------EEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQN 130
           L K +L +E+ +         E   E++ ++     + IK++      +E+  A      
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 131 PGTVATINGQGTVF------IYSRSEGLQSTLKFHEE-NGYALSFSPLVE-GLLLSGSDD 182
              +  I  Q   F      I  +S+    T++ H    GY L +SPL++ G LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 183 HTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242
             + L        + R    W       V D + ++                 N+  +E+
Sbjct: 299 GQIYL--------TQRHTSKW-------VTDKQAYSVG---------------NNKSIED 328

Query: 243 TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNL 301
                         + +S   S + A AG D ++ ++D R+ K +P   +      V  +
Sbjct: 329 --------------IQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVI 374

Query: 302 EFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLN 361
            ++                 +WDL+Q     TPD+A +  P  +  +  HK A+     N
Sbjct: 375 SWNEKIGYLLASGDDNGSWGVWDLRQF----TPDNAANIQP--VAQYNFHKGAITSIAFN 428

Query: 362 AQIPWLVASTEEENILQVWKCS 383
                +VA   E+N + +W  S
Sbjct: 429 PLEESIVAVGSEDNTVTLWDLS 450

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 96/413 (23%), Positives = 169/413 (40%), Gaps = 73/413 (17%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI-IGTHTSGEEEN---YLKFAE 77
           P +Y+ +    + WP LT+  +P  +      + +  L+   T  S ++EN    LK ++
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  IN--LPKEILNNEDPQEEAG--------EDDEVSAPAPRSNIKITAKYKHEEEITRARYM 127
           +N  L K+  + E+  E+          E++E+S     + +KI+     +E +T     
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLT----- 232

Query: 128 PQNPGTVATINGQGTVFIY------------------SRSEGLQSTLKFHEENGYALSFS 169
                  AT++  G V+I+                  S  + L +        GY L +S
Sbjct: 233 -------ATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWS 285

Query: 170 PLVE-GLLLSGSDDHTVALWDVNGNSDST--RPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           PL++ G LL+G     V L   + +   T  +P  T+S+  S  + D +W      +F T
Sbjct: 286 PLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPF-TFSNNKS--IEDIQWSRTESTVFAT 342

Query: 227 VSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNM 284
              D  ++I D R +       T       N ++++     LLA+   D    ++DLR +
Sbjct: 343 SGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQL 402

Query: 285 K-------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQI 328
                   +P+     H+ A+T++ F+P            N + +WDL         KQ 
Sbjct: 403 SPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQ 462

Query: 329 GAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
            AE    + +   P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 463 AAETK--ELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 93/208 (44%), Gaps = 25/208 (12%)

Query: 156 LKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSK 215
            ++ EEN + L   PL +  L++   D +V L D  GN  +   I+     H+  +ND K
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDW-GNLKTISSIQC----HTTSINDMK 62

Query: 216 WHNFNKD---LFGTVSEDSLLKINDLRVENTTTGTAK-CPEPFNTLAFSHHSSNLLAAA- 270
             N + D   +F T +ED  +K+ D+R  N           PF +L   H   N+LA   
Sbjct: 63  VINSDFDTGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPFFSLDSRH---NMLACGT 118

Query: 271 ---GTDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
                D+ +++YD+RN  +P+   +  H D +T+++F P              + ++DL 
Sbjct: 119 ELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT 178

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHKSA 354
           Q       DD ED + ++I   + H   
Sbjct: 179 Q-------DDEEDALHQVINFASIHSCG 199

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 17/162 (10%)

Query: 153 QSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS-DIV 211
           Q     H +   +L+ +     +L S S DHTV LWD+N      R  R+   +HS   V
Sbjct: 264 QHVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHG----RAARSLDAVHSATAV 319

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKC-----PEPFNTLAFSHHSSNL 266
           + S+WH  +  +  T   DS + ++D+R+ N   G +K       E   +  F   +  L
Sbjct: 320 SSSQWHPSDGSILLTAGYDSRVALSDVRIAN-DAGMSKYWKVMKGEEIESATFVSETVFL 378

Query: 267 LAAAGTDS-HVYLYDLRNMKE--PLHHMSGHEDAVTNLEFSP 305
              AGTDS +VY +DLRN ++  PL  ++ H+  +++L  SP
Sbjct: 379 ---AGTDSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVSP 417

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 93/399 (23%), Positives = 161/399 (40%), Gaps = 45/399 (11%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 80  LPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATING 139
           L K +L +++  E+  EDDE        N  I  +            +       AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 140 QGTVFIYS---RSEGLQS--------------TLKFHEE-NGYALSFSPLVE-GLLLSGS 180
            G V+IY+   +S+   +              T+K H    GY L +SPL++ G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG- 293

Query: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           D      +     S      + ++  ++  + D +W      +F T   D  ++I D R 
Sbjct: 294 DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS 353

Query: 241 EN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK-------EPLHHM 291
           +               N +++S     LLA+   +    ++DLR          +P+   
Sbjct: 354 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQY 413

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDGVP 342
             H+ A+T++ F+P            N + +WDL         KQ  AE    + ++  P
Sbjct: 414 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQEIPP 471

Query: 343 ELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           +L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 472 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 79/151 (52%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +++ +     +L S S DHTV LWD+N    S    R+ + +HS+  V+ S+WH
Sbjct: 285 HTDAVLSMAHNKYFRSVLASTSADHTVKLWDLN----SGNAARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + + D+R+ + +      +A   E   T+ F+  S N++   GTD
Sbjct: 341 MLNGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAGEEIETVTFA--SENII-LCGTD 397

Query: 274 S-HVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
           S +VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 398 SGNVYSFDIRNNENRKPVWTLKAHDAGISTL 428

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/409 (21%), Positives = 164/409 (40%), Gaps = 66/409 (16%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI-IGTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S + EN L   A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 80  LPKEILNNEDPQEEAG----------EDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQ 129
           L K +L +++ +++            E++ +      + +K++      +E+        
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVL------- 226

Query: 130 NPGTVATINGQGTVFIYS---RSEGLQS--------------TLKFHEE-NGYALSFSPL 171
                AT++  G V+IY    +S+   +              T+K H    GY L +SPL
Sbjct: 227 ----TATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPL 282

Query: 172 VE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED 230
           ++ G LLSG D      +     S      + ++  ++  + D +W      +F T   D
Sbjct: 283 IKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCD 341

Query: 231 SLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK--- 285
             ++I D R +               N +++S     LLA+   +    ++DLR      
Sbjct: 342 GYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 286 ----EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQ 332
               +P+     H+ A+T++ F+P            N + +WDL         KQ  AE 
Sbjct: 402 ADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 333 TPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
              + ++  P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 462 --KELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 75/155 (48%), Gaps = 13/155 (8%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ +     +L S S DHTV LWD+N    +    R+  ++HS+  V+ S+WH
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWDLN----TATAARSLINIHSNTNVSASQWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGT----AKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS   ++D+R+EN    +        E    + F+    N+      +
Sbjct: 343 PSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFA--DENIFICGTDN 400

Query: 274 SHVYLYDLRNMKE--PLHHMSGHEDAVTNLEFSPH 306
            +VY +D+RN  E  P+  +  H+  V+++E + H
Sbjct: 401 GNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRH 435

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 90/420 (21%), Positives = 161/420 (38%), Gaps = 85/420 (20%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEINL 80
           P +Y+ +    + WP +T+  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 81  PKEILNNE---------------DPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRAR 125
             + L  E               DP  E  E+ ++     R  +   A   + +EI    
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIE-NENIQLRDTTNRLKVSPFASSSNSQEIL--- 237

Query: 126 YMPQNPGTVATINGQGTVFIYSRSEGLQS-----------------TLKFHEE-NGYALS 167
                    AT++  G V+I+  +  +++                 T+K H    GYAL 
Sbjct: 238 --------TATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALD 289

Query: 168 FSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTW-SD------LHSDIVNDSKWHNF 219
           +SPL++ G LL+G     V L        + R    W SD       ++  V D +W   
Sbjct: 290 WSPLIKTGALLTGDCSGQVYL--------TQRHTSKWISDKEPFTVANNQSVEDIQWSRT 341

Query: 220 NKDLFGTVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
              +F +   D  +++ D R +               N +++S     LLA+   +    
Sbjct: 342 ESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWG 401

Query: 278 LYDLR-------NMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL----- 325
           ++DLR       N   P+     H+ A+T++ F+P            N + +WDL     
Sbjct: 402 VWDLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEAD 461

Query: 326 ----KQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
               KQ  AE    + +   P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 462 DEEIKQQAAET--KELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 79/157 (50%), Gaps = 15/157 (9%)

Query: 153 QSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-V 211
           Q     H +   +LS +     +L S S DHTV LWD+N    S    R+ + +H++  V
Sbjct: 282 QHITSHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLN----SGNAARSMASIHNNKNV 337

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDLRVEN----TTTGTAKCPEPFNTLAFSHHSSNLL 267
           + S+WH+ N  +  T   DS + + D+R+ N    +   +    E   T+ F+  +   +
Sbjct: 338 SSSQWHHGNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFADEN---I 394

Query: 268 AAAGTDS-HVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
             AGTDS ++Y +D+RN    +P+  +  H+  +++L
Sbjct: 395 ILAGTDSGNIYSFDIRNNAGSKPVWTLKAHDAGISSL 431

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 79/155 (50%), Gaps = 15/155 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +LS S     +L S S DHTV LWD+N         R+++ +HS+  V+ S+WH
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAGI----AARSFASIHSNKNVSSSQWH 329

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
           + +  +  T   DS + + D+R+ + +      +    E    + F+  ++ +    GTD
Sbjct: 330 STSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGEEVECVQFADENTIM---CGTD 386

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSP 305
           S +VY YD+R  +  +PL  ++ H+  ++ L  +P
Sbjct: 387 SGNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNP 421

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 96/404 (23%), Positives = 166/404 (41%), Gaps = 56/404 (13%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  LPKEILNNEDPQEEAGEDDEVSAPAPRS-NIKITAKYKHEEEITRARYMP----QNPGTV 134
           L K +L +E+ +E+  EDD+   P   + NI +       +   R +  P          
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPL------RDTTNRLKVSPFAVSNQEVLT 227

Query: 135 ATINGQGTVFIYS---RSEGLQS--------------TLKFHEE-NGYALSFSPLVE-GL 175
           AT++  G V+IY    +S+   +              T+K H    GY L +SPL++ G 
Sbjct: 228 ATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGS 287

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           LLSG D      +     S      + ++  ++  + D +W      +F T   D  ++I
Sbjct: 288 LLSG-DCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAGCDGYIRI 346

Query: 236 NDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK-------E 286
            D R +               N +++S     LLA+   +    ++DLR          +
Sbjct: 347 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQ 406

Query: 287 PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDA 337
           P+     H+ A+T++ F+P            N + +WDL         KQ  AE    + 
Sbjct: 407 PVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETK--EL 464

Query: 338 EDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           ++  P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 465 QEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 85/156 (54%), Gaps = 15/156 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +LS +     +L S S DHTV LWD+N N  + R I +   +H++  V+ S+WH
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLN-NGIAARSIAS---IHNNKNVSSSQWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
           + +  +  T   DS + ++D+R+ + +      +    E   ++ F+  S N++   GTD
Sbjct: 334 STDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVI-MCGTD 390

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSPH 306
           S +VY +D+RN +  +PL  +  H+  +++L+ + H
Sbjct: 391 SGNVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQH 426

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 90/431 (20%), Positives = 170/431 (39%), Gaps = 81/431 (18%)

Query: 6   KPLSVDE--EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGT 63
           KPL  DE  E D      P +Y+ +    + WP +T+  +P  +      +  Q L++ T
Sbjct: 115 KPLGPDEVLEAD------PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNY-PQSLLMAT 167

Query: 64  HTSGEEEN-----YLKFAEINLPKEILNNEDPQEEAG-----------EDDEVSAPAPRS 107
            T   ++N      LK ++  L K ++  ++ + E             E++ +S     +
Sbjct: 168 ATQASKKNQNELMVLKMSQ--LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTN 225

Query: 108 NIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQS------------- 154
            +K++      +E+             +T++  G V+I+  +  +++             
Sbjct: 226 RLKVSPFANAAQEVL-----------CSTMSENGEVYIFDLASQVKAFETPGYQIPKQAK 274

Query: 155 ----TLKFHEE-NGYALSFSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
               T++ H    GYA  +SP+++ G +LSG     V L   +  S      + ++  ++
Sbjct: 275 RPIHTVRNHGSVEGYANDWSPIIKTGAMLSGDCSGQVFLTQRH-TSKWITDKQAFTVANN 333

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNL 266
             + D +W      +F +   D  ++I D R +               N +++S     L
Sbjct: 334 KSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYL 393

Query: 267 LAAAGTDSHVYLYDLRNM-------KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
           LA+   D    ++DLR           P+     H+ A+T++ F+P            N 
Sbjct: 394 LASGDDDGTWGVWDLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNT 453

Query: 320 LIMWDL---------KQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVAS 370
           + +WDL         KQ  AE    + +   P+L+ VH   +  V D   + QIP  + S
Sbjct: 454 VTLWDLSVEADDEEIKQQAAE--TKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVS 509

Query: 371 TEEENILQVWK 381
           T  +  L VWK
Sbjct: 510 TGTDG-LNVWK 519

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 52/128 (40%), Gaps = 7/128 (5%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           L +S   S + A+ G D ++ ++D R+ K +P   +      V  + +S           
Sbjct: 339 LQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGD 398

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q     TP +A    P  +  +  HK A+     N     ++A   E+N
Sbjct: 399 DDGTWGVWDLRQF----TPQNASTASP--VAQYQFHKGAITSISFNPLDESIIAVASEDN 452

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 453 TVTLWDLS 460

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 93/408 (22%), Positives = 157/408 (38%), Gaps = 62/408 (15%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEINL 80
           P +Y+ +    L WP LT+  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 81  PKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMP----QNPGTVAT 136
             + L  +D   +  +DDE    A    ++        +   R R  P    Q     +T
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILE-NESLPLRDTTNRLRISPYATVQQEILTST 237

Query: 137 INGQGTVFIYS--------RSEGLQ---------STLKFHEE-NGYALSFSPLVE-GLLL 177
           ++  G VFIY          + G Q          T++ H    GY L +SPL++ G LL
Sbjct: 238 MSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALL 297

Query: 178 SGSDDHTVALWDVNGNSDSTRPIRTW-------SDLHSDIVNDSKWHNFNKDLFGTVSED 230
           +G     V L        + R    W       +  ++  + D +W      +F T   D
Sbjct: 298 TGDCSGMVYL--------TQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCD 349

Query: 231 SLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE-- 286
             ++I D R +       T       N ++++     LLA+        ++DLR      
Sbjct: 350 GYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNS 409

Query: 287 ----PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQT 333
               P+     H+ A+T++ F+P            N + +WDL         KQ  AE  
Sbjct: 410 EKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAE-- 467

Query: 334 PDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
             + E   P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 468 IKELEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S   S + A AG D ++ ++D R+ K +P+         V  + ++           
Sbjct: 333 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGD 392

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q        ++E  +P  +  +  HK A+     N     +VA   E+N
Sbjct: 393 DKGTWGIWDLRQFSP-----NSEKALP--VAQYDFHKGAITSISFNPLDESIVAVASEDN 445

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 446 TVTLWDLS 453

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +++ +     +L S S DHTV LWD+N    S    R+ + +HS+  V+ S+WH
Sbjct: 289 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLN----SGNAARSLASIHSNKNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + + D+R+ + +      +    E   T+ F++ +   +   GTD
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFANEN---IILCGTD 401

Query: 274 S-HVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
           S +VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 402 SGNVYSFDIRNNENRKPVWTLKAHDAGISTL 432

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 79/151 (52%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ +     +L S S DHTV LWD+N    S    R+ + +HS   V+ S+WH
Sbjct: 271 HTDAVLSLTHNKQFRSVLASTSADHTVKLWDLN----SATAARSMASIHSGKNVSSSEWH 326

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGT---AKCP-EPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + ++D+R+ + T  +   +  P E   T+ F+  +   +   GTD
Sbjct: 327 TTNGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADEN---IMLCGTD 383

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           S ++Y +D+RN +  +P+  +  H+  +++L
Sbjct: 384 SGNIYSFDIRNNENSKPVWTLKAHDAGISSL 414

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 81/199 (40%), Gaps = 27/199 (13%)

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+   LL+S S D T  +WD+     S+  +RT    H   V D K+   +  LF
Sbjct: 227 SFHWNPIDTNLLISSSIDTTCIVWDL----QSSNYVRTQLIAHDSEVFDVKFLAHSTQLF 282

Query: 225 GTVSEDSLLKINDLRV----------------ENTTTGTAKCPEPFNTLAFSHHSSNLLA 268
            +   D  +++ DLR                  +T T   K P     L  S    N++A
Sbjct: 283 ASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMA 342

Query: 269 AAGTDSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ 327
               DS  + + D+RN   P+  + GH  AV  +++ P             +++ WDL +
Sbjct: 343 TFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

Query: 328 ------IGAEQTPDDAEDG 340
                 + A +   +A DG
Sbjct: 403 WLSPTSLSANENKVNANDG 421

>Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWHNFNKDLFGTVSEDSLL 233
           +L S S DHTV LWD+N  S      R+   +HS+  V+ S+WH  N  +  T   DS +
Sbjct: 305 VLASTSADHTVKLWDLNSGS----AARSLDSIHSNKNVSSSEWHMLNGSVLLTGGYDSRV 360

Query: 234 KINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTDS-HVYLYDLRN--MKE 286
            + D+R+ + +      +    E   T+ F+  +   +   GTDS +VY +D+RN   ++
Sbjct: 361 ALTDVRISDESQMSKHWSVMSGEEIETVTFADEN---IILCGTDSGNVYSFDIRNNESRK 417

Query: 287 PLHHMSGHEDAVTNL 301
           P+  +  H+  ++ L
Sbjct: 418 PVWTLKAHDAGISTL 432

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 97/242 (40%), Gaps = 34/242 (14%)

Query: 163 GYALSFSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
           GYAL +SPL+  G LL+G D      +     S      + ++  ++  + D +W     
Sbjct: 281 GYALDWSPLIRSGALLTG-DCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 222 DLFGTVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLY 279
            +F T   D  +++ D R +       T       N ++++     LLA+   +    ++
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVW 399

Query: 280 DLRNMK------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL-------- 325
           DLR         +P+     H+ A+T++ F P            N + +WDL        
Sbjct: 400 DLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEE 459

Query: 326 -KQIGAE-----QTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQV 379
            KQ  AE     Q P       P+L+ VH   +  V D   + QIP  + ST  +  L +
Sbjct: 460 IKQQTAETKELAQIP-------PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNI 509

Query: 380 WK 381
           WK
Sbjct: 510 WK 511

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           FH+    ++SF P  E ++   S+D+TV LWD++  +D
Sbjct: 419 FHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEAD 456

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 49/128 (38%), Gaps = 8/128 (6%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S   + + A AG D ++ ++D R+ K +P          V  + ++           
Sbjct: 332 IQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGD 391

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q          E+  P  +  +  HK A+     +     +VA   E+N
Sbjct: 392 DNGTWGVWDLRQFSPSN-----ENAQP--VAQYDFHKGAITSISFHPTDESIVAVASEDN 444

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 445 TVTLWDLS 452

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 15/181 (8%)

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+   LL+S S D T  +WD+     S+  ++T    H   V D ++   +  LF
Sbjct: 237 SFHWNPIDTNLLISSSIDTTCIVWDLQ----SSNYVKTQLIAHDSEVYDVRFLTQSTQLF 292

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKCP--------EPFNTLAF--SHHSSNLLAAAGTDS 274
            +   D  +++ DLR    +T   + P          F  L    S H  N++A    DS
Sbjct: 293 ASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADS 352

Query: 275 H-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQT 333
           + + + D+RN + PL  + GH  +V  +++ P             +++ WDL +  A   
Sbjct: 353 NKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSD 412

Query: 334 P 334
           P
Sbjct: 413 P 413

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 3/88 (3%)

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKF---HEENGYALSFSPLVEGLLL 177
           + R    P +P  +AT        +       +S L     H  +   + + P+   +LL
Sbjct: 332 LLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLL 391

Query: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSD 205
           SG DD  V  WD+N  + S+ P+ T  D
Sbjct: 392 SGGDDCQVLYWDLNKCTASSDPVATTKD 419

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/414 (21%), Positives = 166/414 (40%), Gaps = 72/414 (17%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHT--SGEEENYLKFAEI- 78
           P +Y+ +    + WP +T+  +P  +      +  Q L++ T T  S ++EN L    + 
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNY-PQSLLMATATQASRKKENELMVLSLS 170

Query: 79  NLPKEILNNEDPQEEAG--------------EDDEVSAPAPRSNIKITAKYKHEEEITRA 124
           NL K ++ +++ +EE                E++ +      + +KI+     +EE+   
Sbjct: 171 NLVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVL-- 228

Query: 125 RYMPQNPGTVATINGQGTVFIYS---RSEGLQS--------------TLKFHEE-NGYAL 166
                     AT++  G V+I+    +S+   +              T+K H    GYAL
Sbjct: 229 ---------AATMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYAL 279

Query: 167 SFSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFG 225
            +SPL + G LL+G D      +     S      + ++  ++  + D +W      +F 
Sbjct: 280 DWSPLTKTGALLTG-DCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFA 338

Query: 226 TVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRN 283
           +   D  ++I D R +               N +++S     LLA+   +    ++DLR 
Sbjct: 339 SAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQ 398

Query: 284 MK-------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQ 327
                    +P+     H+ A+T++ F+P            N + +WDL         KQ
Sbjct: 399 FSPENAGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQ 458

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
             AE    + +   P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 459 QAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 55/128 (42%), Gaps = 7/128 (5%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S   S + A+AG D ++ ++D R+ K +P   +      V  + +S           
Sbjct: 327 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGD 386

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q     +P++A  G  + +  +  HK A+     N     ++A   E+N
Sbjct: 387 DNGTWGVWDLRQF----SPENA--GSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDN 440

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 441 TVTLWDLS 448

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/411 (21%), Positives = 170/411 (41%), Gaps = 70/411 (17%)

Query: 24  MYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEIN-LP 81
           +Y+ +    L+WP +++  +P  +      + +  L+   T  S +++N L   +++ L 
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 82  KEILNNEDPQEEAG--------------EDDEVSAPAPRSNIKIT--AKYKHEEEITRAR 125
           K +L  +D   +                ED  V+     + +K+T  A   ++E +T   
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILT--- 245

Query: 126 YMPQNPGTVATINGQGTVFIYSRSEGLQS-----------------TLKFHEE-NGYALS 167
                    AT++  G V+I+     ++S                 T++ H    G+ L 
Sbjct: 246 ---------ATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLD 296

Query: 168 FSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           +SPL++ G LL+G     + L   + +   T   +++S  ++  + D +W    + +F T
Sbjct: 297 WSPLIKSGALLTGDCSGEIFLTSRHTSKWITEK-QSFSVGNNKSIEDIQWSKTEQTVFAT 355

Query: 227 VSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY-LYDLRN 283
              D  ++I D R +       T       N ++++     LLA+ G D  V+ ++DLR 
Sbjct: 356 AGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLAS-GDDKGVWGVWDLRQ 414

Query: 284 MK------EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-----AEQ 332
                    P+     H+ A+T++ F+P            N + +WDL          +Q
Sbjct: 415 FSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQ 474

Query: 333 TPD--DAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           T +  + E   P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 475 THETKELEQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 522

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 48/128 (37%), Gaps = 8/128 (6%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S     + A AG D ++ ++D R+ K +P          V  + ++           
Sbjct: 343 IQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGD 402

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q    Q     E+  P  +  +  HK A+     N      VA   E+N
Sbjct: 403 DKGVWGVWDLRQFSPSQ-----ENASP--VAQYDFHKGAITSISFNPLDESTVAVASEDN 455

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 456 TVTLWDLS 463

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +++ +     +L S S DHTV LWD+N    S    R+ + +HS+  V+ S+WH
Sbjct: 285 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLN----SGNAARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + + D+R+ + +      +    E   T  F+  S N++   GTD
Sbjct: 341 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFA--SENII-LCGTD 397

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           S +VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 398 SGNVYSFDIRNSENCKPVWTLKAHDAGISTL 428

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 91/406 (22%), Positives = 165/406 (40%), Gaps = 58/406 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP +T+  +P  +      + +  L+   T  S ++EN L    ++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 80  LPKEILNNEDPQEEAGEDDEVSAPAP---RSNIKITAKYKHEEEITRARYMP----QNPG 132
           L K ++ +E+ ++E  + DE     P     NIK+       +   R +  P        
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLN------DTTNRLKVSPFASTDKEV 233

Query: 133 TVATINGQGTVFIYS---RSEGLQS--------------TLKFHEE-NGYALSFSPLVE- 173
             AT++  G V+I+    +S+   +              T++ H    GYAL +SP+++ 
Sbjct: 234 LTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKN 293

Query: 174 GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           G LL+G D      +     S      + ++  ++  V D +W      +F +   D  +
Sbjct: 294 GALLTG-DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYI 352

Query: 234 KINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR-------NM 284
           +I D R +               N +++S     LLA+   +    ++DLR       N 
Sbjct: 353 RIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNIND 412

Query: 285 KEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPD 335
            +P+     H+ A+T++ F+P            N + +WDL         KQ  AE    
Sbjct: 413 VQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETK-- 470

Query: 336 DAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           + E   P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 471 ELEKIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 77/345 (22%), Positives = 122/345 (35%), Gaps = 76/345 (22%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P+             L I +    EEE        NL +
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFC--EEER-------NLQE 200

Query: 83  EILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGT 142
           +I                       N+ +    K ++  +R        G++ T   Q  
Sbjct: 201 QI-----------------------NLSLCKYDKQQQGASRVNAAAGGSGSIRTNPQQQQ 237

Query: 143 VFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRT 202
             I      L     FH        ++P+   LL+S S D T  +WD+     S+  +RT
Sbjct: 238 GLIGE----LPPITSFH--------WNPVDPNLLISSSIDTTCIVWDL----QSSNYVRT 281

Query: 203 WSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE---------- 252
               H   V D ++      LF +   D  +++ DLR    +T   + P           
Sbjct: 282 QLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTA 341

Query: 253 -------------PFNTLAFSHHSSNLLAAAGTDS-HVYLYDLRNMKEPLHHMSGHEDAV 298
                        P   L  S    N++A    DS  V + D+RN   P+  + GH  AV
Sbjct: 342 AGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAV 401

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWDLKQ--IG--AEQTPDDAED 339
             + + P             +++ WDL    +G   +Q PD A D
Sbjct: 402 NQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 91/407 (22%), Positives = 157/407 (38%), Gaps = 61/407 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGEEEN-----YLKFA 76
           P +Y+ +    L WP L++  +P  +      +  Q L++ T T   ++       LK +
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNY-PQSLLLTTATQASKKKDNELLLLKMS 185

Query: 77  EIN--LPKE-----------------ILNNED-PQEEAGEDDEVSAPAPRSNIKITAKYK 116
           ++   L KE                 I+ NE+ P  +     +VS  A  S  K+TA   
Sbjct: 186 QLTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMS 245

Query: 117 HEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVE-GL 175
              E+      PQ  G        G     +  + + +        GYAL +SPL + G 
Sbjct: 246 ENGEVYIFDLGPQVKG----FETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGS 301

Query: 176 LLSGSDDHTVALWDVNGN---SDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           LL+G     V L   + +   +D T     +S  ++  + D ++      +F T   D  
Sbjct: 302 LLTGDCSGRVYLTQRHTSKWITDKT----AFSAGNNQSIEDIQFSRTEATVFATCGCDGY 357

Query: 233 LKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK----- 285
           ++I D R +               N ++++     LLA+   +    ++DLR        
Sbjct: 358 IRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAA 417

Query: 286 --EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTP 334
              P+   S H+ A+T++ F+P            N + +WDL         KQ  AE   
Sbjct: 418 SVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK- 476

Query: 335 DDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
            + +   P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 477 -ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/145 (19%), Positives = 59/145 (40%), Gaps = 7/145 (4%)

Query: 240 VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAV 298
           + + T  +A   +    + FS   + + A  G D ++ ++D R+ K +P   +      V
Sbjct: 322 ITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDV 381

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDF 358
             + ++                 +WDL+Q     +P++A    P  +  ++ HK A+   
Sbjct: 382 NVISWNEKIGYLLASGDDNGTWGVWDLRQF----SPNNAASVSP--VAQYSFHKGAITSI 435

Query: 359 DLNAQIPWLVASTEEENILQVWKCS 383
             N     ++A   E+N + +W  S
Sbjct: 436 AFNPLDDSIIAVASEDNTVTLWDLS 460

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 79/409 (19%), Positives = 155/409 (37%), Gaps = 63/409 (15%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    + WP +T+  +P  +      + +  L+   T  + +++N L   +++ 
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 80  LPKEILNNEDPQEEAG-------------EDDEVSAPAPRSNIKITAKYKHEEEITRARY 126
           L K ++ ++  + +               E++ ++     + +K++    H +E+  A  
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 127 MPQNPGTVATINGQGTVF------IYSRSEGLQSTLKFHEE-NGYALSFSPLVE-GLLLS 178
                  V  +  Q   F      +   S     T++ H    GY L +SPL++ G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 179 GSDDHTVALWDVNGNSDSTRPIRTW-------SDLHSDIVNDSKWHNFNKDLFGTVSEDS 231
           G     + L        + R    W       +  ++  V D +W      +F T   D 
Sbjct: 298 GDCSGQIFL--------TQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDG 349

Query: 232 LLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK---- 285
            ++I D R +       T       N ++++     LLA+   +    ++DLR       
Sbjct: 350 YVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANS 409

Query: 286 ---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGV- 341
              +P+     H   +T++ F+P            N + +WDL     E   D+ +    
Sbjct: 410 EGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL---SVEADDDEIQQQTK 466

Query: 342 ---------PELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
                    P+L+ VH   +  V D   + QIP  + ST  +  L VWK
Sbjct: 467 EYKELQKIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/403 (21%), Positives = 161/403 (39%), Gaps = 50/403 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEI-N 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T  S ++EN L    + N
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 80  LPKEILNNEDPQEEAG--------------EDDEVSAPAPRSNIKITAKYKHEEEITRAR 125
           L K ++N +   +E                E++ +      + +K++      +E+  A 
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 126 YMPQNPGTVATINGQGTVF------IYSRSEGLQSTLKFHEE-NGYALSFSPLVE-GLLL 177
                   +  +  Q   F      I   ++    T+K H    GYAL +SP ++ G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 178 SGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
           +G D      +     S      + ++  ++  + D +W      +F +   D  ++I D
Sbjct: 293 TG-DCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWD 351

Query: 238 LRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY-LYDLR-------NMKEP 287
            R +               N +++S     LLA+ G D+ V+ ++DLR       N  +P
Sbjct: 352 TRSKKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSPDTANSVQP 410

Query: 288 LHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAE 338
           +     H+ A+T++ F+P            N + +WDL         KQ  AE    + +
Sbjct: 411 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETK--ELQ 468

Query: 339 DGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
              P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 469 QIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWK 508

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 52/128 (40%), Gaps = 7/128 (5%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S     + A+AG D ++ ++D R+ K +P   +      V  + +S           
Sbjct: 328 IQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGD 387

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q     +PD A    P  +  +  HK A+     N     +VA   E+N
Sbjct: 388 DNGVWGVWDLRQF----SPDTANSVQP--VAQYDFHKGAITSISFNPLDESIVAVASEDN 441

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 442 TVTLWDLS 449

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ +     +L S S DHTV LWD+N    +    R+ +++HS+  V+ S+WH
Sbjct: 289 HTDAVLSLAHNRQFRTVLASTSADHTVKLWDLN----NATAARSMANIHSNKNVSSSQWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGT---AKCP-EPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS   + D+R+ +    +   +  P E   T  F+  S N++      
Sbjct: 345 MQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFA--SENIILCGTDA 402

Query: 274 SHVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
            +VY +D+RN +  +P+  +  H+  +++L
Sbjct: 403 GNVYSFDIRNNEGSKPVWTLKAHDAGISSL 432

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 110/259 (42%), Gaps = 48/259 (18%)

Query: 134 VATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           +A+ +  GT+ I+  +  +   TL  H  +   + +    EGLL SGS D TV +WD+N 
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVWDMNS 310

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDL---RVENTTTGTAK 249
                    T     S + N + W N       ++S D  L+I       V+ +T   AK
Sbjct: 311 A--------TVGKCISILKNHAHWVNHL-----SLSTDYALRIGPFDHTGVKPSTPAEAK 357

Query: 250 --CPEPFNTLAFSHHSSN-LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
                 ++ +A  + S+  L+  A  D  ++L++ + + +PL  M+GH+  V ++ FSP 
Sbjct: 358 RRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPD 417

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
                      N + +W            D  DG  + +    GH ++V       Q+ W
Sbjct: 418 -GRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASV------YQVAW 456

Query: 367 -----LVASTEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 457 SSDCRLLVSCSKDTTLKVW 475

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 80/159 (50%), Gaps = 15/159 (9%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VND 213
            L  H +   +L+ S     +L S S DHTV LWD+N         R+ + +HS+  V+ 
Sbjct: 288 VLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLN----EGIAARSVASIHSNKNVSS 343

Query: 214 SKWHNFNKDLFGTVSEDSLLKINDLRV----ENTTTGTAKCPEPFNTLAFSHHSSNLLAA 269
           S+WH+ +  +  T   DS + ++D+R+    + +   +    E    + F+  ++ +   
Sbjct: 344 SQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTFM--- 400

Query: 270 AGTDS-HVYLYDLRNMK--EPLHHMSGHEDAVTNLEFSP 305
            GTDS +VY +D+R  +  +PL  ++ H+  ++ L  +P
Sbjct: 401 CGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNP 439

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 76/148 (51%), Gaps = 9/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ +     +L S S DHTV LWD+N  + +    R+ + +HS   V+ S+WH
Sbjct: 287 HTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAA----RSLASIHSGKNVSSSEWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAK-CPEPFNTLAFSHHSSNLLAAAGTDS-H 275
             N  +  T   DS + ++D+R+ + +  +      P   +  S  +   +  +GTDS +
Sbjct: 343 KTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGN 402

Query: 276 VYLYDLRN--MKEPLHHMSGHEDAVTNL 301
           VY +D+RN    +P+  ++ H+  ++ L
Sbjct: 403 VYAFDIRNNSGSKPVWTLNAHDAGISCL 430

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 76/151 (50%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +LS +     +L S S DHTV LWD+N    + +  R+ + +HS   V+ S+WH
Sbjct: 290 HTDAILSLSHNKQFRAVLASTSADHTVKLWDLN----NGQTARSLASVHSGKNVSASEWH 345

Query: 218 NFNKDLFGTVSEDSLLKINDLRVEN----TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + ++D+R+ N    +   +    E      F++ +   +   GTD
Sbjct: 346 PTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIECTTFANEN---IILCGTD 402

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           S ++Y +D+RN +  +P+  +  H+  ++ L
Sbjct: 403 SGNIYSFDIRNNENSKPVWTLKAHDAGISTL 433

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 87/406 (21%), Positives = 158/406 (38%), Gaps = 59/406 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELII-GTHTSGEEENYLKFAEIN- 79
           P +Y+ +    L WP L++  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 80  LPKE---------------------ILNNED-PQEEAGEDDEVSAPAPRSNIKITAKYKH 117
           L K                      I+ NE+ P ++     +VS  A  S  K+TA    
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 118 EEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVE-GLL 176
             E+      PQ    V      G     +  + + +        GYAL +SPL + G L
Sbjct: 246 NGEVYIFDLGPQ----VKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSL 301

Query: 177 LSGSDDHTVALWDVNGN---SDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           L+G     V L   + +   +D T     +S  ++  + D ++      +F +   D  +
Sbjct: 302 LTGDCSGRVYLTQRHTSKWITDKT----AFSAGNNQSIEDIQFSRTEATVFASCGCDGYI 357

Query: 234 KINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK------ 285
           +I D R +               N ++++     LLA+   +    ++DLR         
Sbjct: 358 RIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAAS 417

Query: 286 -EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPD 335
             P+   + H+ A+T++ F+P            N + +WDL         KQ  AE    
Sbjct: 418 TSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETR-- 475

Query: 336 DAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
           + ++  P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 476 ELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 113/285 (39%), Gaps = 62/285 (21%)

Query: 117 HEEEITRARYMP---QNPGT---VATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFS 169
           H + IT   + P     PG+   +A+ +  GT+ I+ + S   Q T+  H  +   + + 
Sbjct: 228 HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG 287

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              +GLL SGS D TV +WD+N        +++    H+  VN             ++S 
Sbjct: 288 G--QGLLYSGSHDRTVRVWDINSQGRCINILKS----HAHWVNHL-----------SLST 330

Query: 230 DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHH---------SSNLLAAAGTDSHVYLYD 280
           D  L+I      + T      PE     A  ++         S  ++  A  D  ++L++
Sbjct: 331 DYALRIGAF---DHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWN 387

Query: 281 LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDG 340
                +P+  M+GH+  V ++ FSP            N + +W            D  DG
Sbjct: 388 PLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG 434

Query: 341 VPELIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
             + I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 435 --KFISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 86/235 (36%), Gaps = 33/235 (14%)

Query: 90  PQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNPGTVATINGQGT 142
           P   + ED       PR+  K+       +A   H   I  + + P     + T  G  T
Sbjct: 108 PGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIR 201
             I+   ++    TLK H      +S+SP  E ++ +GS D+T+ LWD          +R
Sbjct: 168 ARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGE-VIATGSMDNTIRLWDPKSGQCLGDALR 226

Query: 202 TWSDLHSDIVNDSKWHNF------NKDLFGTVSEDSLLKINDL--RVENTT----TGTAK 249
                HS  +    W         +K    + S+D  +KI D   RV   T    T +  
Sbjct: 227 G----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVS 282

Query: 250 CPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           C               LL +   D  V ++D+ +    ++ +  H   V +L  S
Sbjct: 283 C--------VKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLS 329

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 79/151 (52%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSD-IVNDSKWH 217
           H +   +LS +     +L S S D T+ LWD+N  +     +R+ + +H+   V+ S+WH
Sbjct: 309 HTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGT----AVRSIASIHNGTTVSSSQWH 364

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             +  +  T + DS + ++D+R+ N +      +    E    ++F + +  L   AGTD
Sbjct: 365 PSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEFL---AGTD 421

Query: 274 S-HVYLYDLRNMKE--PLHHMSGHEDAVTNL 301
           S ++Y +DLRN ++  PL  +  H+  ++++
Sbjct: 422 SGNIYSFDLRNGEKSSPLWTLKAHDSGISSM 452

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 76/151 (50%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ +     +L S S DHTV LWD+N    S    R+ + +HS+  V+ S+WH
Sbjct: 285 HTDAVLSLAHNKHFRSVLASTSADHTVKLWDLN----SGTAARSIASIHSNKNVSASEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             +  +  T   DS L + D+R+ + +      +    E      F+  S NL+   GTD
Sbjct: 341 MSHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFA--SENLI-LCGTD 397

Query: 274 S-HVYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           S +VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 398 SGNVYSFDIRNNEGSKPVWTLKAHDAGISTL 428

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +L+ + L   +L S S DHTV LWD+N  S     +R++  +HS   V+ S+WH
Sbjct: 278 HTDAVLSLAHNKLFRSVLASTSADHTVKLWDLNNAS----VVRSFDSIHSGKNVSASEWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTT----GTAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + + D+R  +        +    E   +  F   +   +   GTD
Sbjct: 334 QSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDEN---IILCGTD 390

Query: 274 S-HVYLYDLRNMKE--PLHHMSGHEDAVTNL 301
           + +VY +D+RN  E   +  +  H+  ++ L
Sbjct: 391 TGNVYSFDIRNNAESKSVWTLKAHDSGISAL 421

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 47/110 (42%), Gaps = 11/110 (10%)

Query: 94  AGEDDEVSAPAPRSN-IKITAKY---KHEEEITRARYMPQNPGTVATINGQGTVFIYSRS 149
           AG D  ++    RSN  K  +KY      EEI  A ++ +N     T  G    F    +
Sbjct: 343 AGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDENIILCGTDTGNVYSFDIRNN 402

Query: 150 EGLQS--TLKFHEENGYALSFSPLVEGLLLSGS-DDHTVALW----DVNG 192
              +S  TLK H+    AL+ +  V GLL +G+  D     W    D NG
Sbjct: 403 AESKSVWTLKAHDSGISALAVNKFVPGLLTTGAMGDKVAKTWKFPTDTNG 452

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 114/282 (40%), Gaps = 56/282 (19%)

Query: 117 HEEEITRARYMP---QNPGT---VATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFS 169
           H + IT   + P     PG+   +A+ +  GT+ I+ S +   Q TL  H  +   + + 
Sbjct: 228 HSKWITCLSWEPIHLVKPGSKPRLASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWG 287

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              +GLL SGS D TV +WD+N        +++    H+  VN             ++S 
Sbjct: 288 G--QGLLYSGSHDRTVRVWDMNSQGRCINILKS----HAHWVNHL-----------SLST 330

Query: 230 DSLLKINDLRVENTTTGTA-----KCPEPFNTLAFSHHSS-NLLAAAGTDSHVYLYDLRN 283
           D  L++           T+     K  E +  +   + SS  ++  A  D  ++L++   
Sbjct: 331 DYALRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLK 390

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +P+  M+GH+  V ++ FSP            N + +W            D  DG  +
Sbjct: 391 STKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--K 435

Query: 344 LIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 100/267 (37%), Gaps = 51/267 (19%)

Query: 85  LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVF 144
           L N+  Q  AGE  E   P+ R  + +TA+               +PG      G+   F
Sbjct: 84  LVNKRIQFAAGESKESVNPSSR-RVHVTAR---------------SPG------GKAPRF 121

Query: 145 IYSRSEGLQSTLKFHEENGYALSFSPLV-----EGLLLSGSDDHTVALWDVNGNSDSTRP 199
           + S       +L+   E  +A S + +       GL  +GS+DH V +WD N        
Sbjct: 122 LTSVESRPPDSLQGPREASHAFSVTSVKWYGPDNGLFFTGSNDHKVKIWDTN-------T 174

Query: 200 IRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFN 255
            +  S +  DI +     +   DL    SEDS  ++ DLR  +         +      N
Sbjct: 175 FQVASSI--DIAHRVAQLDTLGDLLAVASEDSHPRLIDLRSMSAAISLGVKRSDMRHGIN 232

Query: 256 TLAFSHHSSN----LLAAAGTDSHVYLYDLRNMKEPLHHMS-------GHEDAVTNLEFS 304
              FSH SS     LLA    D +V ++DLR     L  ++        H     +L + 
Sbjct: 233 AAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGNRWLCDLTEADTLSKSHARCCNDLCWD 292

Query: 305 PHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           P             +  MWDL + GA+
Sbjct: 293 PSGSLKLVTTGNDGKCKMWDLHEGGAK 319

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 114/285 (40%), Gaps = 62/285 (21%)

Query: 117 HEEEITRARYMP---QNPGT---VATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFS 169
           H + IT   + P     PG+   +A+ +  GT+ I+ + S   Q T+  H  +   + + 
Sbjct: 228 HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG 287

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              +GLL SGS D TV +WD+N        +++    H+  VN             ++S 
Sbjct: 288 G--QGLLYSGSHDRTVRVWDMNSQGRCINILKS----HAHWVNHL-----------SLST 330

Query: 230 DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHH---------SSNLLAAAGTDSHVYLYD 280
           D  L++      + T      PE     A +++         S  ++  A  D  ++L++
Sbjct: 331 DYALRVGAF---DHTGQKPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWN 387

Query: 281 LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDG 340
                +P+  M+GH+  V ++ FSP            N + +W            D  DG
Sbjct: 388 PLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG 434

Query: 341 VPELIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
             + I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 435 --KFISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 86/235 (36%), Gaps = 33/235 (14%)

Query: 90  PQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNPGTVATINGQGT 142
           P   + ED       PR+  K+       +A   H   I  + + P     + T  G  T
Sbjct: 108 PGHNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIR 201
             I+   ++    TLK H      +++SP  E ++ +GS D+T+ LWD          +R
Sbjct: 168 ARIWDCDTQTPMHTLKGHFNWVLCVAWSPDGE-VIATGSMDNTIRLWDPKTGECLGDALR 226

Query: 202 TWSDLHSDIVNDSKWHNF------NKDLFGTVSEDSLLKINDL--RVENTT----TGTAK 249
                HS  +    W         +K    + S+D  +KI D   RV   T    T +  
Sbjct: 227 G----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVS 282

Query: 250 CPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           C               LL +   D  V ++D+ +    ++ +  H   V +L  S
Sbjct: 283 C--------VKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLS 329

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 10/156 (6%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           LLSG  D+ V LWD+  N  S   +R     H+  V+  K H   + L  + S D    +
Sbjct: 230 LLSGGGDNLVKLWDMTSN--SFEELRG----HAGRVSRVKVHPSGR-LAASASFDLTWIL 282

Query: 236 NDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
            DL  +          +   T+AF    + LLA+AG D+   ++DLR+  EP+  + GH 
Sbjct: 283 WDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRS-GEPIMKLEGHA 340

Query: 296 DAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
            A++ +++SP+             + +WD++ +G E
Sbjct: 341 GAISGVDWSPNGYQLATAGADGT-VRVWDIRNVGTE 375

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 113/282 (40%), Gaps = 56/282 (19%)

Query: 117 HEEEITRARYMP---QNPGT---VATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFS 169
           H + IT   + P     PG+   +A+ +  GT+ I+ + S   Q T+  H  +   + + 
Sbjct: 228 HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG 287

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              +GLL SGS D TV +WD+N        +++    H+  VN             ++S 
Sbjct: 288 G--QGLLYSGSHDRTVRVWDINSQGRCINILKS----HAHWVNHL-----------SLST 330

Query: 230 DSLLKINDL-----RVENTTTGTAKCPEPFNTLAFSH-HSSNLLAAAGTDSHVYLYDLRN 283
           D  L++        R         K  E +  +   + +S  ++  A  D  ++L++   
Sbjct: 331 DYALRVGAFDHTGKRPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLK 390

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +P+  M+GH+  V ++ FSP            N + +W            D  DG  +
Sbjct: 391 STKPVARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--K 435

Query: 344 LIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 86/235 (36%), Gaps = 33/235 (14%)

Query: 90  PQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNPGTVATINGQGT 142
           P   + ED       PR+  K+       +A   H   I  + + P     + T  G  T
Sbjct: 108 PGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIR 201
             I+   ++    TLK H      +S+SP  E ++ +GS D+T+ LWD          +R
Sbjct: 168 ARIWDCDTQTPMHTLKGHYNWVLCVSWSPDGE-VIATGSMDNTIRLWDPKTGECLGDALR 226

Query: 202 TWSDLHSDIVNDSKWHNF------NKDLFGTVSEDSLLKINDL--RVENTT----TGTAK 249
                HS  +    W         +K    + S+D  +KI D   RV   T    T +  
Sbjct: 227 G----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVS 282

Query: 250 CPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           C               LL +   D  V ++D+ +    ++ +  H   V +L  S
Sbjct: 283 C--------VKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLS 329

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (47%), Gaps = 10/123 (8%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWD    S  +RPI   S   +D V+  K++    D+F +   D+ + + DLR   T 
Sbjct: 196 INLWD----STRSRPITNLS-WGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR---TN 247

Query: 245 TGTAKCPEPF--NTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
           + T K  +    N L ++   +     A  D + Y YD+RN+   LH    H  AV +++
Sbjct: 248 SPTQKFVQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVD 307

Query: 303 FSP 305
           FSP
Sbjct: 308 FSP 310

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 101/237 (42%), Gaps = 23/237 (9%)

Query: 163 GYALSFSPLVE-GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
           GY L +SPL++ G +L+G     V L     +   T   + ++  ++  + D +W     
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDK-QPFTVGNNKSIEDIQWSRAEM 345

Query: 222 DLFGTVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY-L 278
            +F T   D  ++I D R +               N ++++     LLA+ G DS  + +
Sbjct: 346 TVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLAS-GDDSGTWGV 404

Query: 279 YDLRNMKE-------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG-- 329
           +DLR           P+   + H+ A+T++ F+P            N + +WDL      
Sbjct: 405 WDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADD 464

Query: 330 ---AEQTPDDAE--DGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWK 381
               +QT + AE     P+L+ VH   +  V D   + QIP  + ST  +  L +WK
Sbjct: 465 EEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 52/128 (40%), Gaps = 7/128 (5%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMK-EPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           + +S     + A  G D H+ ++D R+ K +P   +   +  V  + ++           
Sbjct: 338 IQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGD 397

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEEN 375
                 +WDL+Q  A+ T    E   P  +  +  HK+A+     N     ++A   E+N
Sbjct: 398 DSGTWGVWDLRQFSAQNT----EKTTP--VAQYNFHKAAITSISFNPLDESIIAVASEDN 451

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 452 TVTLWDLS 459

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 26/38 (68%)

Query: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           FH+    ++SF+PL E ++   S+D+TV LWD++  +D
Sbjct: 426 FHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 463

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 75/151 (49%), Gaps = 15/151 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +LS +     +L S S DHTV +WD+N    S    R+ + +H++  V+ S+WH
Sbjct: 289 HTDAILSLSHNKHFRSVLASTSADHTVKIWDLN----SGDAARSLASIHNNTNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAGTD 273
             N  +  T   DS + ++D+R+ + +      +    E   T  F+  +   +   GTD
Sbjct: 345 WTNGSILLTSGYDSRVALSDVRISDESQMSKYWSVMGGEDIETATFADEN---IILCGTD 401

Query: 274 S-HVYLYDLRN--MKEPLHHMSGHEDAVTNL 301
           + +VY +D+RN    +P+  +  H+  ++ L
Sbjct: 402 AGNVYSFDVRNGDASKPVWTLKAHDAGISTL 432

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 74/171 (43%), Gaps = 24/171 (14%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           L++S S D T  +WD+     S+  ++T    H   V D ++   +  LF +   D  ++
Sbjct: 258 LIISSSIDTTCIVWDLQ----SSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 235 INDLR---------------VENTTTGT----AKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           + DLR               V   T GT    +K  +    L  S +  N+LA    DS+
Sbjct: 314 VFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSN 373

Query: 276 -VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
            + + D+RN + P+ ++ GH  +V  +++ P             +++ WDL
Sbjct: 374 KIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 72/157 (45%), Gaps = 12/157 (7%)

Query: 150 EGLQSTLKFHEENGY-ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
           EG+  T  FH E+ + +L         +  G+    + LWD N     ++PI   S   +
Sbjct: 163 EGIIKT--FHGEHAFQSLDHHRQKSNFVTGGAQ---IELWDTN----RSKPISNLS-WGA 212

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLA 268
           D +N  +++    D+  +   D+ + + DLR  + T    +     N++ ++   +    
Sbjct: 213 DNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT-NSICWNPVEAFNFV 271

Query: 269 AAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            A  D + Y YD+RNM + LH    H  AV +++FSP
Sbjct: 272 IANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFSP 308

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 75/148 (50%), Gaps = 9/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI-VNDSKWH 217
           H +   +LS +     +L S S DHTV LWD+N    +    R+ + +H++  V+ S+WH
Sbjct: 322 HTDAVLSLSHNKQFRAVLASTSADHTVKLWDLN----TATAARSLASIHNNKNVSSSEWH 377

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAK-CPEPFNTLAFSHHSSNLLAAAGTDS-H 275
             N  +  T   DS + ++D+R+ +    +      P   +  +  +   +   GTD+ +
Sbjct: 378 VSNGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGEEIECTTFADENIILCGTDAGN 437

Query: 276 VYLYDLRNMK--EPLHHMSGHEDAVTNL 301
           +Y +D+RN +  +P+  +  H+  +++L
Sbjct: 438 IYSFDIRNNENSKPVWTLKAHDAGISSL 465

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 74/150 (49%), Gaps = 14/150 (9%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDL-HSDIVNDSKWH 217
           H +   +L+ + L   +L S S D TV LWD+N    S    R+ + + H   V+ S+WH
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLN----SGTAARSLNQVHHGSRVSSSQWH 347

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGT----AKCPEPFNTLAFSHHSSNLLAAAGTD 273
             +  +  T   DS + + D+R+ +    +        E   T +F +  + L   AGTD
Sbjct: 348 QTDGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVL---AGTD 404

Query: 274 S-HVYLYDLRNMK-EPLHHMSGHEDAVTNL 301
           + +VY +D+R+++ +PL  +  H+  +  L
Sbjct: 405 NGNVYSFDVRSVESKPLWTLKAHDAGIAGL 434

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 10/123 (8%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLH--SDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242
           + LWD+N     ++P+   SDL   +D +N  K++  + ++ G+   D+ + + DLR  +
Sbjct: 198 INLWDIN----RSKPL---SDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNS 250

Query: 243 TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
            T    +     N++ ++   +     A  D + Y YD+RNM   L+    H  AV +++
Sbjct: 251 ATQKIVQTMR-VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 309

Query: 303 FSP 305
            SP
Sbjct: 310 ISP 312

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 74/165 (44%), Gaps = 16/165 (9%)

Query: 134 VATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLV---------EGLLLSGSDDH 183
           +A+ +G G +  +  S   Q ++ K H      L  +P V         +  +LS SDD 
Sbjct: 83  IASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSSSDDK 142

Query: 184 TVALWDVN----GNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT--VSEDSLLKIND 237
           TV LW VN     + D+ + I T + L      +  +   +     +  V+    + + D
Sbjct: 143 TVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPRINLWD 202

Query: 238 LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR 282
           +      +  +   +  NT+ F+ + +N+L +AG+D+ + LYDLR
Sbjct: 203 INRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLR 247

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 95/203 (46%), Gaps = 19/203 (9%)

Query: 141 GTVFIYSRSEG---LQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           GT+ +YS +E    + ST KF  H  +   + F+   + +L SG ++  + +WD+N  ++
Sbjct: 84  GTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTE 143

Query: 196 STR---PIRTWSDLHS-DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE------NTTT 245
           S     P+     + S D VN   W+     +F +    +   I DL+ +      + T+
Sbjct: 144 SPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTS 203

Query: 246 GTAKCPEPFNTLAF-SHHSSNLLAAAGTDS--HVYLYDLRNMKEPLHHMS-GHEDAVTNL 301
            ++   +  + + +   +S+ +  A G+D+   + ++DLRN   P+  ++ GH+  + +L
Sbjct: 204 PSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTLNQGHQKGILSL 263

Query: 302 EFSPHXXXXXXXXXXXNRLIMWD 324
           ++              N +++W+
Sbjct: 264 DWCDQDENLLLSSGRDNTVLLWN 286

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 30/176 (17%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI------------VNDSKWHNFNKD 222
           LL+SG+   TV   D N ++DS+  +  WS L +D              ND  W + N+ 
Sbjct: 22  LLVSGTVSGTV---DANFSTDSS--LELWSLLATDSEKPLASLQVDSKFNDLDWSHNNEI 76

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLY 279
           + G +   +L   +     +T + TAK         T+ F+    N+LA+ G +  ++++
Sbjct: 77  IAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIW 136

Query: 280 DLRNMKE---------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
           D+    E         P   MS   D V +L ++             N   +WDLK
Sbjct: 137 DMNKCTESPSTYTPLTPGQSMSS-VDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 84/213 (39%), Gaps = 40/213 (18%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           L++S S D T  +WD+     S+  ++T    H   V D ++   +  LF +   D  ++
Sbjct: 258 LIISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 235 INDLR---------------------VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTD 273
           + DLR                        TTT ++        L  S +  N+LA    D
Sbjct: 314 VFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAAD 373

Query: 274 SH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL------- 325
           S+ + + D+RN + P+  + GH  +V  +++ P             +++ WDL       
Sbjct: 374 SNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEI 433

Query: 326 -----KQIGAEQTPDDAEDGVPELIMVHAGHKS 353
                K  GA  TP +  DG  + +M   G  S
Sbjct: 434 NGGSVKSPGASGTPLEDTDG--DTVMADGGEGS 464

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 77/174 (44%), Gaps = 17/174 (9%)

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+   LL+S S D T  +WD+    +S+  ++T    H   V D ++   +  LF
Sbjct: 253 SFHWNPIDTNLLISSSIDTTCIIWDL----ESSNYVKTQLIAHDSEVFDVRFLTQSTQLF 308

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKCPEPFN------------TLAFSHHSSNLLAAAGT 272
            +   D  +++ DLR    +T   + P   +             L  S H  N++A    
Sbjct: 309 ASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAA 368

Query: 273 DSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           DS+ + + D+RN + P+  + GH  ++  +++ P             +++ WDL
Sbjct: 369 DSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 3/75 (4%)

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQS---TLKFHEENGYALSFSPLVEGLLL 177
           + R    P +P  VAT        I       ++   TL+ H  +   + + P    +LL
Sbjct: 350 LLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILL 409

Query: 178 SGSDDHTVALWDVNG 192
           S +DD  V  WD+N 
Sbjct: 410 SCADDCQVLYWDLNS 424

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 185 VALWDVNGNSDSTRPIR--TWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242
           + LWD N     ++PI   TW    +D V   K++    D+  +   D+ + + DLR  N
Sbjct: 195 IQLWDAN----RSKPISNLTWG---ADNVTSVKFNQTETDILASTGSDNSIVLYDLRT-N 246

Query: 243 TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
           + T   +     N + ++   +     A  D + Y YD+RNM   L+    H  AV +++
Sbjct: 247 SPTQKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 303 FSP 305
           FSP
Sbjct: 307 FSP 309

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWD    S  +RP    S   +D V+  K++    D+F +   D+ + + DLR   T 
Sbjct: 195 INLWD----SSRSRPTANLS-WGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR---TN 246

Query: 245 TGTAKCPEPF--NTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
           + T K  +    N L ++   +     A  D + Y YD+RN+   LH    H  AV +++
Sbjct: 247 SPTQKFTQRMRTNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVD 306

Query: 303 FSP 305
           FSP
Sbjct: 307 FSP 309

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 93/214 (43%), Gaps = 25/214 (11%)

Query: 146 YSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSD 205
           YS S     +++F   N + L   P+    LL+   +  V L D      S   I+T   
Sbjct: 18  YSMSYSKLESIEFGP-NNWCLKLQPIYNSGLLTSLSNGRVELIDW-ATHKSILQIQT--- 72

Query: 206 LHSDIVNDSKWHN---FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFS 260
            H+  VND    N    N  L  T +ED++ KI DL+  N    T K  +  PF +L   
Sbjct: 73  -HATSVNDMVIINNDRMNGSLIATAAEDAV-KIYDLK-SNDCVATLKNGKSAPFLSLDSR 129

Query: 261 HHSSNLLAA----AGTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXX 315
           H    LL      +G D+ +++YD+R+ ++PL  +   H D +T+++F P          
Sbjct: 130 H---GLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGS 186

Query: 316 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 349
               + ++DL Q    Q  DDA   V     +H+
Sbjct: 187 TDGYVNIYDLTQ----QEEDDALHQVINFASIHS 216

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 20/128 (15%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN-- 242
           + LWD    S+ ++PI   S   +D +   K++    D+  +   D+ + + DLR  +  
Sbjct: 194 IHLWD----SNRSKPISNLS-WGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPT 248

Query: 243 -----TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
                T    A C  P     F          A  D + Y YD+RNM   LH    H  A
Sbjct: 249 QKIIQTMRTNAICWNPMEAFNF--------VIANEDHNAYYYDMRNMSRALHVFKDHVSA 300

Query: 298 VTNLEFSP 305
           V +++FSP
Sbjct: 301 VMDVDFSP 308

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 57/131 (43%), Gaps = 26/131 (19%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWDVN      +P+   S    D V+  +++   +D+  +   D+ + + DLR  + T
Sbjct: 198 IQLWDVN----RKKPLSNLS-WGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPT 252

Query: 245 TGT-------AKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGH 294
                     A C    EPFN            A A  D + Y YD+RNM   LH    H
Sbjct: 253 QKVVQRMRTNALCWNPMEPFN-----------FAIANEDHNAYYYDMRNMSRALHVFKDH 301

Query: 295 EDAVTNLEFSP 305
             AV +++FSP
Sbjct: 302 VSAVMDVDFSP 312

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 74/171 (43%), Gaps = 24/171 (14%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           L++S S D T  +WD+     S+  ++T    H   V D ++   +  LF +   D  ++
Sbjct: 258 LIISSSIDTTCIVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 235 INDLRV-------------------ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           + DLR                     +TTT  +K  +    L  S +  N+LA    +S+
Sbjct: 314 VFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESN 373

Query: 276 -VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
            + + D+RN + P+ ++ GH  +V  +++ P             +++ WDL
Sbjct: 374 KIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 24/130 (18%)

Query: 185 VALWDVNGNSDSTRPIR--TWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242
           + LWD    S  ++PI   TW    +D V + K++    D+  +   D+ + + DLR  +
Sbjct: 195 IQLWD----SSRSKPISNLTWG---ADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNS 247

Query: 243 TT-------TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
            T          A C  P     F          A  D + Y YD+RNM   L+    H 
Sbjct: 248 PTQKIVQSMRSNAICWNPMEAFNF--------VIANEDHNAYYYDMRNMSRALNVFKDHV 299

Query: 296 DAVTNLEFSP 305
            AV +++FSP
Sbjct: 300 SAVMDVDFSP 309

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 97/214 (45%), Gaps = 19/214 (8%)

Query: 130 NPGTVATINGQGTVFIYSRSEG---LQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHT 184
           N  T+A     GT+ +YS  +    + ST KF  H  +   + F+   + +L SG ++  
Sbjct: 73  NNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGE 132

Query: 185 VALWDVNGNSDSTR---PIRTWSDLHS-DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240
           + +WD+N  ++S     P+     + S D VN   W+     +F +    +   I DL+ 
Sbjct: 133 IFIWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 241 E------NTTTGTAKCPEPFNTLAF-SHHSSNLLAAAGTDS--HVYLYDLRNMKEPLHHM 291
           +      + T+  +   +  + + +   +S+ +  A G+D+   + ++DLRN   PL  +
Sbjct: 193 KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 292 S-GHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           S GH+  + +L++              N +++W+
Sbjct: 253 SQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 30/176 (17%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI------------VNDSKWHNFNKD 222
           LL+SG+   TV   D N ++DS+  +  WS L +D              ND  W + NK 
Sbjct: 22  LLVSGTVSGTV---DANFSTDSS--LELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKT 76

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLY 279
           + G +   +L   +     +T   TAK         T+ F+    N+LA+ G +  ++++
Sbjct: 77  IAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIW 136

Query: 280 DLRNMKE---------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
           D+    E         P   MS   D V +L ++             N   +WDLK
Sbjct: 137 DMNKCTESPSSYTPLTPGQSMSS-VDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 98/250 (39%), Gaps = 51/250 (20%)

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKF------HEENG----YALSFSP 170
           +TR +++P+  G +AT +   ++ I+S  + LQ  L         + NG     AL   P
Sbjct: 111 VTRCQWLPKGGGKLATCSD--SLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLP 168

Query: 171 LVEG---------LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
            V           L++S S D T  +WD+     S+  ++T    H   V D K+   + 
Sbjct: 169 PVTSFDWNSVDTNLIISSSIDTTCTVWDLQ----SSNYVKTQLIAHDSEVYDVKFLTNST 224

Query: 222 DLFGTVSEDSLLKINDLR-----------VENTTTGTAKCPEPFNT-------------- 256
            LF +   D  +++ DLR           +   T+GT K     N               
Sbjct: 225 QLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLR 284

Query: 257 LAFSHHSSNLLAAAGTDSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXX 315
           L  S    N++A    DS+ V + D+R    P+  + GH  AV  + + P          
Sbjct: 285 LEPSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCG 344

Query: 316 XXNRLIMWDL 325
              +++ WD+
Sbjct: 345 DDCQVLYWDI 354

>KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa]
           {ON} Anc_4.309 YLR429W
          Length = 634

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 23/132 (17%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  L SGSDD  + +WD+            NG+    +P++  +  HS  V    
Sbjct: 89  FDPFNQRRLASGSDDSKIGIWDIPEDYSFHNYLDSNGDPKDIKPVKMLAG-HSRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAG 271
           +H   +D+  + S D  +KI      N  TG    T K P+   +++FS++ ++ LA   
Sbjct: 148 YHPLAQDILASSSLDYTVKI-----WNVETGEVLFTLKHPDMVTSMSFSYNGAH-LATVA 201

Query: 272 TDSHVYLYDLRN 283
            D  + ++D+R 
Sbjct: 202 RDKKLRVWDVRK 213

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 37/212 (17%)

Query: 130 NPGTVATINGQGTVFIYSRSEGLQST--LKFHEENGYALSFSPLVEGLLLSGSDDHTVAL 187
           NP  V    G GT+ ++  +  LQ     K H    ++ +++ L     +SGS D  V +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKI 131

Query: 188 WDVNGNSDSTRPIRTWSDL-----------------HSDIVNDSKWHNFNKDLFGTVSED 230
           WD    S+S   +R    L                 + D +  + +   + ++    S +
Sbjct: 132 WDC-ARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSGN 190

Query: 231 SLLKINDLRVENTTTGTAKCPEPFNTLA--FSHHSSNLLAAAGTDSHVYLYDLRNMKEPL 288
           S L   DLR  N             TL+  ++ + S ++A+AG D  + ++DLR +K   
Sbjct: 191 SYLTFFDLRQPNQQNSILA-HSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKP 249

Query: 289 HHM--------------SGHEDAVTNLEFSPH 306
           H+M              + HE A+  + +SPH
Sbjct: 250 HNMFADISSYNCTNEVVNAHELAIRKILWSPH 281

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKC-PEPFNTLAFSHHSSN 265
           HS  + D  ++  N D+  T S D+ +   D+R  +    T        + + +++  SN
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           +LA+A ++  +Y++DLR    PLH + GH+ +V +++F+               +  WD+
Sbjct: 176 ILASAHSND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

Query: 326 KQ 327
            +
Sbjct: 235 SK 236

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 59/127 (46%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+  + ++LA    D++V+ +D+R+   P +  S      + ++++ +          
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWN-YKDSNILASAH 181

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            N + +WDL+ +G+  TP      + +L+    GH S+VN  D N      + S+  +  
Sbjct: 182 SNDIYIWDLR-MGS--TP------LHKLV----GHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 229 VKFWDIS 235

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 103/265 (38%), Gaps = 50/265 (18%)

Query: 128 PQNPGTVATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVA 186
           P +   +A+ +  GT+ I+  +  +   TL  H  +   + +     G+L SGS D T+ 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKTIR 301

Query: 187 LWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDL-----RVE 241
            WD+N        +++    H+  +N             ++S D  L++        +  
Sbjct: 302 AWDMNAGGKCINILKS----HAHWINHL-----------SLSTDYALRVGAFDHTGKKPS 346

Query: 242 NTTTGTAKCPEPFNTLAFSHHS-SNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300
           +     AK  E +  +A  +     L+  A  D  +YL+D     +P+  M+GH+  V +
Sbjct: 347 SPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNH 406

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360
           + FSP            N + +W            D  DG    I    GH ++V     
Sbjct: 407 VAFSP-DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASV----- 446

Query: 361 NAQIPW-----LVASTEEENILQVW 380
             Q+ W     L+ S  ++  L+VW
Sbjct: 447 -YQVAWSSDCRLLVSCSKDTTLKVW 470

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 71/184 (38%), Gaps = 27/184 (14%)

Query: 76  AEINLPKEILNNED--------PQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEE 120
           AE   P+++++ +D        P  +  ED       PR+  K+       +A   H   
Sbjct: 85  AEKGKPEQLVDIKDNIYNSILKPGYKTTEDFITIVYTPRAVFKVRPVTRSSSAIAGHGST 144

Query: 121 ITRARYMPQNPGTVATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSG 179
           I  + + P     + T  G  T  I+   +     TLK H      +++SP  E L+ +G
Sbjct: 145 ILCSAFAPHTSSRMVTGAGDNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGE-LIATG 203

Query: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF------NKDLFGTVSEDSLL 233
           S D+T+ LW      +    +R     HS  +    W         +K    + S+D  +
Sbjct: 204 SMDNTIRLWQSEKGENFGDALRG----HSKWITSLSWEPIHLVKPGDKPRLASASKDGTI 259

Query: 234 KIND 237
           KI D
Sbjct: 260 KIWD 263

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 85/181 (46%), Gaps = 17/181 (9%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIV--N 212
           ++ F  +N + L   PL    LL+   + +V L D   N   ++ I+      SD+V  N
Sbjct: 8   SINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQ-IQAHGTTISDMVVLN 65

Query: 213 DSKWHNFNKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAA-- 269
           + + + F   L  T +EDS+ KI DLR  +T  T   +   PF +L   H    +LA   
Sbjct: 66  NDRNNGF---LIATAAEDSV-KIFDLRSSDTVATLKNEKSAPFLSLDSRH---GMLACGT 118

Query: 270 --AGTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
             +G D+ +++YD++   +PL  +   H D +TN++F P              + ++DL 
Sbjct: 119 ELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLT 178

Query: 327 Q 327
           Q
Sbjct: 179 Q 179

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239
           + +    LW+++ NS     I      HS  + D  +H  + ++  T S D+ +   D+R
Sbjct: 88  TSNQKALLWNLSRNSSDA--IEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMR 145

Query: 240 VENTTTGTAKC-PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAV 298
                  +A       + + +++ +SN++A+A ++  VY++DLR    PLH + GH ++V
Sbjct: 146 SPRRAYYSASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSV 204

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWD 324
            +++FS               +  WD
Sbjct: 205 NSIDFSKFDETEIMSSSNDGTVKFWD 230

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF-- 219
           + + L F PL    LL+   +  V L D     ++  P+R +  +    +N  K  N   
Sbjct: 14  DNWCLKFQPLYNHGLLTSLSNGEVKLLDW----ETLNPVRNFK-IDQVSINSMKLINNDY 68

Query: 220 -NKDLFGTVSEDSLLKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSNLLAAA----GTD 273
            N  LF T + +S+ KI D++  +   T T     PF +L   H   ++LA      G D
Sbjct: 69  NNASLFATATLNSV-KIYDIKSNDCIATITNDKKSPFLSLDSRH---DMLACGTELQGVD 124

Query: 274 SHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQ 332
           + +Y+YD+RN   P+   +  H D +T+++F P                ++DL Q    Q
Sbjct: 125 AELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ----Q 180

Query: 333 TPDDAEDGVPELIMVHA 349
             DDA   V     +H+
Sbjct: 181 EEDDALYQVINYASIHS 197

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 86/218 (39%), Gaps = 34/218 (15%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           L++S S D T  +WD+     S+  ++T    H   V D ++   +  LF +   D  ++
Sbjct: 258 LIISSSIDTTCIVWDLQ----SSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVR 313

Query: 235 INDLRV-------------------ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           + DLR                       TT + K  +    L  S +  N+LA    DS+
Sbjct: 314 VFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSN 373

Query: 276 -VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTP 334
            + + D+RN + P+ ++ GH  +V  +++ P             + + WDL     E   
Sbjct: 374 KIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEING 433

Query: 335 DDA----------EDGVPELIMVHAGHKSAVNDFDLNA 362
            D+          ED   + +M   G K+   +  LN+
Sbjct: 434 SDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNS 471

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 173 EGLLLSGSDDHTVALWDVN----GNSDSTRPIRTWSDL----HSDIVNDSKWHNFNKDLF 224
           E  +LS SDD TV LW VN     N  +   I T S L    +SD       H+ +K  F
Sbjct: 129 ENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRSKSNF 188

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR 282
             V+  + +++ D       T  +   +  +T+ F+ + +++LA+AG+D+ + LYDLR
Sbjct: 189 --VTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLR 244

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 57/130 (43%), Gaps = 24/130 (18%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLH--SDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR--- 239
           + LWD    S+ ++P+   +DL   +D ++  K++    D+  +   D+ L + DLR   
Sbjct: 195 IQLWD----SNRSKPL---TDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNS 247

Query: 240 ----VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
               +  T    A C  P     F          A  D + Y YD+RNM   L+    H 
Sbjct: 248 PTQKIVQTMRTNAICWNPMEAFNF--------VVANEDHNAYYYDMRNMSRALNVFKDHV 299

Query: 296 DAVTNLEFSP 305
            AV +++FSP
Sbjct: 300 SAVMDVDFSP 309

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 101/260 (38%), Gaps = 57/260 (21%)

Query: 132 GTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVN 191
           GT+   +  G V +Y+ S G  S++      G         + +L +GS D T+ +WD+N
Sbjct: 257 GTIKVWDTTGRVCLYTLS-GHTSSVSCVRWGG---------QNMLYTGSHDKTIRVWDMN 306

Query: 192 GNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTA--- 248
            N      +++    H+  VN             ++S D  L+I            A   
Sbjct: 307 SNGRCINILKS----HAHWVNHL-----------SLSTDYALRIGPFDHSGAKPAIAEEA 351

Query: 249 --KCPEPFNTLAFSH-HSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
             K  + +  +   + H+  L+  A  D  ++L++     +PL  M+GH+  V ++ FSP
Sbjct: 352 RDKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP 411

Query: 306 HXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIP 365
                       N + +W            D  DG  + I    GH ++V       Q+ 
Sbjct: 412 -DGRHIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV------YQVA 450

Query: 366 W-----LVASTEEENILQVW 380
           W     L+ S  ++  L+VW
Sbjct: 451 WSSDCRLLVSCSKDTTLKVW 470

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 154 STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVND 213
           S +  H       +F+P     +++G+ D+T  LWD     D+  P+ T S  HS+ V  
Sbjct: 136 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDC----DTQTPMATLSG-HSNWVLC 190

Query: 214 SKWHNFNKDLFGTVSEDSLLK----INDLRVENTTTGTAK-----CPEPFNTLAFSHHSS 264
             W + + ++  T S D+ ++    IN   + ++  G +K       EP + +       
Sbjct: 191 VAW-SPDAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPR 249

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
             LA+A  D  + ++D    +  L+ +SGH  +V+ + +
Sbjct: 250 --LASASKDGTIKVWDTTG-RVCLYTLSGHTSSVSCVRW 285

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 180 SDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239
           + +    +W+++ NS  T  I      H   + D  +H  + ++  T S D+ +   D+R
Sbjct: 88  TSNQKAMVWNLSRNS--TNAIEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMR 145

Query: 240 V-ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAV 298
             +     T++     + + ++  +SN++A++ +D HV ++DLR    PL+ + GHE +V
Sbjct: 146 SPQRPYYSTSEWRAGASQVKWNFRNSNIMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSV 204

Query: 299 TNLEFSPHXXXXXXXXXXXNRLIMWD 324
            N++F+               +  WD
Sbjct: 205 NNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 25/129 (19%), Positives = 53/129 (41%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F  H   +LA    D++V  +D+R+ + P +  S      + ++++            
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWN-FRNSNIMASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            + + +WDL++            G   L  +  GH+ +VN+ D N      + S+  +  
Sbjct: 179 SDHVCIWDLRK------------GCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSVS 234

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 107/259 (41%), Gaps = 50/259 (19%)

Query: 134 VATINGQGTVFIYSRSEGLQS-TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           +AT +  GT+ I+  +  + + TL  H  +   + +    +  L SGS D TV +WD+  
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGG--QNFLYSGSHDKTVRVWDMK- 304

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN--DLRVENTTT---GT 247
             +S R I         + N + W N       ++S D  L++   D   E   T     
Sbjct: 305 --NSGRCINI-------LKNHAHWVNHL-----SLSTDYALRVGPFDYTGEQPATPEIAK 350

Query: 248 AKCPEPFNTLAFSH-HSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
           AK  + +  +A  +   + L+  A  D  ++L+D     +P+  M+GH+  V ++ FSP 
Sbjct: 351 AKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP- 409

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
                      N + +W            D+ DG  + I    GH ++V       Q+ W
Sbjct: 410 DGRHIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASV------YQVAW 449

Query: 367 -----LVASTEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 450 SSDCRLLVSCSKDTTLKVW 468

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 84/219 (38%), Gaps = 37/219 (16%)

Query: 103 PAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIY-SRSEGLQSTLKFHEE 161
           P  RS+  I     H   I  + + P     + T  G  T  I+   ++   +TL  H  
Sbjct: 128 PVTRSSSAIAG---HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHN 184

Query: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFN- 220
               +S+SP  E L+ +GS D+TV LW+    S + +P       H   +    W   + 
Sbjct: 185 WVLCVSWSPDGE-LIATGSMDNTVRLWE----SKTGKPFGDALRGHGKWITSLSWEPIHL 239

Query: 221 -----KDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSS----------N 265
                +    T S+D  +KI D       T    C     T+  S H+S          N
Sbjct: 240 VTPGERPRLATSSKDGTIKIWD-------TTRRVC-----TMTLSGHTSSVSCVKWGGQN 287

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
            L +   D  V ++D++N    ++ +  H   V +L  S
Sbjct: 288 FLYSGSHDKTVRVWDMKNSGRCINILKNHAHWVNHLSLS 326

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 65/163 (39%), Gaps = 24/163 (14%)

Query: 150 EGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSD 209
           EGL  T  F  E+ +    S  V     +G     + LWDVN      +P+   S   +D
Sbjct: 170 EGLVRT--FDGESAFQGIDSHRVNSTFATGG--AKIQLWDVN----RVKPVSNLS-WGAD 220

Query: 210 IVNDSKWHNFNKDLFGTVSEDSLLKINDLR-------VENTTTGTAKCPEPFNTLAFSHH 262
            +   K++    D+  +   D+ + + DLR       +  T    A C  P     F   
Sbjct: 221 NITSVKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNF--- 277

Query: 263 SSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
                  A  D + Y YD+RN+   L+    H  AV +++FSP
Sbjct: 278 -----VIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSP 315

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 28/128 (21%)

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +  +LS SDD TV LW +N +  S +     SD  S I  +     F+        E + 
Sbjct: 133 QNFMLSCSDDKTVKLWSINVDDYSNKRS---SDNDSVINEEGLVRTFD-------GESAF 182

Query: 233 LKINDLRVENT-TTGTAKCP-------EPFNTLA----------FSHHSSNLLAAAGTDS 274
             I+  RV +T  TG AK         +P + L+          F+ + +++LA+ G+D+
Sbjct: 183 QGIDSHRVNSTFATGGAKIQLWDVNRVKPVSNLSWGADNITSVKFNQNETDILASTGSDN 242

Query: 275 HVYLYDLR 282
            + LYDLR
Sbjct: 243 SIVLYDLR 250

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 4/123 (3%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSN 265
           HS  + D  +++ + D+  T S D+ +   D+R  +     T+      + + ++   SN
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSN 173

Query: 266 LLAAA-GTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           +LA++ G D  V+++DLR+   PLH ++GH   V +++FS               +  WD
Sbjct: 174 ILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWD 231

Query: 325 LKQ 327
           L +
Sbjct: 232 LSK 234

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/136 (18%), Positives = 54/136 (39%), Gaps = 20/136 (14%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    ++LA    D++V+ +D+R+   P +  S    + + ++++            
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWN-FKDSNILASSH 179

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            N + +WDL+      TP          +    GH S VN  D +      + S+  +  
Sbjct: 180 GNDVFIWDLRH---GSTP----------LHKLTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 377 LQVW------KCSHSL 386
           ++ W      KC  ++
Sbjct: 227 VKFWDLSKEEKCQQAI 242

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 113/282 (40%), Gaps = 56/282 (19%)

Query: 117 HEEEITRARYMPQN---PGT---VATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFS 169
           H + IT   + P +   PG+   +A+ +  GT+ I+  S  +   TL  H  +   + + 
Sbjct: 230 HSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWG 289

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              EG+L SGS D TV  WD+  N      +++    H+  VN             ++S 
Sbjct: 290 G--EGILYSGSHDKTVRAWDMKQNGKCINILKS----HAHWVNHL-----------SLST 332

Query: 230 DSLLKIN-----DLRVENTTTGTAKCPEPFNTLAFSHHS-SNLLAAAGTDSHVYLYDLRN 283
           D  L++       ++  N      K  + +  +A  +     L+  A  D  ++L++   
Sbjct: 333 DYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLK 392

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +P+  M+GH+  V ++ FSP            N + +WD    G E T          
Sbjct: 393 GTKPISRMTGHQKLVNHVAFSP-DGKYIVSASFDNSIKLWD----GKEGT---------- 437

Query: 344 LIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            +    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 438 FLSTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 473

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 82/211 (38%), Gaps = 21/211 (9%)

Query: 103 PAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIY-SRSEGLQSTLKFHEE 161
           P  RS+  I     H   I  + + P     V T  G  T  I+   ++  + TL  H  
Sbjct: 133 PITRSSSAIAG---HGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRN 189

Query: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF-- 219
               +S+S   E ++ +GS D+T+ LWD    ++S +P+      HS  +    W     
Sbjct: 190 WVLCVSWSADGE-VIATGSMDNTIRLWD----AESGKPLGDALRGHSKWITSLTWEPIHL 244

Query: 220 ----NKDLFGTVSEDSLLKIND--LRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTD 273
               +K    + S+D  ++I D   RV   T G        +          +L +   D
Sbjct: 245 VEPGSKPRLASASKDGTIRIWDSSRRVCLMTLG----GHTNSVSCVKWGGEGILYSGSHD 300

Query: 274 SHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
             V  +D++   + ++ +  H   V +L  S
Sbjct: 301 KTVRAWDMKQNGKCINILKSHAHWVNHLSLS 331

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 55/130 (42%), Gaps = 24/130 (18%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLH--SDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR--- 239
           + LWDVN      +P+   SDL   +D +   K++    D+  +   D+ + + DLR   
Sbjct: 201 IHLWDVN----RLKPV---SDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 240 ----VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHE 295
               +  T    A C  P     F          A  D + Y YD+RN+   L+    H 
Sbjct: 254 PTQKIVQTMRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNLSRSLNVFKDHV 305

Query: 296 DAVTNLEFSP 305
            AV +++FSP
Sbjct: 306 SAVMDVDFSP 315

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 66/154 (42%), Gaps = 36/154 (23%)

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +  +LS SDD TV LW +N +  S +         SD  NDS             +E+ L
Sbjct: 133 QNFMLSCSDDKTVKLWSINVDDYSNKN-------SSD--NDS-----------VTNEEGL 172

Query: 233 LKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMS 292
           ++  D                F  +  SH  ++  A  G  + ++L+D+  +K P+  +S
Sbjct: 173 IRTFD------------GESAFQGID-SHRENSTFATGG--AKIHLWDVNRLK-PVSDLS 216

Query: 293 GHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
              D +T+L+F+ +           N ++++DL+
Sbjct: 217 WGADNITSLKFNQNETDILASTGSDNSIVLYDLR 250

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 141 GTVFIYSRSEGLQSTL-KFHEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTR 198
           GT+ I+  +  +   L + H +    +SFS   +   ++ SDD+ + +W+  NG  +ST 
Sbjct: 147 GTIKIWQPNFNMVKVLDEAHTQCIRGISFSG-TDSKFVTCSDDNILKIWNFSNGQQESTL 205

Query: 199 PIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLA 258
               W       V    WH     L  + S+D+L+K+ D R     +    C     +  
Sbjct: 206 SGHHWD------VRSCDWHP-TMGLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTK 258

Query: 259 FSHHSSNLLAAAGTDSHVYLYDLR-NMKE 286
           F     N+LA    D    ++D+R NMKE
Sbjct: 259 FQPTKGNMLAVISKDKSCRIFDIRQNMKE 287

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 102/254 (40%), Gaps = 40/254 (15%)

Query: 134 VATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           +A+ +  GT+ I+  S  +   TL  H  +   + +    +G+L SGS D TV  WD+N 
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGG--QGILYSGSHDKTVRAWDMNS 308

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDL---RVENTTTGTAK 249
                  +++    H+  VN             ++S D  L++       VE T+   A+
Sbjct: 309 EGRCINVLKS----HAHWVNHL-----------SLSTDYALRVGPFDHTGVEPTSPEDAR 353

Query: 250 CPEPFN---TLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
                N    +  +     L+  A  D  ++L++     +PL  M+GH+  V ++ FSP 
Sbjct: 354 DKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSPD 413

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
                      N + +W            D  DG  + I    GH ++V     +A    
Sbjct: 414 -GRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCRL 458

Query: 367 LVASTEEENILQVW 380
           LV S  ++  L+VW
Sbjct: 459 LV-SCSKDTTLKVW 471

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 4/120 (3%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSN 265
           HS  + D  ++  N D+  T S D+ +   D+R  +     T+      + + ++   SN
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSN 171

Query: 266 LLAAA-GTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           +LA++ G D  V+++DLRN   PL  + GHE +V +++FS               +  WD
Sbjct: 172 ILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/127 (18%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+  + ++LA    D++V+ +D+R+  +P +  S    + + ++++            
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWN-FKDSNILASSH 177

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            N + +WDL+            +G   L  +  GH+S+VN  D +      + S+  +  
Sbjct: 178 GNDVFIWDLR------------NGSTPLCQL-VGHESSVNSIDFSRFKSTEIMSSSNDGT 224

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 225 VKFWDYS 231

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 16/153 (10%)

Query: 162 NGYALSFSPLVE-GLLLSGSDDHTVAL-WDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF 219
           N + L F PL   GLL S S+     L W  N   D  + I   S    +IVN+    N+
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIK-IGETSINDFEIVNN----NY 68

Query: 220 NKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAA----AGTDS 274
           N       + +  +KI DL+  +   T T +   PF +L   H   N++A     +G D+
Sbjct: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTELSGVDA 125

Query: 275 HVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPH 306
            +Y+YD+R+   P+   +  H D +T+++F P+
Sbjct: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPN 158

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 89/223 (39%), Gaps = 30/223 (13%)

Query: 132 GTVATINGQGTVFIYSRS-EGLQSTLK--FHEENGYALSFSPLVEGLLLSGSDDHTVALW 188
           GT   + G G ++I   S EG   T +    ++  + L++S L E   L    D ++ L+
Sbjct: 29  GTNYGLIGNGKLWILDISPEGQMVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLF 88

Query: 189 DVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT---- 244
           D   +     P+  + + H D V    W    ++ F +   D L+K+  +   N+     
Sbjct: 89  DTTLDK---YPVAVYQE-HRDEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLK 144

Query: 245 ---------------TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNM---KE 286
                          TGT    +      FS H  +L+     DS V L+DLR     + 
Sbjct: 145 PRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQG 204

Query: 287 PLHHMSGHEDAVT-NLEFSPHXXXXXXXXXXXNRLIMWDLKQI 328
           P H    H  + T +++F+ +           N++ +WDL+ +
Sbjct: 205 PTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRML 247

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 80/223 (35%), Gaps = 39/223 (17%)

Query: 198 RPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTG-----TAKCPE 252
           RP  T +    D V  +K+   +  L    S DS + + DLR      G      A    
Sbjct: 156 RPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGS 215

Query: 253 PFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE-PL--------------------HHM 291
              ++ F+ + +N++A  G D+ + ++DLR ++  PL                      +
Sbjct: 216 ETLSVDFNKYRTNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIV 275

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPD------------DAED 339
            GHE AV  + +SPH               +W       ++T              +A D
Sbjct: 276 GGHELAVRKVNWSPHSSNYLLSTSYDMTCCIWQDMGYATDRTRGNNSGYGVTTGRTNASD 335

Query: 340 GVPELIMVHAGHKSAVNDFDLNA-QIPWLVASTEEENILQVWK 381
               L+     H   V D D +    P  VA+T  +  + VWK
Sbjct: 336 LRNGLVSRFTAHTEFVFDGDWSLWGAPGFVATTGWDGNVFVWK 378

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 26/176 (14%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  + SGSDD  + +WD+            NG+    +P +  +  HS  V    
Sbjct: 89  FDPFNDHRVASGSDDCKIGIWDIPEGYSFRNHIDENGDVIDIQPTKMLTG-HSRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAG 271
           +H  ++++  + S D       +R+ N  TG    T K P+   +++FS +  N LA   
Sbjct: 148 FHPVSQNVLASSSLDYT-----VRIWNVETGENLITLKHPDMVTSMSFS-YDGNHLATVA 201

Query: 272 TDSHVYLYDLRNMK---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
            D  + ++D+RN K   E L H       V  L  S              ++ +WD
Sbjct: 202 RDKKLRVWDIRNNKIVSEGLAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 114/282 (40%), Gaps = 56/282 (19%)

Query: 117 HEEEITRARYMPQN---PG---TVATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFS 169
           H++ IT   + P +   PG    +A+ +  GT+ I+  S  +   TL  H  +   + + 
Sbjct: 228 HQKWITSLVWEPLHLVKPGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWG 287

Query: 170 PLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE 229
              +GLL SGS D TV +WD+N        +++    H+  VN             ++S 
Sbjct: 288 G--QGLLYSGSHDKTVRVWDMNVGGKCINILKS----HAHWVNHL-----------SLST 330

Query: 230 DSLLKINDLRVENTTTGTA-----KCPEPFNTLAFSH-HSSNLLAAAGTDSHVYLYDLRN 283
           +  L++       T   +A     K  E +  +A  +  +  L+  A  D  ++L+D   
Sbjct: 331 EYALRVGPFDHTATKFTSAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTK 390

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +PL  ++GH+  V ++ FSP            N + +W            D  +G   
Sbjct: 391 SGKPLARLTGHQKLVNHVAFSP-DGRFIVSASFDNSIKLW------------DGRNGT-- 435

Query: 344 LIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 20/128 (15%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR----- 239
           + LWDVN      +P+   S   +D +   K++    D+  +   D+ + + DLR     
Sbjct: 201 IHLWDVN----RLKPVSNLS-WGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPT 255

Query: 240 --VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
             +  T    A C  P     F          A  D + Y YD+RN+   L+    H  A
Sbjct: 256 QKIVQTMRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNLSRSLNVFKDHVSA 307

Query: 298 VTNLEFSP 305
           V +++FSP
Sbjct: 308 VMDVDFSP 315

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 67/139 (48%), Gaps = 8/139 (5%)

Query: 167 SFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           +  P+     ++GS+D T+ +WD+     +T  +RT    H   V D    + +  LF +
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDL-----ATGKLRTTLAGHVMTVRDIAISDRHPYLF-S 199

Query: 227 VSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE 286
           VSED  +K  DL                 T++  H + +L+A AG DS + L+D+R  + 
Sbjct: 200 VSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDIRT-RV 257

Query: 287 PLHHMSGHEDAVTNLEFSP 305
           P+  + GH+  +  ++ +P
Sbjct: 258 PVITLVGHKGPINQVQCTP 276

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 22/184 (11%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           LL+S S D T  +WD+     S+  ++T    H   V D ++   +  LF +   D  ++
Sbjct: 295 LLISSSIDTTCIVWDL----QSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVR 350

Query: 235 INDLRVENTTTGTAKCP-EPFNTLAFSHHSSNLLAA--AGTDSHV-----------YLYD 280
           + DLR    +T   + P  P +    S   + LL    + TD++V            + D
Sbjct: 351 VFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILD 410

Query: 281 LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQT----PDD 336
           +RN + P+  + GH+ A+  +++ P             +++ WDL    +  T     ++
Sbjct: 411 MRNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSGNTVASPSNN 470

Query: 337 AEDG 340
           AE+G
Sbjct: 471 AENG 474

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 79/180 (43%), Gaps = 29/180 (16%)

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVEN--TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTD 273
           W+  + +L  + S D+   + DL+  N   T   A   E ++ + F   S+ L A+ G D
Sbjct: 288 WNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYD-VRFLTKSTQLFASCGGD 346

Query: 274 SHVYLYDLRNMK----------EPLHH--MSGHEDAVTNLEFSP-HXXXXXXXXXXXNRL 320
             V ++DLR++            P+ +  +S  ++A+  LE SP             N++
Sbjct: 347 GSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKI 406

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVW 380
           ++ D++     ++P          ++V  GHKSA+N    +    +++ S  ++  +  W
Sbjct: 407 LILDMRN---SESP----------VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYW 453

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 71/149 (47%), Gaps = 16/149 (10%)

Query: 162 NGYA--LSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVND---SKW 216
           NG+   ++  P+      +GS+D T+ +WD+     +T  ++     H   V D   SK 
Sbjct: 129 NGWVRTVAVDPIDNEWFATGSNDTTIKIWDL-----ATGKLKLTLSGHIMTVKDICISKR 183

Query: 217 HNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHV 276
           H +   +F + SED L+K  DL                +T+   H + NL+A AG DS V
Sbjct: 184 HPY---MF-SASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDI-HPTLNLIATAGRDSVV 238

Query: 277 YLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            L+D+R  K P+  M+GH+  +  ++  P
Sbjct: 239 RLWDIRT-KLPVMTMAGHKSPINRVKCLP 266

>KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {ON}
           Anc_8.631 YOR212W
          Length = 423

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 66/158 (41%), Gaps = 9/158 (5%)

Query: 130 NPGTVATINGQGTVFIYSRSEGLQSTLK--FHEENGYALSFSPLVEGLLLSGSDDHTVAL 187
           N    A ++   TV+  S+   +Q  +   F    GY  S   L E  +LS S D T AL
Sbjct: 148 NLAASAGLDNNCTVYKISKENRIQQNVITIFKGHTGYISSIDFLDERQILSASGDMTCAL 207

Query: 188 WDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD--LFGTVSEDSLLKINDLRVENTTT 245
           WD+       + IR ++D   D++  +  HN N +  +F +   D  L I D R      
Sbjct: 208 WDI----PKAKRIREYTDHLGDVLALALPHNDNANGKIFASCGSDGYLYIWDTRSPANAQ 263

Query: 246 GTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRN 283
                    ++L F     N + A   +  + ++DLR+
Sbjct: 264 SFFISSSDASSLQF-FRDDNSIIAGSENGTISMFDLRS 300

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 105/261 (40%), Gaps = 54/261 (20%)

Query: 134 VATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEG---LLLSGSDDHTVALWDV 190
           +AT +  GT+ ++         +  +  +G+  S S +  G   LL SGS D TV +WD+
Sbjct: 251 LATSSKDGTIKVWDTGR----RVCLYTLSGHVNSVSCVKWGGKNLLYSGSHDKTVRVWDM 306

Query: 191 NGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGT--- 247
           N        +++    H+  VN             ++S D  L++           T   
Sbjct: 307 NLGGKCINILKS----HAHWVNHL-----------SLSTDYALRVGPFDHTGIMPATPEE 351

Query: 248 --AKCPEPFNTLAFSHHSSN-LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
             AK  + +  +A  + S   L+  A  D  ++L++     +P+  M+GH+  V ++ FS
Sbjct: 352 ARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFS 411

Query: 305 PHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQI 364
           P            N + +W            D+ DG  + I    GH ++V       Q+
Sbjct: 412 P-DGRYIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASV------YQV 450

Query: 365 PW-----LVASTEEENILQVW 380
            W     L+AS  ++  L+VW
Sbjct: 451 AWSSDCRLLASCSKDTSLKVW 471

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 79/189 (41%), Gaps = 14/189 (7%)

Query: 150 EGLQSTLKFHEENG--YALSFSPLVEGLLLSGSDDHTVALWDVN--GNSDSTRPIRTWSD 205
           + L+S  K H+  G    L F+     +L+SG     + +WD N  G+SD +      S+
Sbjct: 92  KALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDSNKIGSSDYSPFSAGISN 151

Query: 206 LHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE------NTTTGTAKCPEPFNTLAF 259
              D V+   W+     +F + S      + DL+ +      N ++ T     P   + +
Sbjct: 152 TPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAKKQVLHLNHSSSTTGIKVPLTVVDW 211

Query: 260 SHHSSNLLAAAG---TDSHVYLYDLRNMKEPLHHMS-GHEDAVTNLEFSPHXXXXXXXXX 315
              SS ++A A    T+  V  +DLRN   PL  +S GH   V +L++            
Sbjct: 212 HPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLSQGHSKGVLSLDWCKQDENLLLSSG 271

Query: 316 XXNRLIMWD 324
             N  ++W+
Sbjct: 272 RDNTSVLWN 280

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG 271
           ND  W   +K + G + E+ +++  D +   +     K   P  TL F+   +N+L + G
Sbjct: 66  NDLDWSGDDKIIAGAL-ENGVVEFFDPKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGG 124

Query: 272 TDSHVYLYD 280
           T   ++++D
Sbjct: 125 TQGEIFVWD 133

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 92/203 (45%), Gaps = 19/203 (9%)

Query: 141 GTVFIYSRSE---GLQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           G++ +YS +E    + S  KF  H  +   + F+   + +L SG ++  + +WD+N  ++
Sbjct: 84  GSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTE 143

Query: 196 STR---PIRTWSDLHS-DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENT------TT 245
           S     P+     + S D VN   W+     +F +    +   I DL+ +        T+
Sbjct: 144 SPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCYTS 203

Query: 246 GTAKCPEPFNTLAF-SHHSSNLLAAAGTDS--HVYLYDLRNMKEPLHHMS-GHEDAVTNL 301
             +   +  + + +   +S+ +  A G+D+   + ++DLRN   PL  ++ GH+  + +L
Sbjct: 204 PNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQGHQKGILSL 263

Query: 302 EFSPHXXXXXXXXXXXNRLIMWD 324
           ++              N +++W+
Sbjct: 264 DWCHQDENLLLSSGRDNTVLLWN 286

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 71/176 (40%), Gaps = 30/176 (17%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI------------VNDSKWHNFNKD 222
           LL+SG+   TV   D N +SDS+  +  WS L SD              ND  W + NK 
Sbjct: 22  LLVSGTVSGTV---DANFSSDSS--LELWSLLASDSEKPIASLQVDSKFNDLDWSHNNKI 76

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLY 279
           + G +   SL   +   V +  +  AK         T+ F+    N+LA+ G +  ++++
Sbjct: 77  IAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIW 136

Query: 280 DLRNMKE---------PLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
           D+    E         P   MS   D V +L ++             N   +WDLK
Sbjct: 137 DMNKCTESPANYTPLTPGQSMSS-VDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 20/134 (14%)

Query: 255 NTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHM-----SGHEDAVTNLEFSPHXXX 309
           N+LA++   +++ A+AG+ +   ++DL+  KE +H       SG +  ++ +E+ P    
Sbjct: 164 NSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCYTSPNSGIKQQLSVVEWHPKNST 223

Query: 310 XXXXXXXXNR---LIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
                   +    +++WDL+      TP         L  ++ GH+  +   D   Q   
Sbjct: 224 RVATATGSDNDPSILVWDLRNAN---TP---------LQTLNQGHQKGILSLDWCHQDEN 271

Query: 367 LVASTEEENILQVW 380
           L+ S+  +N + +W
Sbjct: 272 LLLSSGRDNTVLLW 285

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 79/181 (43%), Gaps = 24/181 (13%)

Query: 164 YALSFSPLVEGLLLSGSDDHTVALWDVN-GNSDSTRPIRTWSDLHSDI----VNDSKWHN 218
           + L   PL    LLS   +  V L D N GN      IRT    ++ I    V DS + N
Sbjct: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNC-----IRTVKAGNTSINRMRVLDSDYDN 71

Query: 219 FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE---PFNTLAFSHHSSNLLAA----AG 271
               +F     D++ K+ DLRV+  +       E   PF +L   H    +LA     +G
Sbjct: 72  --GSVFSVAMNDAV-KVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSG 125

Query: 272 TDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGA 330
            D+ +++YD+RN  +P+  +   H D VT+++F P                ++DL Q+  
Sbjct: 126 VDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEE 185

Query: 331 E 331
           E
Sbjct: 186 E 186

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 6/121 (4%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWD    S+ + PI   S   +D V + K++    D+  +   D+ + + DLR  + T
Sbjct: 194 IELWD----SNRSNPISNLS-WGADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPT 248

Query: 245 TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
               +     N+L ++   +     A  D + Y YD+R M   L+    H  AV +++FS
Sbjct: 249 QKIVQTMRT-NSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFS 307

Query: 305 P 305
           P
Sbjct: 308 P 308

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 83/181 (45%), Gaps = 17/181 (9%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG-NSDSTRPIRTWSDLHSDIVND 213
           T+ F  +N + L   PL    LLS   +  V L D N   S    P+   S + +  V D
Sbjct: 8   TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTS-ISALKVLD 65

Query: 214 SKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFSHHSSNLLAA-- 269
           +   + N   F T SEDS+ KI DLR+ N    T +  +  PF +L   H    +LA   
Sbjct: 66  NDVDSGNT--FVTASEDSV-KIFDLRL-NQCVATVQNAKNSPFISLDSRH---GMLACGT 118

Query: 270 --AGTDSHVYLYDLRNMKEPLHHMS-GHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
             +GTD+ ++LYDL+ +  P+      H D +T+++F                + ++DLK
Sbjct: 119 ELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178

Query: 327 Q 327
           Q
Sbjct: 179 Q 179

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 141 GTVFIYSRSEGLQSTL-KFHEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTR 198
           GT+ I+  +  +   L + H +    +SFS   +   ++ SDD+ + +W+  NG  +ST 
Sbjct: 147 GTIKIWQPNFNMVKVLDEAHTQCIRGISFSG-TDSKFVTCSDDNILKIWNFSNGQQESTL 205

Query: 199 PIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLA 258
               W       V    WH     L  + S+D+L+K+ D R     +    C     +  
Sbjct: 206 TGHHWD------VRSCDWHP-TMGLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTK 258

Query: 259 FSHHSSNLLAAAGTDSHVYLYDLR-NMKE 286
           F     N+LA    D    ++D+R NMKE
Sbjct: 259 FQPTKGNMLAVISKDKSCRVFDIRQNMKE 287

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 90/201 (44%), Gaps = 24/201 (11%)

Query: 134 VATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN 193
           VAT +G+ +++  S +   +S ++ H+     +++S   +  L+SG  D T+ +W  N N
Sbjct: 100 VATYSGEFSLWNGS-TFNFESIMQAHDSAVSVMTYSHAGD-WLISGDSDGTIKIWQPNFN 157

Query: 194 SDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI---NDLRVENTTTG---- 246
                 ++   + H+  +    +   +   F T S+D++LKI   ++ + E+T TG    
Sbjct: 158 M-----VKVLDEAHTQCIRGISFSGTDSK-FVTCSDDNILKIWNFSNGQQESTLTGHHWD 211

Query: 247 TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
              C          H +  L+A+   D+ + L+D R+  + +  + G +  + + +F P 
Sbjct: 212 VRSCDW--------HPTMGLIASGSKDNLIKLWDPRS-GQCISTILGCKHTIISTKFQPT 262

Query: 307 XXXXXXXXXXXNRLIMWDLKQ 327
                          ++D++Q
Sbjct: 263 KGNMLAVISKDKSCRVFDIRQ 283

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 103/269 (38%), Gaps = 58/269 (21%)

Query: 128 PQNPGTVATINGQGTVFIYS--RSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTV 185
           P N   +A+ +  GT+ ++   R + +  TL  H  +   + +    +G++ +GS D T+
Sbjct: 272 PGNKPRIASASKDGTIKVWDTVRRQCIL-TLSGHTSSVSCIKWGG--QGVIYTGSHDRTI 328

Query: 186 ALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTT 245
             WD+N        +++    H+  VN             ++S D  LK+       +  
Sbjct: 329 RCWDMNAGGKCINILKS----HAHWVNHL-----------SLSTDYALKVGAFDHTYSRP 373

Query: 246 GTAKCPEPFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296
            TA   E     A  ++            L+A A  D  +YL++     +PL  M+GH+ 
Sbjct: 374 ATA---EEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQK 430

Query: 297 AVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356
            V ++ FSP            N + +W              E    + I    GH ++V 
Sbjct: 431 LVNHVAFSP-DGRYIVSASFDNSIKLW--------------EGSSGKFISTFRGHVASV- 474

Query: 357 DFDLNAQIPW-----LVASTEEENILQVW 380
                 Q+ W     L+ S  ++  L+VW
Sbjct: 475 -----YQVAWSSDCRLLVSCSKDTTLKVW 498

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 4/123 (3%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSN 265
           HS  V D  ++  + DL  T S D+ +   D+R  N     T       + + +++  SN
Sbjct: 113 HSRAVTDITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWNYKQSN 172

Query: 266 LLAAA-GTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           +LA+A G D  V ++DLR    PL+ +S H  +V N++F+ H             +  WD
Sbjct: 173 ILASAQGND--VCIWDLRMGSTPLYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGTVKFWD 230

Query: 325 LKQ 327
             +
Sbjct: 231 YSK 233

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/129 (17%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + F+    +LLA    D++++ +D+R+   P +  +      + ++++ +          
Sbjct: 120 ITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWN-YKQSNILASAQ 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            N + +WDL+ +G+  TP          +   + H  +VN+ D N      + ++  +  
Sbjct: 179 GNDVCIWDLR-MGS--TP----------LYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSKS 234

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 103/257 (40%), Gaps = 46/257 (17%)

Query: 134 VATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           +A+ +  GT+ I+  +  +   T+  H  +   + +S   +G++ SGS D TV +WD+N 
Sbjct: 251 LASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSG--QGIIYSGSHDKTVRVWDMNA 308

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE 252
           +      +++    H+  VN             ++S D  L++           +AK   
Sbjct: 309 DGKCINILKS----HAHWVNHL-----------SLSTDYALRVGAFDHTGAQPASAK--- 350

Query: 253 PFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
                A +++            L+  A  D  ++L++     +P+  M+GH+  V ++ F
Sbjct: 351 DARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAF 410

Query: 304 SPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQ 363
           SP            N + +W            D  DG  + I    GH ++V     +A 
Sbjct: 411 SP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSAD 455

Query: 364 IPWLVASTEEENILQVW 380
              LV S  ++  L+VW
Sbjct: 456 CRLLV-SCSKDTTLKVW 471

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 85/199 (42%), Gaps = 30/199 (15%)

Query: 115 YKHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEG 174
           Y+  E+I    Y P+             VF         S +  H       +F+P    
Sbjct: 110 YRTTEDIITLIYTPR------------AVFKVKPVTRSSSAIAGHGSTILCSAFAPNTSS 157

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
            +++G+ D+T  +WD     D+  P  T +   + ++  S  +  N ++  T S D+ ++
Sbjct: 158 RMVTGAGDNTARIWDC----DTQTPKATLTGHFNWVLCVS--YCPNGEVIATGSMDNTIR 211

Query: 235 INDLR----VENTTTG-----TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK 285
           + D +    + +   G     T+   EP + +      S  LA+A  D  + ++D+   +
Sbjct: 212 LWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGE--SPRLASASKDGTIRIWDI-TRR 268

Query: 286 EPLHHMSGHEDAVTNLEFS 304
             L+ MSGH ++V+ +++S
Sbjct: 269 VCLYTMSGHTNSVSCIKWS 287

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 52/128 (40%), Gaps = 20/128 (15%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR----- 239
           + LWDVN      +PI   S   +D +   +++    D+  +   D+ + + DLR     
Sbjct: 201 IHLWDVN----RLKPISNLS-WGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 240 --VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
             +  T    A C  P     F          A  D + Y YD+RN+   L     H  A
Sbjct: 256 QKIVQTMRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNLSRSLTVFKDHVSA 307

Query: 298 VTNLEFSP 305
           V +++FSP
Sbjct: 308 VMDVDFSP 315

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 30/129 (23%)

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +  +LS SDD TV LW +N +  S +     S  +  + N+       + L  T   +S 
Sbjct: 133 QNFMLSCSDDKTVKLWSINVDDYSNKR----SSDNDSVTNE-------EGLVRTFDGESA 181

Query: 233 LKINDLRVENTT--TGTAKCP-------EPFNTLA----------FSHHSSNLLAAAGTD 273
            +  D   EN+T  TG AK         +P + L+          F+ + +++LA+ G+D
Sbjct: 182 FQGIDSHRENSTFATGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETDILASTGSD 241

Query: 274 SHVYLYDLR 282
           + + LYDLR
Sbjct: 242 NSIVLYDLR 250

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 85/203 (41%), Gaps = 20/203 (9%)

Query: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           F  EN + L   P  +  LL+G  +  + L D N      +   + + ++   + DS + 
Sbjct: 12  FGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDMKIIDSDFV 70

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT----- 272
             N  L  + S DS+ K+ D+R  +     AK     N+   S  S + L A GT     
Sbjct: 71  AGN--LISSASIDSV-KVFDIRSNDCV---AKINNETNSPFLSLDSRHGLLACGTELQGI 124

Query: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           D+ +++YD+R    PL  +   H D VT ++F P                ++DLKQ    
Sbjct: 125 DAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ---- 180

Query: 332 QTPDDAEDGVPELIMVHAGHKSA 354
              DD ED + ++I   + H   
Sbjct: 181 ---DDEEDALHQVINYASIHSCG 200

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 87/217 (40%), Gaps = 39/217 (17%)

Query: 156 LKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSK 215
            + H++   ALSF       L+SGS D  +  WD+       +    ++  HSDI   ++
Sbjct: 420 FELHKDEITALSFDSEA---LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 476

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
             N    L GT              E    G  +C   +N+          LA    D  
Sbjct: 477 SLNNGACLLGT--------------EAPMIGALQC---YNSA---------LATGTKDGI 510

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D +T+L+F              N + +WDL+      + A
Sbjct: 511 VRLWDLR-VGKPVRLLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSILDVIA 566

Query: 331 EQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWL 367
              P  + D   +LI V A ++  VN F++     W+
Sbjct: 567 YDLPVSSLDFDGKLITVGA-NEGGVNVFNMERDEHWM 602

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 20/203 (9%)

Query: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           F  EN + L   P  +  LL+G  +  + L D N      +   + + ++   V DS + 
Sbjct: 12  FGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT----- 272
             +  L  + S D++ K+ D+R   T    AK     N+   S  S + L A GT     
Sbjct: 71  AGH--LVSSASIDAV-KVFDIR---TNACVAKIHNEANSPFISLDSRHGLLACGTELQGI 124

Query: 273 DSHVYLYDLRNMKEPLHH-MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           D+ VY+YD+R    PL   +  H D VT ++F P                ++DLKQ    
Sbjct: 125 DAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ---- 180

Query: 332 QTPDDAEDGVPELIMVHAGHKSA 354
              D+ ED + ++I   + H   
Sbjct: 181 ---DEEEDALHQVINYASIHSCG 200

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 8/141 (5%)

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
            ++  P+     ++GS+D T+ +WD+     +T  ++T    H   V D    + +  LF
Sbjct: 144 CVAIDPVDNEWFITGSNDTTMKVWDL-----ATGKLKTTLAGHVMTVRDVAVSDRHPYLF 198

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNM 284
            +VSED  +K  DL                 T++  H + +L+A AG DS + L+D+R  
Sbjct: 199 -SVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDMRT- 255

Query: 285 KEPLHHMSGHEDAVTNLEFSP 305
           + P+  + GH+  +  ++ +P
Sbjct: 256 RIPVITLVGHKGPINQVQCTP 276

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 104/268 (38%), Gaps = 56/268 (20%)

Query: 128 PQNPGTVATINGQGTVFIYSRSEGLQS-TLKFHEENGYALSFSPLVEGLLLSGSDDHTVA 186
           P +   +AT +  GT+ I+  +  +   TL  H  +   + +    + +L SGS D T+ 
Sbjct: 245 PGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGG--KNVLYSGSHDKTIR 302

Query: 187 LWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTG 246
            WD+N N      +++    H+  VN             ++S D  L++     +  T  
Sbjct: 303 CWDMNLNGKCINILKS----HAHWVNHL-----------SLSTDYALRLGAFDHKGETPA 347

Query: 247 TAKCPEPFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
           +   PE     A  ++            L+  A  D  +YL++     +P+  M+GH+  
Sbjct: 348 S---PEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKL 404

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357
           V ++ FSP            N + +W            D  DG  + +    GH ++V  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASV-- 447

Query: 358 FDLNAQIPW-----LVASTEEENILQVW 380
                Q+ W     L+ S  ++  L+VW
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 90/242 (37%), Gaps = 28/242 (11%)

Query: 79  NLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNP 131
           NL + IL    P  +  ED       PR+  K+       +A   H   I  + + P   
Sbjct: 100 NLYQSILK---PGLKTTEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTS 156

Query: 132 GTVATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDV 190
             + T  G  T  I+   ++    TL+ H       S+SP  E L+ +GS D+T+ LW+ 
Sbjct: 157 SRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDGE-LIATGSMDNTIRLWES 215

Query: 191 NGNSDSTRPIRTWSDLHSDIVNDSKWHNF------NKDLFGTVSEDSLLKINDL--RVEN 242
           +        +R     HS  +    W         +K    T S+D  +KI D   RV  
Sbjct: 216 SKGKPYGDALRG----HSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCL 271

Query: 243 TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
            T     C    +         N+L +   D  +  +D+    + ++ +  H   V +L 
Sbjct: 272 LTL----CGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLS 327

Query: 303 FS 304
            S
Sbjct: 328 LS 329

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 25/182 (13%)

Query: 165 ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           +  ++P+   +L+S S D T  +WD+     S+  ++T    H   V D ++   +  LF
Sbjct: 240 SFHWNPVDTNILISSSIDTTCIVWDLQ----SSNYVKTQLIAHDSEVFDVRFLTQSTQLF 295

Query: 225 GTVSEDSLLKINDLRVENTTTGTAKCP--EP------------------FNTLAFSHHSS 264
            +   D  +++ DLR    +T   + P  EP                     L  S H  
Sbjct: 296 ASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDP 355

Query: 265 NLLAAAGTDSH-VYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMW 323
           N+LA     S+ + + D+RN   PL  ++GH  ++  +++ P             +++ W
Sbjct: 356 NVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFW 415

Query: 324 DL 325
           D+
Sbjct: 416 DI 417

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 83/200 (41%), Gaps = 26/200 (13%)

Query: 162 NGYALSFSPL--VEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF 219
           N +   F PL    GLLLS S+     L D  G   S + IR  S+L    +ND K  N 
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCL-DF-GTCQSKQSIRV-SNLS---INDLKILNS 70

Query: 220 N---KDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFSHHSSNLLAAA---- 270
           +     LF T + +S+ KI D+   N    T    +  PF +L   H    LLA      
Sbjct: 71  DFHCGSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQ 126

Query: 271 GTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIG 329
           G D+ + +YD+R    PL  +   H D VT L+F P                ++DL Q  
Sbjct: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ-- 184

Query: 330 AEQTPDDAEDGVPELIMVHA 349
             Q  DDA   V     +H+
Sbjct: 185 --QDEDDALHQVMNYASIHS 202

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 20/128 (15%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR----- 239
           + LWD    S+ + P+   S   +D +   K++    D+F +   D+ + + DLR     
Sbjct: 195 IQLWD----SNRSTPLSNLS-WGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPT 249

Query: 240 --VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
             +  T    A C  P     F             D + Y YD+RNM   ++    H  A
Sbjct: 250 QKIVQTMRTNAICWNPMEAFNF--------VIGNEDHNAYYYDMRNMSRAINVFKDHVSA 301

Query: 298 VTNLEFSP 305
           V +++FSP
Sbjct: 302 VMDVDFSP 309

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 85/193 (44%), Gaps = 9/193 (4%)

Query: 116 KHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEG 174
           K   E  R     +N     T +    + I++ S G Q  TL  H  +  +  + P + G
Sbjct: 167 KAHTECIRDIAFSKNDSKFVTCSDDNILKIWNFSNGKQERTLSGHHWDVKSCDWHPEM-G 225

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           L++S S D+ + LWD      S + + T  +    ++  +K+     +L   +S+D   +
Sbjct: 226 LIVSASKDNLIKLWD----PRSGQCVSTLLNFKHTVLK-TKFQPTKGNLLAAISKDKSCR 280

Query: 235 INDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYD-LRNMKEPLHHM-S 292
           + D+R         +    + TL +   + ++   A  D  +  +D L+N++EP   +  
Sbjct: 281 VFDIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQVIPY 340

Query: 293 GHEDAVTNLEFSP 305
            H+  +T+L ++P
Sbjct: 341 AHDKCITSLSYNP 353

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 104/263 (39%), Gaps = 58/263 (22%)

Query: 134 VATINGQGTVFIY--SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVN 191
           +A+ +  GT+ I+  SR   L  TL  H  +   + +    +GLL +GS D T+ +WD+ 
Sbjct: 251 LASASKDGTIKIWDASRRTCLY-TLSGHTNSVSCVKWGG--QGLLYTGSHDKTIRVWDIK 307

Query: 192 GNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCP 251
                   +++    H+  VN             ++S D  +++     +   + +   P
Sbjct: 308 AGGKCINILKS----HAHWVNHL-----------SLSTDYAIRVGPFGPDGKASPS---P 349

Query: 252 EPFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLE 302
           +    +A  ++            L+  A  D  ++L++     +PL  M+GH+  V ++ 
Sbjct: 350 QEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVA 409

Query: 303 FSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNA 362
           FSP            N + +W            D  DG  + I    GH ++V       
Sbjct: 410 FSPD-GRYIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVY------ 448

Query: 363 QIPW-----LVASTEEENILQVW 380
           Q+ W     L+ S  ++  L+VW
Sbjct: 449 QVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 82/212 (38%), Gaps = 23/212 (10%)

Query: 103 PAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIY-SRSEGLQSTLKFHEE 161
           P  RS+  I     H   I  + + P     + T  G  T  I+   ++   S LK H  
Sbjct: 131 PITRSSAAIAG---HGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSN 187

Query: 162 NGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDL---HSDIVNDSKWHN 218
               +++SP  E L+ +GS D+T+ LW+    S + +P   W D    HS  +    W  
Sbjct: 188 WVLCVAWSPDGE-LIATGSMDNTIRLWE----SKAGKP---WGDAMKGHSKWITSLTWEP 239

Query: 219 F------NKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT 272
                  +K    + S+D  +KI D          +      + + +      LL     
Sbjct: 240 LHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWG--GQGLLYTGSH 297

Query: 273 DSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           D  + ++D++   + ++ +  H   V +L  S
Sbjct: 298 DKTIRVWDIKAGGKCINILKSHAHWVNHLSLS 329

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/356 (19%), Positives = 131/356 (36%), Gaps = 57/356 (16%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P   Q P       + +    +  E+E  ++  +INL  
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPARAQ-PRTFATCSDSLXXFWSLTEDETAIQ-EQINL-- 184

Query: 83  EILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTV--ATINGQ 140
            +  +   Q E G++           +           IT   + P +P  +  ++I+  
Sbjct: 185 SLCKHNKQQSEKGKE----------LVGTNGVLGELPPITSFHWNPTDPNLLISSSIDTT 234

Query: 141 GTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPI 200
             V+    +  +++ L  H+   + + F      L  S   D +V ++D+   +      
Sbjct: 235 CIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLA------ 288

Query: 201 RTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFS 260
                 HS I+ +    +   DL       +LL++               P PF+     
Sbjct: 289 ------HSTIIYEPTIPDGAPDLPSPTVPPALLRLE--------------PSPFD----- 323

Query: 261 HHSSNLLAAAGTD-SHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNR 319
               N++A    D S V + D+R+   PL  +  H   +  +++ P             +
Sbjct: 324 ---PNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQ 380

Query: 320 LIMWDLK-QIGAEQTPDDAEDGVPELI-----MVHAGHKSAVNDFDLNAQIPWLVA 369
           ++ WDL   + +E T D   D  P+       M +A     VN+     Q  W  A
Sbjct: 381 VLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 20/128 (15%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR----- 239
           + LWD    +  ++P+   S   +D V   K++    D+  +   D+ + + DLR     
Sbjct: 195 IELWD----TGRSKPVSNLS-WGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPT 249

Query: 240 --VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
             +  T    A C  P     F          A  D + Y YD+RNM   L+    H  A
Sbjct: 250 QKIVQTMRTNAICWNPMEAFNF--------VIANEDHNAYYYDMRNMSRALNVFKDHVSA 301

Query: 298 VTNLEFSP 305
           V +++FSP
Sbjct: 302 VMDVDFSP 309

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 87/222 (39%), Gaps = 53/222 (23%)

Query: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232
           +G+L SGS D TV +WD+N        ++          N + W N       ++S D  
Sbjct: 289 QGVLYSGSHDKTVRVWDMNLGGKCINILK----------NHAHWVNHL-----SLSTDYA 333

Query: 233 LKINDLRVENTTTGTAKCPEPFNTLAFSHH---------SSNLLAAAGTDSHVYLYDLRN 283
           L+      ++T T  A  PE     A  ++         +  L+  A  D  ++L++   
Sbjct: 334 LRRGPF--DHTGTKMAS-PEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLWNPLK 390

Query: 284 MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 343
             +PL  M+GH+  V ++ FSP            N + +W            D  DG  +
Sbjct: 391 SNKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--K 435

Query: 344 LIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            +    GH S+V       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FLSTFRGHVSSV------YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 67/173 (38%), Gaps = 22/173 (12%)

Query: 79  NLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNP 131
           NL   IL    P     ED       PR+  K+       +A   H   I  + + P   
Sbjct: 100 NLYSSILK---PGYHGTEDIITLVYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTS 156

Query: 132 GTVATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDV 190
             + T  G  T  I+   ++   +TL  H+     +S+SP  E ++ +GS D+T+ LW+ 
Sbjct: 157 SRMVTGAGDNTARIWDCDTQTPMTTLTGHQNWVLCVSWSPDGE-IIATGSMDNTIRLWES 215

Query: 191 NGNSDSTRPIRTWSDLHSDIVNDSKWHNFN------KDLFGTVSEDSLLKIND 237
           +       P+R     H   +    W   +      K    + S+D  +KI D
Sbjct: 216 DRGKPLGEPLRG----HLKWITSLSWEPLHLVKAGEKPRLASASKDGTIKIWD 264

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 2/122 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV-ENTTTGTAKCPEPFNTLAFSHHSSN 265
           HS  + D  +   + D+  T S D+ +   D+R  +     T+        + ++H   N
Sbjct: 113 HSRAITDINFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVN 172

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           ++A++  D  V+++DLRN   PL  +S HE +V +++F+               +  WD 
Sbjct: 173 IMASSHGDD-VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDY 231

Query: 326 KQ 327
            +
Sbjct: 232 SR 233

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/130 (19%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 257 LAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXX 316
           + FS    ++LA    D++V+ +D+R+ + P +  S  + +   ++++ H          
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWN-HSDVNIMASSH 178

Query: 317 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENI 376
            + + +WDL+            +G   L  + + H+S+VN  D N      + S+  +  
Sbjct: 179 GDDVFIWDLR------------NGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSSSNDGT 225

Query: 377 LQVWKCSHSL 386
           ++ W  S ++
Sbjct: 226 VKFWDYSRNV 235

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 143 VFIYSRSEGLQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN-SDSTRP 199
           VFI+    G     K   HE +  ++ F+      ++S S+D TV  WD + N  DS R 
Sbjct: 182 VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYSRNVEDSLRT 241

Query: 200 IRT 202
           I T
Sbjct: 242 IHT 244

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 103/268 (38%), Gaps = 56/268 (20%)

Query: 128 PQNPGTVATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVA 186
           P     +A+ +  GT+ I+  +  +   TL  H  +   + +    +G+L SGS D T+ 
Sbjct: 245 PGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGG--QGVLYSGSHDKTIR 302

Query: 187 LWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTG 246
            WD+N        +++    H+  VN             ++S D  L+I      + T+ 
Sbjct: 303 AWDMNLGGKCINILKS----HAHWVNHL-----------SLSTDYALRIGAF---DHTSE 344

Query: 247 TAKCPEPFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
               PE     A  ++            L+  A  D  +YL++     +P+  M+GH+  
Sbjct: 345 KPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKL 404

Query: 298 VTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVND 357
           V ++ FSP            N + +W            +  DG  + I    GH ++V  
Sbjct: 405 VNHVAFSP-DGRHIVSASFDNSIKLW------------NGRDG--KFISTFRGHVASV-- 447

Query: 358 FDLNAQIPW-----LVASTEEENILQVW 380
                Q+ W     L+ S  ++  L+VW
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 74/193 (38%), Gaps = 23/193 (11%)

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKI------- 111
            ++     GE E  +   + NL   IL    P  +  ED       PR+  K+       
Sbjct: 81  CMVAGKDKGESEQMIDIKD-NLYNSILK---PGLKTTEDFITLVYTPRAVFKVKPVTRSS 136

Query: 112 TAKYKHEEEITRARYMPQNPGTVATINGQGTVFIY-SRSEGLQSTLKFHEENGYALSFSP 170
           +A   H   I  + + P     + T  G  T  I+   ++   STLK H      +S+SP
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSP 196

Query: 171 LVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFN------KDLF 224
             E L+ +GS D+T+ LW+ N        +R     H   +    W   +      K   
Sbjct: 197 DGE-LIATGSMDNTIRLWEGNKGQPVGDALRG----HGKWITSLSWEPIHLVKPGQKPRL 251

Query: 225 GTVSEDSLLKIND 237
            + S+D  +KI D
Sbjct: 252 ASASKDGTIKIWD 264

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 17/141 (12%)

Query: 220 NKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAA----AGTDS 274
           N DLF + S+DS+ KI D+R  +   T       PF +L   H   ++LA     +G D+
Sbjct: 70  NSDLFASASKDSV-KIFDVRTSSCVATLHNDKSAPFLSLDSRH---DMLACGTELSGVDA 125

Query: 275 HVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQT 333
            +++YD++ + +PL   +  H D +T+ +F P              + ++DL       T
Sbjct: 126 ELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDL-------T 178

Query: 334 PDDAEDGVPELIMVHAGHKSA 354
             D ED + ++I   + H   
Sbjct: 179 NSDEEDALHQVINFASVHSCG 199

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 2/119 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKC-PEPFNTLAFSHHSSN 265
           HS  + D  +H  N ++  T S D+ +   D+R       +A         + ++  + N
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPN 172

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           ++A+A ++  ++++DLR    PLH + GH ++V +++FS               +  WD
Sbjct: 173 VMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 122 TRARYMPQNPGTVATINGQGTVFIYSRSEGLQ--STLKFHEENGYALSFSPLVEGLLLSG 179
            + ++  +NP  +A+ +    +FI+   +G      LK H  +  ++ FS   E  ++S 
Sbjct: 162 AQVKWNFKNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSS 220

Query: 180 SDDHTVALWDVNGNSDSTRPIRT 202
           S+D TV  WD + N     P+RT
Sbjct: 221 SNDGTVKFWDYSVN--DKEPLRT 241

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 8/139 (5%)

Query: 167 SFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           +  P+     ++GS+D T+ +WD+     +T  ++T    H   V D    + +  LF +
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDL-----ATGKLKTTLAGHVMTVRDIAVSDRHPYLF-S 199

Query: 227 VSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE 286
           VSED  +K  DL   +             T++  H + +L+A AG DS V L+D+R  + 
Sbjct: 200 VSEDKTVKCWDLEKNHIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RM 257

Query: 287 PLHHMSGHEDAVTNLEFSP 305
           P+  + GH+  +  ++ +P
Sbjct: 258 PVITLVGHKGPINQVQCTP 276

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 66/160 (41%), Gaps = 26/160 (16%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV-ENTTTGTAKCPEPFNTLAFSHHSSN 265
           H+  + D  +H  + +L  T S D+ +   D+R  +    GT+      + + ++   +N
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMRCSQRPFYGTSDWSSGASQVKWNFKDAN 172

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           ++A++   S V+++D+R    PL+ ++G   +V N++F+ +             +  WD 
Sbjct: 173 IIASSHA-STVFIWDIRKGSVPLYRLNGSGSSVNNIDFNRNNECEIMSSYNDGTIKFWDY 231

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIP 365
                                   GH+ A   F +NA  P
Sbjct: 232 ------------------------GHEPASAQFTINADFP 247

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 20/129 (15%)

Query: 184 TVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENT 243
           T+ LWD    +  ++P+   S   +D +   K++    D+  +   D+ + + D+R  + 
Sbjct: 194 TIQLWD----TARSKPLSNLS-WGADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSP 248

Query: 244 TTG-------TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296
           T          A C  P     F          A  D + Y YD+RNM   L+    H  
Sbjct: 249 TQKIVQRLRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNMSRALNVFKDHVS 300

Query: 297 AVTNLEFSP 305
           AV +++F+P
Sbjct: 301 AVMDVDFAP 309

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 88/214 (41%), Gaps = 12/214 (5%)

Query: 97  DDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQ-ST 155
           D E+    P  N+       H E +    + P +   V+  +    + I++ S G Q   
Sbjct: 144 DGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVS-CSDDNVLKIWNFSNGQQERV 202

Query: 156 LKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSK 215
           L  H  +  +  + P + GL++SGS D+ +  WD    S     + T       I++ +K
Sbjct: 203 LSGHHWDVKSCDWHPKM-GLIVSGSKDNLIKFWDPRSGS----CVSTMLGFKHTIIS-TK 256

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           +     +L   +S+D   K+ D+R +     + +    + TL +      +      D  
Sbjct: 257 FQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGS 316

Query: 276 VYLYDLRNMKE---PLHHM-SGHEDAVTNLEFSP 305
           +  +DL    +   P H++   HE  VT+L +SP
Sbjct: 317 IKHFDLSQENQPNKPTHNIPYAHEKCVTSLAYSP 350

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 113/280 (40%), Gaps = 52/280 (18%)

Query: 132 GTVATINGQGTVF-IYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWD 189
           GT+ + + Q  +  ++  + G+Q   L+ H      +        +L++GS D T+ +WD
Sbjct: 334 GTLCSASYQDRIVKVWDLNHGVQVGELRGHLATVNCMQMDKTNYNILITGSKDATLKMWD 393

Query: 190 VNGNSD---STRPIRTWSDLHSDIVNDSKWHNF--NKDLFGTVSEDSLLKIN---DLRVE 241
           +N + +      P+R   ++   I+     HNF  + D    +S DS   I+   D ++ 
Sbjct: 394 LNLSKELYLDHSPLR--QNMEETIITPC-IHNFELHNDEITALSFDSEALISGSKDKKIF 450

Query: 242 NTTTGTAKCPEPFNTLAFSHHS-----------------------------SNLLAAAGT 272
           +    T KC +  N +    H+                             ++ LA    
Sbjct: 451 HWDLATGKCVQELNLIFTPTHNDTKTSTRSGKNGTYLLGTEAPMIGALQCYNSALATGTK 510

Query: 273 DSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----Q 327
           D  V L+DLR + +P+  + GH D +T+L+F              N + +WDL+      
Sbjct: 511 DGVVRLWDLR-IGKPVRSLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSIVD 566

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWL 367
           + A   P  + D   +LI V A  +  VN F++     W+
Sbjct: 567 VIAYDLPVTSLDFDDKLITVGANER-GVNIFNMERDEHWM 605

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 73/148 (49%), Gaps = 10/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHN 218
           H  +    +F  L +   ++GS D  +AL D++    + R +R ++  H+ +VN  +   
Sbjct: 117 HRRSAAITTFDTLDDTRAVTGSSDTRLALVDLH----TGRKLRNFAG-HTRVVNQVR--A 169

Query: 219 FNKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
            N D F +VS+D  LKI D   ++     +++ P    T + S    N+L  +G D  + 
Sbjct: 170 LNTDRFASVSDDGALKIWDAHTKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPVIR 229

Query: 278 LYDLR--NMKEPLHHMSGHEDAVTNLEF 303
            YDLR  N +E  +  + H D+VT++  
Sbjct: 230 AYDLRQNNGQELFNWSTPHTDSVTSIHI 257

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 83/202 (41%), Gaps = 19/202 (9%)

Query: 141 GTVFIYSRS-EGLQSTLKFHEENGYA--LSFSPLVEGLLLSGSDDHTVALWDVN---GNS 194
           G V ++S + + L+S  +F +  G A  + F+     +L SG     + +WD+N    NS
Sbjct: 84  GVVELFSSTGDSLKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIYIWDLNTCLKNS 143

Query: 195 DSTRPIRTW-SDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEP 253
           +   P+    +    + V    W+     +F +    S   I DL+ +      +    P
Sbjct: 144 EGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSYA-SP 202

Query: 254 FNTLAFS--------HHSSNLLAAAGTDSH--VYLYDLRNMKEPLHHMS-GHEDAVTNLE 302
              L            +S+ +  A G+D+   + ++DLRN   PL  +S GH   + +L+
Sbjct: 203 STGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLSKGHSKGILSLD 262

Query: 303 FSPHXXXXXXXXXXXNRLIMWD 324
           +              N +++W+
Sbjct: 263 WCSQDEELLLSSGRDNTIVLWN 284

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 13/129 (10%)

Query: 118 EEEITRARYMPQNPGTVATINGQGT---VFIYSRSEG---LQSTLKFHEENGYALSFSPL 171
           + +++   + P+N   VAT  G  T   + ++        LQ   K H +   +L +   
Sbjct: 207 KSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLSKGHSKGILSLDWCSQ 266

Query: 172 VEGLLLSGSDDHTVALWDVNGNSDSTR-PIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED 230
            E LLLS   D+T+ LW+     + T+ P R       +    +K+     DLF + S D
Sbjct: 267 DEELLLSSGRDNTIVLWNPESGQELTQFPTR------GNWCFKTKFAPEAPDLFASASFD 320

Query: 231 SLLKINDLR 239
           + +++  L+
Sbjct: 321 NKIQVQTLQ 329

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 26/131 (19%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR----- 239
           + LWD+N      +P+   S    D +   K++    DL  +   D+ + + DLR     
Sbjct: 197 IELWDIN----RRKPLSNLS-WGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPT 251

Query: 240 --VENTTTGTAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGH 294
             +  T    + C    EPFN              A  D + Y YD+RNM   LH    H
Sbjct: 252 QKIVQTMKTNSMCWNPMEPFN-----------FVTANEDQNAYYYDMRNMSRALHVFKDH 300

Query: 295 EDAVTNLEFSP 305
             A+ +++ SP
Sbjct: 301 VSAIMDVDISP 311

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 16/133 (12%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR--------VENTTTGTAKCPEPFNTLA 258
           H   + D  +H    ++  T S D+     D+R          N  +G A+       + 
Sbjct: 113 HFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQ-------VK 165

Query: 259 FSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXN 318
           ++H +SN+LA + ++  VY++D+R    PL  + GH  +V +++F+P             
Sbjct: 166 WNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDG 224

Query: 319 RLIMWDLKQIGAE 331
            +  WD  ++  E
Sbjct: 225 TVKFWDYNKVEDE 237

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 92/229 (40%), Gaps = 63/229 (27%)

Query: 115 YKHEEEITRARYMPQNPGTVATINGQGTVFIY--SRSEGLQSTLKFHEENGYALSFSPLV 172
           Y H + +        +   +AT +G G V  +  S SE L S  K H      L  SP++
Sbjct: 64  YGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEELCS-FKAHYGIVTGLCVSPVL 122

Query: 173 EG------LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFN-----K 221
                    +LS  DD TV LW V+            +D ++D+ +D    N N     K
Sbjct: 123 ASKNKNLQYMLSCGDDKTVKLWSVD------------TDDYADVKDD---QNLNTRGLLK 167

Query: 222 DLFGT---------------VSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNL 266
             +G                V+  + +++ D     +T+  +   +   ++ F+ + SN+
Sbjct: 168 TFYGDHSFQGIDHHRSNSAFVTGGAQIQLWDTSRSKSTSNLSWGADNITSVKFNQNDSNI 227

Query: 267 LAAAGTDSHVYLYDLR-------------------NMKEPLHHMSGHED 296
           LA+ G+D+ + LYDLR                   N  EP + ++G+ED
Sbjct: 228 LASTGSDNSIVLYDLRTNSPTQKIVQQMRTNSLCWNPMEPFNFVTGNED 276

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 6/121 (4%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWD +  S ST  + +W    +D +   K++  + ++  +   D+ + + DLR  + T
Sbjct: 194 IQLWDTS-RSKSTSNL-SWG---ADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPT 248

Query: 245 TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
               +     N+L ++            D + Y YD+R M   L+    H  AV +++F+
Sbjct: 249 QKIVQQMRT-NSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFA 307

Query: 305 P 305
           P
Sbjct: 308 P 308

>AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR429W
           (CRN1); 1-intron
          Length = 633

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 156 LKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSK 215
           L  H+     + + P  +G+L S S DHTV LW+V      T PI      H D+V  S 
Sbjct: 136 LTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVE---QGTNPIVL---THPDMVT-SM 188

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG---- 271
             ++      TV  D +L++ D+R     +       P N       +S+ LA  G    
Sbjct: 189 SFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKL 248

Query: 272 TDSHVYLYDLRNMKE 286
           +D  + ++D  N+++
Sbjct: 249 SDRQIAVWDAFNLEK 263

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 69/172 (40%), Gaps = 18/172 (10%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  E +L+SGSDD  + +W++            +GN +   P++  +  H   V    
Sbjct: 89  FDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFLTG-HQRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           +H   + +  + S D  +++ ++  + T       P+   +++FS +    LA    D  
Sbjct: 148 YHPTAQGVLASSSLDHTVRLWNVE-QGTNPIVLTHPDMVTSMSFS-YGGTYLATVCRDKM 205

Query: 276 VYLYDLRN---MKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           + ++D+R    + E + H       V  L  S              ++ +WD
Sbjct: 206 LRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWD 257

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 18/161 (11%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG-NSDSTRPIRTWSDLHSDI 210
           L+ TL+ H     +LS SP    +LLSGS D T+  W + G +     P+R++   HS I
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG-HSHI 83

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPF-----NTLAFSHH-SS 264
           V D    +  K    + S D  L++ DL+       + KC + F     + ++ S    +
Sbjct: 84  VQDCTVTHDGKYAL-SASWDKTLRLWDLQ-------SGKCIKRFVGHKSDVMSVSIDPRA 135

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
             + +A  D  V +++   + + +  + GH D V+N+  +P
Sbjct: 136 TQIVSASRDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAP 174

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 55/131 (41%), Gaps = 26/131 (19%)

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT 244
           + LWD N ++  T    +W    +D +   K++    D+  +   D+ + + DLR  + T
Sbjct: 201 IELWDNNRSTPLTNL--SWG---ADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPT 255

Query: 245 TG-------TAKC---PEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGH 294
                     A C    EPFN              A  D + Y YD+RNM   L+    H
Sbjct: 256 QKIVQSMRTNAICWNPMEPFN-----------FVVANEDHNAYYYDMRNMSRSLNVFKDH 304

Query: 295 EDAVTNLEFSP 305
             AV +++FSP
Sbjct: 305 VSAVMDVDFSP 315

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 8/154 (5%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIV 211
           L   +K H      +   P+      +GS+D T+ +WD+     ++  ++     H+  V
Sbjct: 103 LMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDL-----ASGKLKITLSGHAMTV 157

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG 271
            D    N +  LF + SED L K  DL                +T+   H + +L+A AG
Sbjct: 158 RDIAISNRHPYLF-SASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDI-HPTLDLIATAG 215

Query: 272 TDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
            DS V L+D+R+ + P+  + GH+  +  +   P
Sbjct: 216 RDSVVKLWDIRS-RVPVVTLIGHKSPINKVHCLP 248

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 115/294 (39%), Gaps = 68/294 (23%)

Query: 87  NEDPQEEAGEDDEVSAPAP-------RSNIKITAKYKHEEEITRARYMPQNPGTVATING 139
           +ED  E   E++E   PA        +S IK + +  H   + R R + +N      ++G
Sbjct: 102 SEDLGEGKAEEEEFYTPASWQLIESRKSIIKYSMENAHAR-LLRQRRIAENLSIKKLLSG 160

Query: 140 QGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG-----NS 194
           +           L   L+  E  G  L     V  + +S  DD  VA  +  G     NS
Sbjct: 161 R---------RNLNKKLRTLELAGSQLVAEKPVSEVCVS-KDDVYVASGNWGGHIKVLNS 210

Query: 195 DSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDL---------------- 238
           D+   ++++ ++HS  V    WH     L  +   D+L+KI +L                
Sbjct: 211 DTLDIVKSFDNVHSGKVCGLDWHPTANSLL-SGGADNLVKITNLDQGSCAELKDHVGRVC 269

Query: 239 RVENTTTGTAKCPEPFN-------------------------TLAFSHHSSNLLAAAGTD 273
           +V+   +G       F+                         TL F    S LLA+ G D
Sbjct: 270 KVKFHPSGKFAASASFDMTWILWDLEKALAIQLQEGHSREVFTLGFQTDGS-LLASGGLD 328

Query: 274 SHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQ 327
           S   ++DLR+  EP+ ++ GH+  +  L++SP+           + + +WDL++
Sbjct: 329 SIGLIWDLRS-GEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGS-IKIWDLRK 380

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 93/232 (40%), Gaps = 42/232 (18%)

Query: 111 ITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIYS--RSEGLQSTLKFHEENGYALSF 168
           I+   +H++E+    +   N  T  + +  GTV I+S  R E L + +    E       
Sbjct: 97  ISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMER------ 150

Query: 169 SPLVE----GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLF 224
           SPLVE    G+ LS   +H++                     + D +  +++   + +L 
Sbjct: 151 SPLVEAKAGGIPLSNQQNHSII------------------SKNKDCIYQAQFSPHDPNLI 192

Query: 225 GTVSEDSLLKINDLRV-ENTTTGTAKCPEPFNTLA--FSHHSSNLLAAAGTDSHVYLYDL 281
              + +S + + DLR   NT            TL   F+ +  +++A  G D  V ++DL
Sbjct: 193 MCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDL 252

Query: 282 RNMKE---PLHH------MSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           R +++   PL        + GHE A+  + +SPH               +WD
Sbjct: 253 RMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVWD 304

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 92/241 (38%), Gaps = 49/241 (20%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           +L+   D ++ L+D+N       PI  + + H   V    W+  NK  F + S D  +KI
Sbjct: 76  VLAAQGDGSLRLFDIN---LPQYPISIFQE-HQKEVFSCNWNLVNKQTFVSSSWDGTVKI 131

Query: 236 -NDLRVENTTTGT----------------------------AKCPEPFNTLAFSHHSSNL 266
            + +R E+ TT                              +K  +      FS H  NL
Sbjct: 132 WSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNL 191

Query: 267 LAAAGTDSHVYLYDLR-----NMKEPLHHMSGHEDAVTNL-EFSPHXXXXXXXXXXXNRL 320
           +     +S+V L+DLR     N +  + H  G E    +  ++ PH           ++L
Sbjct: 192 IMCCAGNSYVTLFDLRQPTNTNQQNFMSH-GGLETLTCDFNKYRPH----IVATGGVDKL 246

Query: 321 I-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQV 379
           + +WDL+ +     P      + E+     GH+ A+     +     LV ST  +   +V
Sbjct: 247 VKIWDLRMVRKFSNPLQQPMSINEI----PGHELAIRKVSWSPHHSNLVLSTSYDMTCRV 302

Query: 380 W 380
           W
Sbjct: 303 W 303

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGY---------------- 164
           I+R ++MPQN   +AT +    ++    S   Q  L  ++   +                
Sbjct: 133 ISRIQWMPQNNTRLATCSDSLRIWSLDGSLQEQINLSLYKYGKHPSSASQKDTVTLGQLP 192

Query: 165 ---ALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNK 221
              +  +SP+   LLLS S D T  +WD+   S+ST  ++T    H   V D K+   + 
Sbjct: 193 PVTSFHWSPISPNLLLSCSIDTTCTVWDL---SNSTNYVKTQLIAHDSEVFDVKFLAQST 249

Query: 222 DLFGTVSEDSLLKINDLR 239
            LF +   D  +++ DLR
Sbjct: 250 QLFASCGGDGSVRVFDLR 267

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 64/153 (41%), Gaps = 24/153 (15%)

Query: 171 LVEGLLLSGSDDHTVALWDVNGNSDS-----------------TRPIRTWSDLHSDIVND 213
           L   +++S   D TV LW+V+   +S                 T  I   S  H ++V+ 
Sbjct: 418 LTYNMVISAGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTDEITAISSYHENLVSG 477

Query: 214 SKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTA---KCPEPFNTLAFSHHSSNLLAAA 270
           S+     +    T     +L I  L  +    GT    + P P   L     +   LA  
Sbjct: 478 SRDKTIRQWDLKTGKCIQILNIGFLNSQKELLGTVDPIRSPPPIGALQCRDAA---LATG 534

Query: 271 GTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
           G D  V L+DLR + + +  +SGHE+A+T L+F
Sbjct: 535 GQDGIVRLWDLR-IGKVVRSLSGHENAITALKF 566

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  L S +DD  +A+W++            +G     +P++  S  H   V    
Sbjct: 89  FDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKILSG-HKRKVGHIL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           +H   +++  + S D  +KI D+  E     T   P+   +++FS++  N LA    D  
Sbjct: 148 YHPVAQNVLASSSLDYTVKIWDIENEKDML-TLTHPDMVTSMSFSYN-GNFLATVARDKK 205

Query: 276 VYLYDLRNMK 285
           + ++D+R  K
Sbjct: 206 LRVWDVREGK 215

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 156 LKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSK 215
           L  H+     + + P+ + +L S S D+TV +WD+    D        +  H D+V  S 
Sbjct: 136 LSGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKD------MLTLTHPDMVT-SM 188

Query: 216 WHNFNKDLFGTVSEDSLLKINDLR 239
             ++N +   TV+ D  L++ D+R
Sbjct: 189 SFSYNGNFLATVARDKKLRVWDVR 212

>NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}
           Anc_1.534 YKL213C
          Length = 722

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 9/133 (6%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIV 211
           L+  LK HE + +     P VE   +S S D T+ +W+ N        I+T   +H+D++
Sbjct: 134 LKYDLKGHEASVWCAKSFPGVENKYVSVSADQTIKIWENN------VAIKTLGGIHTDVI 187

Query: 212 NDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCP-EPFNTLAFSHHSSNLLAAA 270
              +    N +   T S DS +K+++  +E+       C  E F       + SN L + 
Sbjct: 188 RRVEISKSNPNEIITCSNDSTIKLSN--IESGEIIRNWCGHESFVYSVKQFNLSNDLVSC 245

Query: 271 GTDSHVYLYDLRN 283
           G D  V ++D  N
Sbjct: 246 GEDRSVIIWDSNN 258

>KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON}
           similar to uniprot|P36037 Saccharomyces cerevisiae
           YKL213C DOA1 WD repeat protein required for ubiquitin-
           mediated protein degradation forms complex with Cdc48p
           plays a role in controlling cellular ubiquitin
           concentration also promotes efficient NHEJ in
           postdiauxic/stationary phase
          Length = 714

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 11/129 (8%)

Query: 151 GLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI 210
            L+  L  H+ + + +   P V G  L+ S D TV LW+        + ++T+S+LH+D+
Sbjct: 134 ALKHELVGHKASVWDVKMLPEV-GFYLTASADGTVKLWE------GEKVLKTFSNLHTDV 186

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAA 270
           V        + D F + S D  +KIND+  +  T  T K  E F      +     L + 
Sbjct: 187 VRHLDISP-DGDQFASCSNDGTIKINDM--DGNTLRTLKGHESF-VYCVKYTPCGGLVSC 242

Query: 271 GTDSHVYLY 279
           G D  V ++
Sbjct: 243 GEDRSVRVW 251

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 135 ATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           A+ +  GT+ I         TLK HE   Y + ++P   G L+S  +D +V +W  +G
Sbjct: 200 ASCSNDGTIKINDMDGNTLRTLKGHESFVYCVKYTPC--GGLVSCGEDRSVRVWGPDG 255

>KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} similar
           to uniprot|P42935 Saccharomyces cerevisiae YGR200C ELP2
           Elongator protein part of the six- subunit RNA
           polymerase II Elongator histone acetyltransferase
           complex target of Kluyveromyces lactis zymocin
          Length = 790

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 69/165 (41%), Gaps = 15/165 (9%)

Query: 150 EGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSD 209
            G+ +TLK H+     + F P  E  +++ S+D  V LW  +G  +S       +D H  
Sbjct: 49  RGVYATLKGHDAEVTCVRFVPGTE-FMITASEDSQVRLWAFDGEDNSAMACIQSTDHHKH 107

Query: 210 IVNDSKWHNFNKDLFGTVSED---SLLKINDLRVENTTTGTAKCPEPFNTLAFS--HHSS 264
            +      +   +L      D   S+ +IN+ ++    +   K       +A      S 
Sbjct: 108 TITS---LSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVFPLCMALKSVEDSK 164

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHH------MSGHEDAVTNLEF 303
            LLA  GT+S+V++Y        L +      + GHED +  ++F
Sbjct: 165 VLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDF 209

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 151 GLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDI 210
            LQ +L+ H+ + +      + E   ++ S D TV LW  N      + ++T+S +HSD+
Sbjct: 132 ALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWKEN------KLLKTFSGIHSDV 185

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDL--RVENTTTGTAKCPEPFNTLAFSHHSSNLLA 268
           + + +  +  K++  T S D  +KI+DL   ++   +G     E F          + L 
Sbjct: 186 IRNIEVLSSGKEI-ATCSNDGTIKISDLDGNIKQVLSG----HESFVYNVKLSKQGDKLV 240

Query: 269 AAGTDSHVYLYDLRN 283
           + G D  + ++D+ N
Sbjct: 241 SCGEDRSLRIWDINN 255

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 134 VATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN 193
           +AT +  GT+ I      ++  L  HE   Y +  S   + L+  G +D ++ +WD+N N
Sbjct: 198 IATCSNDGTIKISDLDGNIKQVLSGHESFVYNVKLSKQGDKLVSCG-EDRSLRIWDINNN 256

Query: 194 SDSTRPIR 201
            +  + I+
Sbjct: 257 FNIKQVIK 264

>Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {ON}
           YDR030C (RAD28) - involved in DNA repair, has WD repeats
           [contig 184] FULL
          Length = 424

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 70/181 (38%), Gaps = 33/181 (18%)

Query: 174 GLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
           GL  +GS+DH V +WD N        + +  D+   +V      +   DL    SEDS  
Sbjct: 156 GLFFTGSNDHKVKVWDTNAF-----EVASTIDVGHRVVQ----LDVQGDLLAVASEDSHP 206

Query: 234 KINDLRVENT--TTGTAKCPEPF--NTLAFSHHS----SNLLAAAGTDSHVYLYDLR--- 282
           ++ DL   +   T G  +    +  NT  F+         LLA    D +V L+DLR   
Sbjct: 207 RLIDLASMSAAITLGVKRTDMRYGINTAKFARSDEGSPQQLLATGDDDGNVRLWDLRMGN 266

Query: 283 ----NMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD---------LKQIG 329
               +++EP      H     +L + P             +  +W+         L+QIG
Sbjct: 267 RALCDLQEPDSLAKPHARCCNDLCWDPSGANRIVTTGNDGKCKLWEISPDGSSQLLRQIG 326

Query: 330 A 330
           A
Sbjct: 327 A 327

>KNAG0A04800 Chr1 complement(688282..688815) [534 bp, 177 aa] {ON}
           Anc_8.377 YLR164W
          Length = 177

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 20/126 (15%)

Query: 127 MPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVA 186
           +PQ PG V  I      ++  ++  ++ ++ +  E G+A++  PLV   +L+     TVA
Sbjct: 30  LPQKPGGV--IGSPNDSYVAPKTNRMEGSVHWWLEKGFAVTCVPLVTAAMLTSGPLSTVA 87

Query: 187 LWDVNGNSDSTRPI----RTWSDLHSDIVN------DSKWHNFNKDLFGTVSEDSLLKIN 236
                   DS   +      + +LHS I +        K+HN+   L G  S  SL  I 
Sbjct: 88  --------DSVLSVGLLGYCYMELHSCITDYVSARVYGKFHNYALYLLGAGSVFSLFGIY 139

Query: 237 DLRVEN 242
            L  EN
Sbjct: 140 KLETEN 145

>TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {ON}
           Anc_5.139 YGR200C
          Length = 785

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 73/171 (42%), Gaps = 28/171 (16%)

Query: 149 SEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
           ++G+  TLK H      + F P     ++S S+DH V +WD +    +   ++T      
Sbjct: 47  AQGVCRTLKGHAAEVTCVKFMPGTN-YMVSASEDHHVKIWDFS----TLECVQTIEHFKH 101

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFN--------TLAFS 260
            IV  +     NK+L    S D L+ I    ++++        + F+        TL+ S
Sbjct: 102 TIVTLA----VNKNLIAIGSADGLVSI---WIKDSQEHRFGLGQEFSIRKGILPLTLSIS 154

Query: 261 H--HSSNLLAAAGTDSHVYLYDLRNMKEPLH------HMSGHEDAVTNLEF 303
           H  +   LLA  GT  +V++Y     +  +        + GHED V +L F
Sbjct: 155 HVINDKFLLAVGGTSMNVFIYSFVLSESEIQDCQMAAELDGHEDWVKSLAF 205

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 12/177 (6%)

Query: 135 ATINGQGTVFIYSRSEGLQ-STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN 193
            T +    + I++ S G Q   L  H  +  +  + P + GL++SGS D+ + LWD    
Sbjct: 179 VTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKM-GLIVSGSKDNLIKLWD---- 233

Query: 194 SDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEP 253
             + R + T   L   ++  +K+     +L   VS+D  +KI D+R       T +    
Sbjct: 234 PRTGRNVSTILGLKHTVIK-TKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMD 292

Query: 254 FNTLAFSHHSSNLLAAAGTDSHVYLYDL----RNMKEPLHHM-SGHEDAVTNLEFSP 305
           + +L++   +  + +    +  +  +DL     N     H +   HE +VT+L +SP
Sbjct: 293 YMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYSP 349

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 101/243 (41%), Gaps = 32/243 (13%)

Query: 133 TVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
            VAT +G+ +++  S S   +S ++ H+     + +S   +  L+SG  D T+ +W  N 
Sbjct: 95  VVATYSGEFSLWNGS-SFNFESIMQAHDSAVTVMQYSHAGD-WLISGDADGTIKIWQPNF 152

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI---NDLRVENTTTG--- 246
           N      ++     H++ + D  + +++   F T S+D++LKI   ++ + E   +G   
Sbjct: 153 NM-----VKVLDRAHTECMRDISF-SYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHW 206

Query: 247 -TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
               C          H    L+ +   D+ + L+D R  +  +  + G +  V   +F P
Sbjct: 207 DVKSCDW--------HPKMGLIVSGSKDNLIKLWDPRTGRN-VSTILGLKHTVIKTKFQP 257

Query: 306 HXXXXXXXXXXXNRLIMWDLKQIGAE-QTPDDAED-------GVPELIMVHAGHKSAVND 357
                         + ++D++Q   E QT  D  D        + E I     +  A+  
Sbjct: 258 TQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 358 FDL 360
           FDL
Sbjct: 318 FDL 320

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 206 LHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSS 264
           +H   +    W N +   F +  ED ++K+     E    + + +  E   T    H  +
Sbjct: 139 IHRGKITGLDW-NVDGKSFASGGEDGIVKLFSFENEKIQESNSIEAHEARITAVKYHGCA 197

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           +LLA +  DS   L+DL  M E      GH   + NL+F P            N  ++WD
Sbjct: 198 SLLATSSFDSTWKLWDLAKMTELYLQEGGHSTEIFNLDFHPDGSLLSSVGGDGN-CVLWD 256

Query: 325 LK 326
           L+
Sbjct: 257 LR 258

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 86/207 (41%), Gaps = 28/207 (13%)

Query: 117 HEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYA-LSFSPLVEGL 175
           HE++I    Y P     V+  +G  TV I+    G Q +L    E+G   ++ SP    L
Sbjct: 511 HEQDIYSLDYFPSGDKLVSG-SGDRTVRIWDLRTG-QCSLTLSIEDGVTTVAVSPGDGKL 568

Query: 176 LLSGSDDHTVALWDVNGNS-----DSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE- 229
           + +GS D TV +WD          DS   + T    H D V       F +D  G VS  
Sbjct: 569 IAAGSLDRTVRIWDSETGFLVERLDSENELGTG---HKDSVYSVV---FTRDGHGVVSGS 622

Query: 230 -DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT-----------DSHVY 277
            D  +K+ +LR  N  T   K     + + ++ H   +L+ A T           D  V 
Sbjct: 623 LDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVL 682

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
            +D  +   PL  + GH ++V ++  +
Sbjct: 683 FWDTPS-GNPLLMLQGHRNSVISVAVA 708

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 66/139 (47%), Gaps = 8/139 (5%)

Query: 167 SFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGT 226
           +  P+     ++GS+D T+ +WD+     ++  ++     H   V D    + +  LF +
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDL-----ASGKLKVTLTGHVMTVRDIAVSDRHPYLF-S 199

Query: 227 VSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE 286
           VSED  +K  DL                 T++  H + +L+A AG DS V L+D+R  + 
Sbjct: 200 VSEDKTVKCWDLEKNQIIRDYHGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RV 257

Query: 287 PLHHMSGHEDAVTNLEFSP 305
           P+  + GH+  +  +E +P
Sbjct: 258 PVITLVGHKGPINQVECAP 276

>CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa]
           {ON} similar to uniprot|P18851 Saccharomyces cerevisiae
           YOR212w STE4
          Length = 419

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 66/156 (42%), Gaps = 17/156 (10%)

Query: 135 ATINGQGTVFIYSRSEGLQSTLK--FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           A +N   T++   R   +Q  +   F    GY      + E  +++ S D T ALWD+  
Sbjct: 145 AGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDI-- 202

Query: 193 NSDSTRPIRTWSDLHSDIVNDS-KWHNFNK-DLFGTVSEDSLLKINDLR----VENTTTG 246
                + +R +SD   D++  S    N +K ++F +   D    I D+R    V+  + G
Sbjct: 203 --PKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIG 260

Query: 247 TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR 282
           +       N L F     N +A    D  + L+DLR
Sbjct: 261 SCDS----NCLKF-FPDGNSVAVGNDDGTISLFDLR 291

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 85/214 (39%), Gaps = 24/214 (11%)

Query: 149 SEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
           S  L  +  F  EN + L   P  +  LL+G  +  + L D +    S + I+       
Sbjct: 3   SYSLVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWS-TGKSVQKIKA----SE 56

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSL--LKINDLRVENTTTGTA-KCPEPFNTLAFSHHSSN 265
             +ND K    +      VS  S+  +K+ D+R  +       +   PF +L   H    
Sbjct: 57  TAINDMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRH---G 113

Query: 266 LLAAA----GTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           LLA      G D+ VY+YD+R    PL  +   H D VT ++F P               
Sbjct: 114 LLACGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYT 173

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSA 354
            ++DLKQ       D+ ED + ++I   + H   
Sbjct: 174 NIYDLKQ-------DEEEDALHQVINYASIHSCG 200

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 99/235 (42%), Gaps = 51/235 (21%)

Query: 175 LLLSGSDDHTVALWDVNGNSD---STRPIRTWSDLHSDIVNDSKWHNF--NKDLFGTVSE 229
           +L++GS D T+ +WD+N + +      P++     +++ V     HNF  + D    +S 
Sbjct: 379 MLITGSKDATLKMWDLNLSKELYSDQSPLKQ----NAEEVVTPCLHNFELHSDEITALSF 434

Query: 230 DSLLKIN---DLRVENTTTGTAKCPE--------PFNTLAFSHHSSN------------- 265
           DS   I+   D ++ +    T KC +         +N    S  S+N             
Sbjct: 435 DSEALISGSKDRKILHWDLVTGKCVQQLDLIVTPTYNDTKVSARSANNSTSVLGSEAPMI 494

Query: 266 --------LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXX 317
                    LA+   D  V L+DLR + +P+  + GH D +T+L+F              
Sbjct: 495 GALQCYNSALASGTKDGVVRLWDLR-IGKPVRALEGHTDGITSLKFDSE---KLVTGSMD 550

Query: 318 NRLIMWDLK-----QIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWL 367
           N + +WDL+      + A   P  + D   +LI V A +++ VN F++     W+
Sbjct: 551 NSVRIWDLRTSSIIDVIAYDLPITSLDFDDKLITVGA-NETGVNVFNMERDEHWM 604

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 92/203 (45%), Gaps = 19/203 (9%)

Query: 141 GTVFIYSRSEG---LQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           G++ +YS +E    + S  +F  H  +   + F+   + +L SG ++  + +WD+N  ++
Sbjct: 84  GSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTE 143

Query: 196 STR---PIRTWSDLHS-DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE------NTTT 245
           S     P+     + S D V    W+     +F +    +   I DL+ +      + T+
Sbjct: 144 SPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTS 203

Query: 246 GTAKCPEPFNTLAF-SHHSSNLLAAAGTDS--HVYLYDLRNMKEPLHHMS-GHEDAVTNL 301
             +   +  + + +   +S+ +  A G+D+   + ++DLRN   PL  ++ GH+  + +L
Sbjct: 204 PNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSL 263

Query: 302 EFSPHXXXXXXXXXXXNRLIMWD 324
           ++              N +++W+
Sbjct: 264 DWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 60/133 (45%), Gaps = 20/133 (15%)

Query: 256 TLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHM-----SGHEDAVTNLEFSPHXXXX 310
           +LA++   +++ A+AG+ +   ++DL+  KE +H       SG +  ++ +E+ P     
Sbjct: 165 SLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTR 224

Query: 311 XXXXXXXNR---LIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWL 367
                  +    +++WDL+      TP         L  ++ GH+  +   D   Q   L
Sbjct: 225 VATATGSDNDPSILIWDLRNAN---TP---------LQTLNQGHQKGILSLDWCHQDEHL 272

Query: 368 VASTEEENILQVW 380
           + S+  +N + +W
Sbjct: 273 LLSSGRDNTVLLW 285

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 81/207 (39%), Gaps = 25/207 (12%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDS 214
           + + H      +   P    L LSG +D+ V LWDV    +  R        HS  V D 
Sbjct: 164 SYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYHKRELLRDYCG----HSKAVRDV 219

Query: 215 KWHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAA 270
            +       F +VS D  +KI      NT TG      K P   N   FS  +SN L   
Sbjct: 220 SFSGSGTS-FLSVSYDQHMKI-----WNTETGDIEHRYKFPAVPNCAEFSPANSNELIVG 273

Query: 271 GTDSHVYLYDLR-NMKEPL-----HHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
            ++S V  YDLR   K+ L     HH+S    ++  L++ P            +  I  +
Sbjct: 274 LSNSEVRHYDLRVAHKDGLVQVYDHHLS----SIIALKYFPDGSKFISSSEDKSMRIWDN 329

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHAGH 351
              I  +Q  D A+  +P  I +H  H
Sbjct: 330 QVNIPIKQISDTAQYSMP-FIDIHPEH 355

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV-ENTTTGTAKCPEPFNTLAFSHHSSN 265
           H   + D  +H  + +L  T S D+ +   D+R  +     T+      + + ++  ++N
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNAN 172

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           +LA++  +S V+++D+R    PL+ +SG+  +V N++F+               +  WD 
Sbjct: 173 VLASSHANS-VFIWDIRKGCTPLYKLSGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDY 231

Query: 326 KQIGAE 331
            +   E
Sbjct: 232 SKSSTE 237

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 266 LLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           LLA    D++V+ +D+R+ + P +  S      + ++++             N + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHA-NSVFIWDI 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHS 385
           ++            G   L  + +G+ S+VN+ D N      + S+  +  ++ W  S S
Sbjct: 188 RK------------GCTPLYKL-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKS 234

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           H E+   ++FS   +   ++ SDD+ + +W+  NG  +     R  S  H D V    WH
Sbjct: 176 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKQE-----RVLSGHHWD-VKSCDWH 228

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
                L  + S+D+L+K+ D R  N  +   K         F     NLL A   D    
Sbjct: 229 P-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCR 287

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           ++D+R   + L  +    D +T LE+ P
Sbjct: 288 VFDIRYSMKELMCVRDETDYMT-LEWHP 314

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 68/159 (42%), Gaps = 34/159 (21%)

Query: 147 SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDL 206
           S+ +    T   H +   ALSFS      L+SGS D T+  WD+N    S + ++T    
Sbjct: 539 SKEDACVYTFDAHVDEITALSFSG---DNLISGSQDRTIRQWDLN----SGKCVQTIDIN 591

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDS--LLKINDLRVENTTTGTAKCPEPFNTLAFSHHSS 264
            +  VN S          GT+S  S  LL  N    E    G  +C +            
Sbjct: 592 FASRVNSSTS--------GTLSSRSSTLLVPN----EQPVIGALQCYDA----------- 628

Query: 265 NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
             LA    D  V L+DLR+  + +  + GH DA+T+L+F
Sbjct: 629 -ALATGTKDGLVRLWDLRS-GQVVRTLQGHTDAITSLQF 665

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 64/165 (38%), Gaps = 18/165 (10%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
           LL+S S D T  +WD+     S   ++T    H   V D ++ + +  LF +   D  ++
Sbjct: 261 LLVSSSIDTTCIVWDL----QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVR 316

Query: 235 INDLRV-------------ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH-VYLYD 280
           + DLR              E T             L  S    N++A    DS  + + D
Sbjct: 317 VFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILD 376

Query: 281 LRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           +RN + P   + GH   V  +++ P             +++ WDL
Sbjct: 377 MRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON}
           YDR030C (REAL)
          Length = 504

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 24/128 (18%)

Query: 174 GLLLSGSDDHTVALWDVNGNSDSTRPIRTWS------DLHSDIVNDSKWHNFNKDLFGTV 227
           G+  +GS+D TV +WD N       P++  S       + ++I NDS        L    
Sbjct: 207 GMFFTGSNDKTVKIWDTN----RFEPVQNISLGYRINQIDNNIANDSS-------LLVVA 255

Query: 228 SEDSLLKINDLRVEN---TTTGTA---KCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDL 281
           SED   ++ DLR  N   TT G     +     +   F+     ++A   T+  + L+DL
Sbjct: 256 SEDYYPRMIDLRTMNSGITTLGMGNKTRMQSEISCCKFNPVREQIVACGDTEGGIKLWDL 315

Query: 282 RNMKEPLH 289
           R M+  L+
Sbjct: 316 R-MRNRLY 322

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 64/148 (43%), Gaps = 10/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           H E+   ++FS   +   ++ SDD+ + +W+  NG  +     R  S  H D V    WH
Sbjct: 178 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKQE-----RVLSGHHWD-VKSCDWH 230

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
                L  + S+D+L+K+ D R  N  +   K         F     NLL A   D    
Sbjct: 231 P-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCR 289

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           ++D+R   + L  +    D +T LE+ P
Sbjct: 290 VFDIRYSMKELMCVRDETDYMT-LEWHP 316

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 15/133 (11%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPI------RTWSDLHSDI--VNDSKWHNFNKDLFGTV 227
            L+G+++ TV+LW+++ N+ ST  I      RT +  HS +  +ND KW++ +  +F T 
Sbjct: 64  FLAGNNNGTVSLWNLD-NTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTC 122

Query: 228 SEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHV-YLYDLRNMKE 286
             D  +K+ D     T          FN+  F   ++N       D +   L DLRNM  
Sbjct: 123 GNDKFVKLWD-----TNKFINVQDLEFNSNLFQMDTANQFILVTLDDYYPRLIDLRNMNL 177

Query: 287 PLHHMSGHEDAVT 299
            +     H ++ T
Sbjct: 178 GITIFGKHLNSKT 190

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 13/138 (9%)

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE-PFNTLAFSHHSSNLLAA----AGT 272
           NFN+     V+ +  + I D+R  +           PF +L   H    +LA     +G 
Sbjct: 68  NFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRH---GMLACGTELSGV 124

Query: 273 DSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAE 331
           D+ +++YD+RN   P+   +  H D VT++ F P                ++DLKQ    
Sbjct: 125 DAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ---- 180

Query: 332 QTPDDAEDGVPELIMVHA 349
           Q  DDA   V     +H+
Sbjct: 181 QEEDDALHQVINYASIHS 198

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 10/115 (8%)

Query: 130 NPGTVATINGQGTVFIYS-RSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSD----DHT 184
           N G+   +    +V I   RS    ++LK +++N   LS      G+L  G++    D  
Sbjct: 70  NEGSSYAVASNDSVNILDVRSRDKLASLK-NDKNAPFLSLDSR-HGMLACGTELSGVDAE 127

Query: 185 VALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239
           + ++DV   S    PIR++ D H D V D ++H  ++++  + S D    + DL+
Sbjct: 128 LHIYDVRNWS---TPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLK 179

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 53/262 (20%), Positives = 98/262 (37%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFIYSRSEGLQS-TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           +A+ +  GT+ I+  +  +   TL  H  +   + +     G+L SGS D T+  WD+  
Sbjct: 250 LASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAA 307

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPE 252
                  +++    H+  +N             +++ D  L++      + T      PE
Sbjct: 308 GGKCINILKS----HAHWINHL-----------SLNTDYALRVGAF---DHTGEKPSSPE 349

Query: 253 PFNTLAFSHHSS---------NLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEF 303
                A  ++            L+  A  D  +YL+D     +P+  M+GH+  V ++ F
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 304 SPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQ 363
           SP            N + +W            D  +G    I    GH ++V       Q
Sbjct: 410 SP-DGRYIVSASFDNSIKLW------------DGRNGT--FIATFRGHVASV------YQ 448

Query: 364 IPW-----LVASTEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 449 VAWSSDCRLLVSCSKDTTLKVW 470

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 63/165 (38%), Gaps = 25/165 (15%)

Query: 90  PQEEAGEDDEVSAPAPRSNIKI-------TAKYKHEEEITRARYMPQNPGTVATINGQGT 142
           P  +  ED       PR+  K+       +A   H   I  + + P   G + T +G  T
Sbjct: 107 PGHKTTEDFITIVYTPRAVFKVRPVTRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNT 166

Query: 143 VFIY-SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIR 201
             I+   +     TLK H      +++ P  E L+ +GS D+T+ LWD N        +R
Sbjct: 167 ARIWDCNTNTPMYTLKGHFNWVLCVAWCPDGE-LIATGSMDNTIRLWDSNKGESYGEALR 225

Query: 202 ---------TWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIND 237
                    TW  +H     D       +    + S+D  +KI D
Sbjct: 226 GHAKWITSLTWEPMHLVKAGD-------QPRLASASKDGTIKIWD 263

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 74/158 (46%), Gaps = 14/158 (8%)

Query: 147 SRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDL 206
           +R++ L++  K  ++NG        +E L+++ SDD T+ LWD      +++PI   +  
Sbjct: 351 ARAKALKNYEKIAKKNGQ-------LEELMVTASDDFTMYLWD---PLKASKPITRMTG- 399

Query: 207 HSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNL 266
           H  +VN   +    + +  + S D+ +K+ D R                 +A+S     L
Sbjct: 400 HQKLVNHVAFSPDGRYIV-SASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWS-SDCRL 457

Query: 267 LAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFS 304
           L +   D+ + ++D+R  K  +  + GH D V  +++S
Sbjct: 458 LVSCSKDTTLKVWDVRTKKLSV-DLPGHNDEVYTVDWS 494

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 11/187 (5%)

Query: 117 HEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTL-KFHEENGYALSFSPLVEGL 175
           H+  +T   Y       V+  +  GT+ I+  +  +   L + H E    ++FS   +  
Sbjct: 122 HDSAVTTMEYSHAGDWMVSG-DSDGTIKIWQPNFNMVKELDRAHTECIRDVAFSG-NDSK 179

Query: 176 LLSGSDDHTVALWDV-NGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLK 234
            ++ SDD+ + +W+  NG  +     R  S  H D V    WH     L  + S+D+L+K
Sbjct: 180 FVTCSDDNILKIWNFSNGQQE-----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVK 232

Query: 235 INDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGH 294
           + D RV    +   K         F     NLLAA   D    ++D+R+  + L  +   
Sbjct: 233 LWDPRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELMVVRDE 292

Query: 295 EDAVTNL 301
            D +T L
Sbjct: 293 VDYMTLL 299

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 85/204 (41%), Gaps = 26/204 (12%)

Query: 136 TINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHT-VALWDVNGNS 194
           TI   G +   ++ +G   TLKF+ +             LL+SGSD +  + +WD+N N 
Sbjct: 97  TIKSLGNLSDSNKHKGSVKTLKFNTKQS----------NLLVSGSDKNGEILIWDLN-NL 145

Query: 195 DSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVE------NTTTGTA 248
           D T          ++ +    W+     +F   S  S + I DL+ +      N T    
Sbjct: 146 DKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTNPVN 205

Query: 249 KCPEPFNTLAFSHHSSNLLAAAGTDS------HVYLYDLRNMKEPLHHMS--GHEDAVTN 300
                F+ + +   +S  +A A  ++       ++++DLRN   PL  +S  GH + + +
Sbjct: 206 NVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNGILS 265

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWD 324
           L++              N +++W+
Sbjct: 266 LDWCSTDENLLLSSGRDNSVMLWN 289

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 36/172 (20%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDS 214
           T   H +   ALSF       L+SGS D T+  WD+N      + ++T        +N +
Sbjct: 500 TFDSHIDEITALSFEA---NNLVSGSQDRTIRQWDLNNG----KCVQTLD------INFA 546

Query: 215 KWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDS 274
              N ++ + G+      L  N+   ++   G  +C +              LA    D 
Sbjct: 547 TGGNLSRSMIGS----GFLNTNN---DHPIIGAIQCYDA------------ALATGTKDG 587

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK 326
            V L+DLR+ +  +  + GH DAVT+L+F              N + +WDL+
Sbjct: 588 IVRLWDLRSGR-VVRTLEGHSDAVTSLQFDS---LNLVTGSLDNSIRIWDLR 635

>CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021c MAK11 involved in cell growth and replication of
           M1 dsRNA virus
          Length = 388

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 24/126 (19%)

Query: 263 SSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXX--------XXXX 314
           S   L +   D H+ +YDL+  KE L  +  H+ ++TNL+FS                  
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSA 108

Query: 315 XXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEE 374
              N++I+W +K         D E+          GH + +ND D++     +VAS  E+
Sbjct: 109 SEDNKIIVWRVK---------DWEN-----FGTLKGHTARINDMDIHPS-NRVVASVSED 153

Query: 375 NILQVW 380
           + +++W
Sbjct: 154 HSIRLW 159

>SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, 617
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 617

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 71/172 (41%), Gaps = 18/172 (10%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F+P  + +++S SDD  + +W++            +GN    +P++  +  HS  V    
Sbjct: 89  FNPFNDRIIVSSSDDAKIGVWEIPEDYSFHSYVDEDGNPKDIKPLKFLTG-HSRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           +H    ++  + S D  +K+ D+        T + P    +++FS +  N LA    D  
Sbjct: 148 FHPTANNVLASSSLDYTVKLWDIE-SGKEIFTLEHPNMVTSMSFS-YDGNHLATVCRDKK 205

Query: 276 VYLYDLRNMK---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           + ++D+R  K   E L H S     V  L  S              ++ +WD
Sbjct: 206 LRVWDIRAKKVVSEGLAHSSAKNQRVVWLGNSDRIATTGFSRLSDRQIGIWD 257

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD 222
           G+ L F P    +L S S D+TV LWD+    +S + I T    H ++V  S   +++ +
Sbjct: 144 GHVL-FHPTANNVLASSSLDYTVKLWDI----ESGKEIFTLE--HPNMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG----TDSHVYL 278
              TV  D  L++ D+R +   +         N       +S+ +A  G    +D  + +
Sbjct: 196 HLATVCRDKKLRVWDIRAKKVVSEGLAHSSAKNQRVVWLGNSDRIATTGFSRLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNIEK 263

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 27/143 (18%)

Query: 248 AKCPEPFNTLAFSHHSSNLLAAAG-TDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
           AK  +P  T    HH    L A G  D  V ++DL + K  L +++GH  A+T L+F   
Sbjct: 101 AKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYS-KTVLCNLNGHSSAITALKFDTS 159

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNA---- 362
                      N +I+WDL           +E G+ +L      HK A+     N     
Sbjct: 160 GTRLISGSRDSN-IIVWDLV----------SEVGLYKL----RSHKDAITGIWCNEVTNN 204

Query: 363 -----QIPWLVASTEEENILQVW 380
                ++ WL+ ST ++ ++++W
Sbjct: 205 NQEENELDWLI-STSKDGLIKIW 226

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 125/334 (37%), Gaps = 62/334 (18%)

Query: 19  SNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTHTSGEEENYLKFAEI 78
           SN  L ++ V+E  +T+P   +QWLP+ V  P              TS E        + 
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPS-VPNPRK----------LATSSECLRIWSLDDN 238

Query: 79  NLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATIN 138
           ++    + N +    +  +    +   + N+ +  KY  + +I        +  + A + 
Sbjct: 239 SMDNSSVFNNNISNNSRHNTYKKSLTEQVNLSL-CKYNEQHQIINNSTNSVSNKSNARLL 297

Query: 139 GQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTR 198
           GQ           L     FH        ++ +   LL+S S D T  +WD+     S+ 
Sbjct: 298 GQ-----------LPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDL----QSSN 334

Query: 199 PIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTT---GTAKCPEPFN 255
            ++T    H   V D K+   +  LF +   D  +++ DLR    +T    TA   +  N
Sbjct: 335 YVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNN 394

Query: 256 TL--------------AFSHH---------SSNLLAAAGTDSH-VYLYDLRNMKEPLHHM 291
           T               + SH            NL+A  G D   + + D+RN   P+  +
Sbjct: 395 TFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVL 454

Query: 292 SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDL 325
           SGH  +V  +++ P             +++ WDL
Sbjct: 455 SGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429W
           (REAL)
          Length = 652

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 68/172 (39%), Gaps = 18/172 (10%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  + SGSDD  + +W++            +G      P++  +  H+  V    
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWNIPESYKFHDHVNEDGEPIDIEPVKFLTG-HARKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSH 275
           +H   K++  + S D  +K+ D+        T K P+   +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDYTVKLWDVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKK 205

Query: 276 VYLYDLRNMK---EPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWD 324
           + ++++R+ K   E   H       V  L  S              ++ +WD
Sbjct: 206 LRVWNIRDEKIVSEGFAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD 222
           G+ L + P+ + +L S S D+TV LWDV    D        +  H D+V  S   +++ +
Sbjct: 144 GHVL-YHPVAKNVLASSSGDYTVKLWDVETGKDMI------TLKHPDMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG----TDSHVYL 278
              TV+ D  L++ ++R E   +         N       +S+ LA  G    +D  + +
Sbjct: 196 YLATVARDKKLRVWNIRDEKIVSEGFAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 18/120 (15%)

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           H  +NLLAA   D  + ++DL + K  L   SGH+  VT L+F              + +
Sbjct: 86  HDETNLLAAGYADGVIKIWDLMS-KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD-I 143

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVW 380
           I+WDL           +E GV +L      HK A+       +  WLV ST ++ ++++W
Sbjct: 144 IIWDLV----------SEVGVFKL----RSHKDAITGIWCEGE-DWLV-STAKDGLIKLW 187

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 12/112 (10%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           L+SGS D  + +WD+       + +R+  D  + I     W    +D   + ++D L+K+
Sbjct: 134 LMSGSRDSDIIIWDLVSEVGVFK-LRSHKDAITGI-----WCE-GEDWLVSTAKDGLIKL 186

Query: 236 NDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKE 286
            DL+ +    T  A+  E +   A   H  +L+   GTDS + +++L   KE
Sbjct: 187 WDLKTQQCVETHIAQTGECW---ALGVH-GDLVVTTGTDSQIKIWNLDTSKE 234

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 221 KDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAA---GTDSHVY 277
           ++LF   S  + +K+ DLR EN    T +     N L+       L   +   G D+H++
Sbjct: 65  ENLFAA-SNGNKVKVFDLR-ENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLH 122

Query: 278 LYDLRNMKEPLH-HMSGHEDAVTNLEFSP 305
           L+D+RN  +P+   +  H+D +T++ F P
Sbjct: 123 LFDIRNWSKPVRSFVDSHQDDITSIAFHP 151

>Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C
           (ASC1) - G-beta like protein [contig 54] FULL
          Length = 218

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 26/166 (15%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTR-PIRTWSDLHSDI 210
           L+ TL+ H     +L+ SP    LLLSGS D ++  W + G+      P+R++   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG-HSHI 67

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKIN---DLRVENTTTGTAKCPEPFN-------TLAFS 260
           V D            TV+ D    ++   D  V      T KC + F        ++   
Sbjct: 68  VQDC-----------TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTID 116

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
             +S +++A+  D  V +++   + E +  + GH D V+ +  +P+
Sbjct: 117 RRASQIVSAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPN 159

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 60/141 (42%), Gaps = 29/141 (20%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           L  G     V ++DV  N    + IRT S  H D V    W+N    +  + S D  +  
Sbjct: 333 LAVGLSSGIVEIYDVLKN----KCIRTLSG-HVDRVACLSWNNH---VLSSGSRDRKILH 384

Query: 236 NDLRVENTTTGTAKCPEPFNTLAFSHH----------SSNLLAAAGTDSHVYLYDLRNMK 285
            D+R           PEPF     +H           + N LA+ G D+ VY+YD   ++
Sbjct: 385 RDVR----------APEPFFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYD-GTLR 433

Query: 286 EPLHHMSGHEDAVTNLEFSPH 306
           +P+  M  H  AV  + +SPH
Sbjct: 434 QPMLSMEEHTAAVKAMAWSPH 454

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 10/148 (6%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           H E+   ++FS   +   ++ SDD+ + +W+  NG  +     R  S  H D V    WH
Sbjct: 176 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKQE-----RILSGHHWD-VKSCDWH 228

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
                L  + S+D+L+K+ D R  N  +   K         F     NLL A   D    
Sbjct: 229 P-EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCR 287

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           ++D+R     L  +    D +T LE+ P
Sbjct: 288 VFDIRYSMRELMCVRDETDYMT-LEWHP 314

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 88/217 (40%), Gaps = 39/217 (17%)

Query: 155 TLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDS 214
           T + H +   ALS  P     L+SGS D T+  WD+     S + ++T     ++++  +
Sbjct: 495 TFEAHTDEVTALSLDP---SFLVSGSQDRTIRQWDLR----SGKCMQTIDLSFANVLTAA 547

Query: 215 KWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDS 274
                N DL    S+ +LL     R E  + G  +  +              LA    D 
Sbjct: 548 T----NVDL----SKSTLLT---QRSERPSIGALQSFDA------------ALATGTKDG 584

Query: 275 HVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-----QIG 329
            V L+DLR+ K  +  + GH DA+T+L+F                + +WDL+     +  
Sbjct: 585 IVRLWDLRSGK-VIRTLKGHTDAITSLKFGSECLVTGSYDRT---VRVWDLRTGLLSKFH 640

Query: 330 AEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
           A   P  + D   E   V   +++AV  +D N    W
Sbjct: 641 AYSEPILSLDLCQENAAVIVANETAVQIYDSNKDESW 677

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 13/151 (8%)

Query: 158 FHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWH 217
           +H  N    +   L +   ++GS D  +AL D+    ++ + +R  +  H  +VN  +  
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDL----ETGQLLRGLAG-HRRVVNQVR-- 107

Query: 218 NFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVY 277
              +  F +V +D  LK+ D          A    P   +A    + +L+ A+G +  + 
Sbjct: 108 ALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIR 167

Query: 278 LYDLRNMKEPLHHMS----GHEDAVTNLEFS 304
            YDLR   +  H  S     H DAVT+L+ S
Sbjct: 168 AYDLRRSAD--HAFSSWPAAHSDAVTSLDVS 196

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 76/163 (46%), Gaps = 20/163 (12%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTR-PIRTWSDLHSDI 210
           L+ TL+ H     +L+ SP    LLLS S D T+  W + G+      P+R++   HS I
Sbjct: 10  LRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKG-HSHI 68

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFN-------TLAFSHHS 263
           + D      + +   + S D  +++ +L        T KC + F        ++A    +
Sbjct: 69  IQDCT-VTADGEYALSASWDKTIRLWEL-------ATGKCVKRFVGHKSDVLSVAIDRRA 120

Query: 264 SNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
           + +++A+  D  V +++   + E +  + GH D V+ +  +P+
Sbjct: 121 TQIVSAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPN 160

>KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {ON}
           Anc_4.309 YLR429W
          Length = 527

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 148 RSEGLQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSD 205
           + +G+Q T +   HE+    + ++P+++ LL S S D TV +WD++          T   
Sbjct: 121 KFKGIQPTARLTGHEKKVGHVLYNPVIQDLLASSSFDQTVKIWDISTG-------ETLHT 173

Query: 206 LHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLR 239
           L  D V  S   +++ +   T+S + +L++ D+R
Sbjct: 174 LQHDEVVLSLSFSYDGNYLATLSRNRILRVWDIR 207

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 79/188 (42%), Gaps = 33/188 (17%)

Query: 154 STLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVND 213
           +TLK H+ +  AL    L + L++SGS D TV LWD    +D+T      S+++S +++ 
Sbjct: 291 TTLKSHKSSLTALQ---LDDHLIVSGSKDATVKLWDTKSLADTTN-----SNINSPLLHT 342

Query: 214 SKWHN--------FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEP--------FNTL 257
              H         F   L  T S D  ++  DL   N    T   P P         NTL
Sbjct: 343 FSSHKDEITAISLFQSSLI-TTSLDKTIRHWDLNT-NKNIQTIPLPSPVSVYTSPIINTL 400

Query: 258 AFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXX 317
                +   LA    D  V L+DLR + + +     H D +T L+F+             
Sbjct: 401 QCFDAA---LATGSRDGIVRLWDLR-IGKIVRSFEKHNDEITGLKFN---NKQLVSTSLD 453

Query: 318 NRLIMWDL 325
           N + +WDL
Sbjct: 454 NSIKIWDL 461

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 63/147 (42%), Gaps = 8/147 (5%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHN 218
           H E+   ++FS   +   ++ SDD+ + +W+ +   +     R  S  H D V    WH 
Sbjct: 176 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKEE----RVLSGHHWD-VKSCDWHP 229

Query: 219 FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYL 278
               L  + S+D+L+K+ D R  N  +   K         F     NLL A   D    +
Sbjct: 230 -EMGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRV 288

Query: 279 YDLRNMKEPLHHMSGHEDAVTNLEFSP 305
           +D+R   + L  +    D +T LE+ P
Sbjct: 289 FDIRYSMKELMCVRDETDYMT-LEWHP 314

>TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {ON}
           Anc_8.651 YPL139C
          Length = 448

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 47/204 (23%)

Query: 219 FNKDLFGTVSEDSLLKINDLRVENTTTGTAKC--PEPFNTLAFSHHSS---NLLAAAGTD 273
           F+  +FGT S+D++++  D R    T G   C   +P N    S   S   + L   G+D
Sbjct: 245 FDNHVFGTCSDDNVIRFWDTR----TGGEPTCVLSDPNNGALTSFDVSPVIDTLFVTGSD 300

Query: 274 SH-VYLYDLR-------------NMKEP-------LHHMSGHEDAVTNLEFSPHXXXXXX 312
           +  V L+D+R             N +EP       LHH  G  D+V +++FSP       
Sbjct: 301 TGIVKLWDIRSVTSAATDLANRQNGEEPIQDEVIALHHSGG--DSVVDVKFSPTSPSEFV 358

Query: 313 XXXXXNRLIMWDLKQIGAEQTPDDAEDGVP--------ELIMVHAG--HKSAVNDFDLN- 361
                  +  WDL+   ++   D  +   P         L  +H G   +S  N    N 
Sbjct: 359 SIGGSGDVYHWDLQNFFSQYDDDSNDVKYPVDENVKANALKFLHTGGSRRSLANTGRRNV 418

Query: 362 ----AQIPWLVASTEEENILQVWK 381
               + +  L+A+ +E++++ V+K
Sbjct: 419 LGYHSIVSDLIATVDEDSLITVYK 442

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 13/102 (12%)

Query: 102 APAPRSNIKITAKYKHEEEITRARYMPQNPGT----------VATINGQGTVFIYSRSEG 151
            P   S +K+        E+ R  Y+P    T            T +    +  +    G
Sbjct: 208 GPEGDSILKLVDNAGKPGELLRKVYVPGTTVTHSVRFFDNHVFGTCSDDNVIRFWDTRTG 267

Query: 152 LQSTLKFHEENGYALS---FSPLVEGLLLSGSDDHTVALWDV 190
            + T    + N  AL+    SP+++ L ++GSD   V LWD+
Sbjct: 268 GEPTCVLSDPNNGALTSFDVSPVIDTLFVTGSDTGIVKLWDI 309

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 63/146 (43%), Gaps = 24/146 (16%)

Query: 117 HEEEITRARYMPQNPGTVATINGQGTVFI-----------YSRSEGLQSTL---KFHEEN 162
           H   +    + P N   +A+ +  G + I           Y+ SEG    L   KF   +
Sbjct: 80  HTAHVLDTDFDPFNDNIIASGSDDGKIGIWEIPEDYSFHHYTNSEGEPKDLQPKKFLTGH 139

Query: 163 GYALS---FSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF 219
           G  +    F P    +L S S DHTV +WDV    +S + + T    H D+V  S   ++
Sbjct: 140 GRKVGHVLFHPTARNVLASSSLDHTVRIWDV----ESGKELFTLK--HPDMVT-SMSFSY 192

Query: 220 NKDLFGTVSEDSLLKINDLRVENTTT 245
           + +   TVS D  L++ D+R E   +
Sbjct: 193 DGNHLATVSRDKKLRVWDIREEKIVS 218

>ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} similar
           to uniprot|P42935 Saccharomyces cerevisiae YGR200C ELP2
           Elongator protein part of the six-subunit RNA polymerase
           II Elongator histone acetyltransferase complex target of
           Kluyveromyces lactis zymocin
          Length = 783

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 28/170 (16%)

Query: 149 SEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
           ++G+ +TLK H+     + F P ++ L++S S+DH V +W  +    S   ++T      
Sbjct: 46  AKGVYATLKGHQAEVTCVKFIPNMD-LMVSTSEDHHVKIWKFS----SLECLQTIEHYKH 100

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKI-----NDLRVENTTTGTAKCPEPFNTLAFS--- 260
            IV+ + W    KDL    S D L+ +     N+  ++   T      + F  L+ S   
Sbjct: 101 SIVSLAVW----KDLIVVGSADGLVSLWVFRDNEFVLDYEFTNR----KGFFPLSLSVTN 152

Query: 261 -HHSSNLLAAAGTDSHVYLYDLRNMKEPLH------HMSGHEDAVTNLEF 303
                 LLA  GT  ++ +Y        +H       + GHED V +L F
Sbjct: 153 IEDGGFLLAVGGTKPNIIVYSFVLRDSRVHECRLAAELEGHEDWVKSLAF 202

>Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {ON}
           complement(63130..64962) [1833 nt, 611 aa]
          Length = 610

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD 222
           G+ L +SP+ + +L S S D+TV +W+V    D        +  H D+V  S   +++ +
Sbjct: 144 GHVL-YSPVAQNILASSSLDYTVKIWNVETGKDEI------TLKHPDMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG----TDSHVYL 278
              TVS D  L++ D+R     +  A      N       + N LA  G    +D  + +
Sbjct: 196 HLATVSRDKKLRVWDVRKGTVVSEGAAHTGAKNQRVVWLGNCNRLATTGFSRLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 23/131 (17%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDVNGN------------SDSTRPIRTWSDLHSDIVNDSK 215
           F P  E  ++S +DD  +A+WD+  N                 P++  +  H   V    
Sbjct: 89  FDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKILTG-HKKKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAG 271
           +    +++  + S D  +KI      N  TG    T K P+   +++FS +  N LA   
Sbjct: 148 YSPVAQNILASSSLDYTVKI-----WNVETGKDEITLKHPDMVTSMSFS-YDGNHLATVS 201

Query: 272 TDSHVYLYDLR 282
            D  + ++D+R
Sbjct: 202 RDKKLRVWDVR 212

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 80/198 (40%), Gaps = 15/198 (7%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHN 218
           HE    AL F P    L LSG +D+ + +WD+  +    R +R +   H   + D    N
Sbjct: 177 HENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDR---RLLRDFCG-HQKPIRD---FN 229

Query: 219 FNKD--LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHV 276
           F  D   F +VS D  LKI D         T     P N + F   ++  L     +S +
Sbjct: 230 FTTDSKQFTSVSYDKFLKIWDTEKGAIIHRTKLTSVP-NCVTFHPINNYELVVGLLNSEI 288

Query: 277 YLYDLR-NMKEPL-HHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLK-QIGAEQT 333
             YD R N K  L      H  ++  L+F P+             + +WD +  I  +Q 
Sbjct: 289 KHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFISSSEDKT-IRIWDNQINIPIKQI 347

Query: 334 PDDAEDGVPELIMVHAGH 351
            D A+  +P  I +H  H
Sbjct: 348 SDTAQHSMP-WIEIHPEH 364

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 66/154 (42%), Gaps = 18/154 (11%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHN 218
           H+    +L F P    LLLSG +D+ + LWD     +    +RT+   HS  + D  + +
Sbjct: 134 HKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHEREL---LRTYEG-HSMTIKDLNFTD 189

Query: 219 FNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNT----LAFSHHSSNLLAAAGTDS 274
            N   F + S D  +KI      NT  G       FN+    + F     N L    ++S
Sbjct: 190 -NGHSFASASFDKWVKI-----WNTEKGIIDKRLRFNSVPNCITFHPKDKNQLVVGLSNS 243

Query: 275 HVYLYDLR---NMKEPLHHMSGHEDAVTNLEFSP 305
            +  YDLR   N  E +     H+ ++  L++ P
Sbjct: 244 EIRHYDLRLSENHGE-VQKYDHHQGSILALKYFP 276

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 90/204 (44%), Gaps = 17/204 (8%)

Query: 138 NGQGTVFIYSRSEGLQSTLKF--HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNG--- 192
           NG   +F  +  + L+S  K   H  +   ++F+   E +L SGS +  + +WD+N    
Sbjct: 83  NGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCID 142

Query: 193 -NSDSTRPIRTWSDLHS-DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN-----TTT 245
            ++DS  P+     +   + +    W+     +F +    S   I DL+ +      + T
Sbjct: 143 QSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWDLKAKKEVIHLSYT 202

Query: 246 GTAKCPEPFNTLAFSH--HSSNLLAAAGTDSH--VYLYDLRNMKEPLHHM-SGHEDAVTN 300
             +   +P  ++   H  +S+ +  A+ +D+   + ++DLRN   PL  + +G+   + +
Sbjct: 203 SPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNANTPLQILENGNSKGILS 262

Query: 301 LEFSPHXXXXXXXXXXXNRLIMWD 324
           L++  H           N  ++W+
Sbjct: 263 LDWCKHDSNLLLSSGRDNTAVLWN 286

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 19/134 (14%)

Query: 248 AKCPEPFNTLAFSHH-SSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
           AK  +P  T    +H  +NLLAA   D  + ++DL + K  L   +GH+ A+T L F   
Sbjct: 74  AKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLIS-KTVLISFNGHKSAITVLAFDTT 132

Query: 307 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPW 366
                      + +I+WDL  +G        E G+ +L      HK A+       +  W
Sbjct: 133 GTRLISASKDSD-IIVWDL--VG--------ESGLYKL----RSHKDAITGLWCEDE-NW 176

Query: 367 LVASTEEENILQVW 380
           L+ ST ++ ++++W
Sbjct: 177 LI-STSKDGLVKIW 189

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 83/185 (44%), Gaps = 12/185 (6%)

Query: 149 SEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208
           S  L + + F  +N + L   PL    LL  S + +V L D N  S   +     ++++S
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLA 268
             V ++ + N    +F   S  S+ KI D+R  ++   T K  +  N++  S  S + + 
Sbjct: 61  LRVINNDFEN--GCIFAATSLASV-KIYDVRNGDSPVATIKNDK--NSVFLSLESRHDML 115

Query: 269 AAGT-----DSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIM 322
             GT     D+ +++YD+R   +P+   +  H D +T+++F P                +
Sbjct: 116 VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNI 175

Query: 323 WDLKQ 327
           +DL Q
Sbjct: 176 YDLAQ 180

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 11/117 (9%)

Query: 132 GTVATINGQGTVFIYSRSEGLQ--STLKFHEENGYALSFSP----LVEGLLLSGSDDHTV 185
           G +       +V IY    G    +T+K +++N   LS       LV G  L+G D   +
Sbjct: 71  GCIFAATSLASVKIYDVRNGDSPVATIK-NDKNSVFLSLESRHDMLVCGTELTGVDAE-M 128

Query: 186 ALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242
            ++DV   S   +P+R + D H D + D K+H  +K++  + S D    I DL  E+
Sbjct: 129 FIYDVRYFS---KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 166 LSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFG 225
           L F PL E +L S S D+TV +WD+     S   ++ ++  H D+V    +    K L  
Sbjct: 158 LLFHPLAENILASSSLDYTVKIWDI-----SQEEVK-FTLKHPDMVTSMSFSYDGKHLV- 210

Query: 226 TVSEDSLLKINDLRVENTTT 245
           TVS D  L++ D+R E   +
Sbjct: 211 TVSRDKKLRVWDVRAEKIVS 230

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 86/207 (41%), Gaps = 28/207 (13%)

Query: 117 HEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYA-LSFSPLVEGL 175
           HE++I    Y P     V+  +G  TV I+    G Q +L    E+G   ++ SP    L
Sbjct: 489 HEQDIYSLDYFPSGDKLVSG-SGDRTVRIWDLRAG-QCSLTLSIEDGVTTVAVSPGDGKL 546

Query: 176 LLSGSDDHTVALWDVNGNS-----DSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSE- 229
           + +GS D TV +WD          DS   + T    H D V       F +D  G VS  
Sbjct: 547 IAAGSLDRTVRIWDSETGFLVERLDSENELGTG---HKDSVYSVV---FTRDGHGVVSGS 600

Query: 230 -DSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGT-----------DSHVY 277
            D  +K+ +LR  N  +   K     + + ++ H   +L+ A T           D  V 
Sbjct: 601 LDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVL 660

Query: 278 LYDLRNMKEPLHHMSGHEDAVTNLEFS 304
            +D  +   PL  + GH ++V ++  +
Sbjct: 661 FWDTPS-GNPLLMLQGHRNSVISVAVA 686

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 18/129 (13%)

Query: 233 LKINDLRVENTTTGTAK--CPEPFNTLAFSHHSSNLLAAA----GTDSHVYLYDLRNMKE 286
           +K+ D+R  N+   T +     PF +L   H    LLA      G D+ V++YD+R    
Sbjct: 83  VKVFDIRT-NSCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAVHIYDIRKWDT 138

Query: 287 PLHHM-SGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELI 345
           PL  +   H D VT ++F P                ++DLKQ       D+ ED + ++I
Sbjct: 139 PLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191

Query: 346 MVHAGHKSA 354
              + H   
Sbjct: 192 NYASIHSCG 200

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 23/134 (17%)

Query: 168 FSPLVEGLLLSGSDDHTVALWDV------------NGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  + SGSDD  + +WD+            +G     +P++  +  H+  V    
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTG-HARKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAG 271
           +H   +++  + S D  +K+      N  TG    T K P+   +++FS +  N LA   
Sbjct: 148 YHPVAENVLASSSGDYTVKL-----WNVETGKDMITLKHPDMVTSMSFS-YDGNYLATVA 201

Query: 272 TDSHVYLYDLRNMK 285
            D  + ++++R  K
Sbjct: 202 RDKKLRVWNIREEK 215

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD 222
           G+ L + P+ E +L S S D+TV LW+V    D        +  H D+V  S   +++ +
Sbjct: 144 GHVL-YHPVAENVLASSSGDYTVKLWNVETGKDMI------TLKHPDMVT-SMSFSYDGN 195

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG----TDSHVYL 278
              TV+ D  L++ ++R E   +         N       +S+ LA  G    +D  + +
Sbjct: 196 YLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNIEK 263

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 22/141 (15%)

Query: 175 LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVN------DSKWHNFNKDLFGTVS 228
           +++SGS D T+ +W + G+  +T         H+D V+      + K  + N  L  +  
Sbjct: 120 MIISGSRDKTIKVWSIKGDCLATLL------GHNDWVSQVRVAPNEKQEDDNVTLI-SAG 172

Query: 229 EDSLLK---INDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMK 285
            D ++K   IN  ++E    G        N++  S   S L+A+AG D  + L++L+  K
Sbjct: 173 SDKMVKAWNINQFQIEADFVGH---NNYINSITASPDGS-LVASAGKDGDIMLWNLKQ-K 227

Query: 286 EPLHHMSGHEDAVTNLEFSPH 306
            PL+ +S  +D V  L FSP+
Sbjct: 228 TPLYTLSA-QDEVFALAFSPN 247

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 108/247 (43%), Gaps = 38/247 (15%)

Query: 139 GQGTVFIYS-RSEG-LQSTLKFHEENG-YALSFSPLVEGLLLSGSDDHTVALWDVNGNSD 195
           G G +FI    ++G +  T  F  ++G + ++++ L E  +L    D ++ L+D+  N  
Sbjct: 36  GNGKLFIIDIDNQGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQLND- 94

Query: 196 STRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI-NDLRVENTTTGTAKCPEPF 254
              P+  + + H   V    W+  NK LF + S D  +K+   +R  + TT T   P+P 
Sbjct: 95  --YPVAIFQE-HEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLT---PKPM 148

Query: 255 NTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHXXXXXXX 313
                  H+S L +           D+    +  H  +S +++ +   +FSPH       
Sbjct: 149 TA-----HNSALSSK----------DIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMS 193

Query: 314 XXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEE 373
               + + M+DL+Q      P +A        M H G ++   DF  N     ++A+   
Sbjct: 194 CAGNSYVTMFDLRQ------PANANQ---YSFMAHNGMETLTCDF--NKYRSHIIATGGV 242

Query: 374 ENILQVW 380
           +N+++VW
Sbjct: 243 DNMVKVW 249

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 16/139 (11%)

Query: 256 TLAFSHHSSNLLAAAGTDSHVYLYDLR-------NMKEPL--HHMSGHEDAVTNLEFSPH 306
           T  F+ + S+++A  G D+ V ++DLR       N ++P+  + + GH+ A+  + +SPH
Sbjct: 226 TCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPH 285

Query: 307 XXXXXXXXXXXNRLIMW-DLKQIGAEQTPD----DAEDGVPELIMVHAGHKSAVNDFDLN 361
                          +W DL   G   T      D   G    I  H        D+ L 
Sbjct: 286 HSNMLLSTSYDMTCRVWQDLSDDGRRPTGKTNSIDPTHGC-RFIFSHHTEFVFGADWSLW 344

Query: 362 AQIPWLVASTEEENILQVW 380
            Q P  VAST  +  + +W
Sbjct: 345 GQ-PGYVASTSWDGDVCIW 362

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 18/120 (15%)

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           H  +NLLAA   D  + ++DL + K  L   +GH+ A+T ++F              N +
Sbjct: 86  HDETNLLAAGYMDGTIKVWDLLS-KSVLLTFNGHKSAITVMKFDVTGTRLISGSRDSN-I 143

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVW 380
           I+WDL           +E G+ +L      HK A++      +  WLV ST ++ ++++W
Sbjct: 144 IVWDLV----------SEVGLYKL----RSHKDAISGIWCEGE-DWLV-STSKDGLIKIW 187

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 176 LLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKI 235
           L+SGS D  + +WD+         +R+  D  S I     W    +D   + S+D L+KI
Sbjct: 134 LISGSRDSNIIVWDLVSEV-GLYKLRSHKDAISGI-----WCE-GEDWLVSTSKDGLIKI 186

Query: 236 NDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEP 287
            DL+V+    T  A   E +   A   H  +LL  +G D+ + L++L   KE 
Sbjct: 187 WDLKVQQCIETHIAHTGECW---AMGVH-EDLLITSGADTQLKLWNLDFSKEA 235

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 75/202 (37%), Gaps = 21/202 (10%)

Query: 159 HEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHN 218
           H      + F P    L LSG +D+ V +WD   +  S R  R     H+  +   K  +
Sbjct: 145 HSSGTTCMKFIPNTGHLFLSGGNDNIVKIWDFYHDRKSLRDYRG----HTKAI---KSMS 197

Query: 219 FNKDL--FGTVSEDSLLKINDLRVENTTTGTAKCPEPF----NTLAFSHHSSNLLAAAGT 272
           FN D   F T S D  +K+ D     T TG  K    F    N + F   +++       
Sbjct: 198 FNDDAHNFITSSFDQTVKLWD-----TETGQVKKRLKFKSTPNCVEFRPANNHEFIVGLA 252

Query: 273 DSHVYLYDLRNMKEP--LHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGA 330
           DS +  YD R   +   +     H  ++ +L F P               I  +   I  
Sbjct: 253 DSKIAHYDTRESSKHGLVQTYDHHLGSILSLRFFPDGSKFISSSEDKTVRIWENQINIPI 312

Query: 331 EQTPDDAEDGVPELIMVHAGHK 352
           +Q  D  +  +P  I +H  HK
Sbjct: 313 KQISDTTQYSMP-FIGIHPEHK 333

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 109/284 (38%), Gaps = 60/284 (21%)

Query: 117 HEEEITRARYMP---QNPG---TVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSP 170
           H + IT   + P     PG    +A+ +  GT+ I+  +      +  +  +G+  S S 
Sbjct: 226 HTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTR----RVCIYTLSGHTSSVSC 281

Query: 171 LVEG---LLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTV 227
           +  G   +L S S D TV  WD+         +++    H+  VN             ++
Sbjct: 282 IKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKS----HAHWVNHL-----------SL 326

Query: 228 SEDSLLKINDLRVENTTTGT-----AKCPEPFNTLAFSHHSSNLLAAAGTDSH-VYLYDL 281
           S D  L++       T   +     A+    +  +A  + +   L   G+D   +YL++ 
Sbjct: 327 STDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNP 386

Query: 282 RNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGV 341
               +P+  M+GH+  V ++ FSP            N + +W            D  DG 
Sbjct: 387 LKGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG- 432

Query: 342 PELIMVHAGHKSAVNDFDLNAQIPW-----LVASTEEENILQVW 380
            + I    GH ++V       Q+ W     L+ S  ++  L+VW
Sbjct: 433 -KFIATFRGHVASVY------QVAWSSDCRLLVSCSKDTTLKVW 469

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 14/174 (8%)

Query: 117 HEEEITRARYMPQNPGT-VATINGQGTVFIYSRSEGLQSTLK-FHEENGYALSFSPLVEG 174
           H+  +T  +Y   N G  + + +  G + I+  +  +   L+  H E    +SF+   + 
Sbjct: 122 HDSAVTTMKY--SNAGDWMVSGDTDGNIKIWQPNFNMVKELENAHTECIRDISFNN-ADS 178

Query: 175 LLLSGSDDHTVALWDV-NGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLL 233
             ++ SDD+ + +W+  NG  +     R  S  H D V    WH     L  + S+D+L+
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQE-----RVLSGHHWD-VKSCDWHP-TMGLIASASKDNLI 231

Query: 234 KINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLR-NMKE 286
           K+ D R  N  +   K         F     NLL A   D    ++D+R +MKE
Sbjct: 232 KLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKE 285

>TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {ON}
           Anc_6.135 YGL116W
          Length = 724

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 10/129 (7%)

Query: 179 GSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDL 238
           G +D T+ +WD+    DS   +RT     +  +    W    + L  T S+   ++IND+
Sbjct: 403 GKNDGTLEIWDI----DSMSLVRTMKSHLNVRIGSQSWL---ETLIATGSKSGEIQINDV 455

Query: 239 RVENTTTGTAKCPEPFNTLAFSHHSSNL-LAAAGTDSHVYLYDLRNMKEPLHHMSGHEDA 297
           R++N    T    +       S+ S  L LA+ G D+ V ++D R    P      H  A
Sbjct: 456 RIKNHIVSTWDNHKG-EVCGLSYKSDGLQLASGGNDNTVMIWDTR-TSLPQFIKRNHNAA 513

Query: 298 VTNLEFSPH 306
           V  L + P+
Sbjct: 514 VKALSWCPY 522

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 74/166 (44%), Gaps = 26/166 (15%)

Query: 152 LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTR-PIRTWSDLHSDI 210
           L+ TL+ H     +L+ SP    LLLSGS D ++  W + G+      P+R++   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG-HSHI 67

Query: 211 VNDSKWHNFNKDLFGTVSEDSLLKIN---DLRVENTTTGTAKCPEPFN-------TLAFS 260
           V D            TV+ D    ++   D  V      + KC + F        ++   
Sbjct: 68  VQDC-----------TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTID 116

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH 306
             +S +++A+  D  V +++   + E +  + GH D V+ +  +P+
Sbjct: 117 RRASQIVSAS-RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPN 159

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 23/134 (17%)

Query: 168 FSPLVEGLLLSGSDDHTVALW------------DVNGNSDSTRPIRTWSDLHSDIVNDSK 215
           F P  +  + S SDD  +A+W            D +      +P++ W   H   V    
Sbjct: 89  FDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVK-WLAGHGRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDLRVENTTTG----TAKCPEPFNTLAFSHHSSNLLAAAG 271
           +H   +++  + S D  +KI      N  TG    T K P+   +++FS++ ++ LA  G
Sbjct: 148 FHPVAENILASSSLDYTVKI-----WNVETGEVVYTLKHPDMVTSMSFSYNGAH-LATVG 201

Query: 272 TDSHVYLYDLRNMK 285
            D  + ++D+R  K
Sbjct: 202 RDKKLRVWDIRAEK 215

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 12/128 (9%)

Query: 163 GYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKD 222
           G+ L F P+ E +L S S D+TV +W+V    ++   + T    H D+V  S   ++N  
Sbjct: 144 GHVL-FHPVAENILASSSLDYTVKIWNV----ETGEVVYTLK--HPDMVT-SMSFSYNGA 195

Query: 223 LFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAG----TDSHVYL 278
              TV  D  L++ D+R E   +  A              +S+ LA  G    +D  + +
Sbjct: 196 HLATVGRDKKLRVWDIRAEKIVSEGAAHAGAKTQRVIWLGNSDRLATTGFSRLSDRQIGI 255

Query: 279 YDLRNMKE 286
           +D  N+++
Sbjct: 256 WDAFNLEK 263

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 66/149 (44%), Gaps = 11/149 (7%)

Query: 141 GTVFIYSRSEGLQSTL-KFHEENGYALSFSPLVEGLLLSGSDDHTVALWDV-NGNSDSTR 198
           GT+ I+  +  +   L + H E    ++FS   +   ++ SDD+ + +W+  NG  +   
Sbjct: 145 GTIKIWQPNFNMVKELDRAHTECIRDIAFSH-NDSKFVTCSDDNILKIWNFSNGQQE--- 200

Query: 199 PIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLA 258
             R  S  H D V    WH     L  + S+D+L+K+ D R     +   K         
Sbjct: 201 --RVLSGHHWD-VKSCDWHP-QMGLIASASKDNLVKLWDPRSGQCVSTLLKFKHTVLKTK 256

Query: 259 FSHHSSNLLAAAGTDSHVYLYDLR-NMKE 286
           F     NL+AA   D    ++DLR +MKE
Sbjct: 257 FQPTQGNLMAAISKDKSCRVFDLRQSMKE 285

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 18/120 (15%)

Query: 261 HHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPHXXXXXXXXXXXNRL 320
           HH +NLLAA   D  + ++D++  +  L   + H  A+T L+F P            N +
Sbjct: 85  HHETNLLAAGYADGVIKIWDMQT-QTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN-I 142

Query: 321 IMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVW 380
           I+WDL  +G        E G+ +L      HK ++          WL+ ST ++ +++VW
Sbjct: 143 IIWDL--VG--------EVGLCKL----RSHKDSITGIWFEND-DWLI-STSKDGLIKVW 186

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 76/177 (42%), Gaps = 23/177 (12%)

Query: 111 ITAKYKHEEEITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSP 170
           I AKY+   E+    Y  +    +A     G + I+      Q+ L     +  A++F  
Sbjct: 69  IDAKYEKPAEVAYLEYHHET-NLLAAGYADGVIKIWDMQT--QTVLIIFNSHTAAITFLK 125

Query: 171 L--VEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVS 228
                  L+SGS D  + +WD+ G     + +R+  D  + I     W   N D   + S
Sbjct: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCK-LRSHKDSITGI-----WFE-NDDWLISTS 178

Query: 229 EDSLLKINDLR----VENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDL 281
           +D L+K+ D++    VE     T +C     +LA    S +L+  A  DS + +++L
Sbjct: 179 KDGLIKVWDIKSQQCVETHMAHTTECW----SLAI---SDDLVVTANADSELKIWEL 228

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 118/289 (40%), Gaps = 64/289 (22%)

Query: 138 NGQGTVFIYSR-SEGLQST--LKFHEENG--YALSFSPLVEGLLLSGSDDHTVALWDVNG 192
           NG   +F +++ ++ +QS   +K +   G   +++F+P  + LLLSG +        +  
Sbjct: 83  NGSIEIFKFNQENDSIQSNELIKNNRHTGPIRSITFNPRQDNLLLSGGEG-------IIN 135

Query: 193 NSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTT------G 246
           +S+S + + T +++ +                 T SE  +  +ND  V+N  T       
Sbjct: 136 SSNSAKTLPTINNIQN-----------------TTSEIFIYDLND--VDNPETLPMSPNM 176

Query: 247 TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEP-----LHHMSGHEDAVTNL 301
           T    E  ++LA++   S++ +AAG  S V ++DL+  KE      ++  +G ++  + +
Sbjct: 177 TMNRFETISSLAWNKSLSHVFSAAGNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVV 236

Query: 302 EFSPHXXXXXXXXXXXN-------------RLIMWDLKQIGAE---QTPDDAEDGVPELI 345
           E+ P            N              + +WDL+   A     +P   E+      
Sbjct: 237 EWHPKNSTRIATATSNNISNPLNATANAGDSIYIWDLRNSNAPLQILSPQQFENN----- 291

Query: 346 MVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPK 394
               GH   +   D  AQ    + S+  +N + +W     LP+   P +
Sbjct: 292 -TIVGHTDGIQSLDWCAQDETFLLSSGRDNSIMLWNPDSGLPLTKYPKR 339

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,178,301
Number of extensions: 2230206
Number of successful extensions: 9030
Number of sequences better than 10.0: 714
Number of HSP's gapped: 8530
Number of HSP's successfully gapped: 995
Length of query: 401
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 289
Effective length of database: 40,638,807
Effective search space: 11744615223
Effective search space used: 11744615223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)