Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.11na 1ON23323311681e-164
Skud_5.32na 1ON2332338701e-119
YEL057Cna 1ON2332338681e-118
Smik_5.30na 1ON2342348591e-117
NDAI0D040604.186ON547120730.73
KLTH0H13926g1.441ON563137721.1
Skud_15.253.41ON37872674.4
TDEL0C027907.418ON278641665.9
TBLA0B001502.8ON107944666.0
KAFR0D047605.368ON111899658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.11
         (233 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON} YE...   454   e-164
Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON} YE...   339   e-119
YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Prot...   338   e-118
Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON} YE...   335   e-117
NDAI0D04060 Chr4 (954472..956115) [1644 bp, 547 aa] {ON} Anc_4.1...    33   0.73 
KLTH0H13926g Chr8 complement(1212915..1214606) [1692 bp, 563 aa]...    32   1.1  
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    30   4.4  
TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7....    30   5.9  
TBLA0B00150 Chr2 (20203..23442) [3240 bp, 1079 aa] {ON} Anc_2.8 ...    30   6.0  
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    30   8.9  

>Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  454 bits (1168), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/233 (96%), Positives = 224/233 (96%)

Query: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60
           MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE
Sbjct: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60

Query: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
           TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH
Sbjct: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180
           LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV
Sbjct: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180

Query: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMXXXXXXXXXIVFISTTINFNYQTKV 233
           GSSIVVVRSSFIENDFLYEDYLIWGGGM         IVFISTTINFNYQTKV
Sbjct: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV 233

>Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  339 bits (870), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 197/233 (84%)

Query: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60
           MANGGIQKND TT  K   F T SKEI+IIMKKI+FLERNIT+QLDTLP FPKTLPP+H+
Sbjct: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60

Query: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
           T   RT + + SW  QLKNLLGIYS++EISTLDNLAATLHDQVLKLQAKLFPIAILKQVH
Sbjct: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180
           L+ +NVEN+KILKE+TYEYLSK+NCQRE KFGAFIV+RIFFGDLSLGVSILVNR+ FETV
Sbjct: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFETV 180

Query: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMXXXXXXXXXIVFISTTINFNYQTKV 233
            SSIV+V SSFIENDF YEDYLI G  +         I+FIS TINFNYQTKV
Sbjct: 181 TSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV 233

>YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Protein
           of unknown function involved in telomere maintenance;
           target of UME6 regulation
          Length = 233

 Score =  338 bits (868), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/233 (70%), Positives = 191/233 (81%)

Query: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60
           MAN GIQ+ND   G KTV F   SKEID+IMKKISFLERNIT+QLDTLP FPKTLPPNH+
Sbjct: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60

Query: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120
             ++R  R +  W +QLKNLLGIYS++EI TLDNLAATLHDQVLKLQA LFP AILKQVH
Sbjct: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120

Query: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180
           L+  N+ENK+ILKEITY+YLS +NC+ E+KFG FIV+RIFFGDLSLGVS+L+NRIAFE+ 
Sbjct: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180

Query: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMXXXXXXXXXIVFISTTINFNYQTKV 233
            SSI+VVRSSFIE+DF YEDYLI+             I+FISTT+NFNYQTKV
Sbjct: 181 TSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV 233

>Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON}
           YEL057C (REAL)
          Length = 234

 Score =  335 bits (859), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 168/234 (71%), Positives = 191/234 (81%), Gaps = 1/234 (0%)

Query: 1   MANGGIQKNDGTTGS-KTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNH 59
           M N GIQ+ND      KTV F   SKEID+IM+KISFLE+NIT+QL TLP FPKTLPPNH
Sbjct: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60

Query: 60  ETRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQV 119
           +T + RT RTK +W  QL NLLGIYS+DEI TLD+LAATLHDQVL+LQ+ LFPIAIL+QV
Sbjct: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120

Query: 120 HLNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFET 179
           HLN DNVENKK+LKEITYEYLSK+NC   +KFG FI++RIFFGDLSLG+SILVNR  FET
Sbjct: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET 180

Query: 180 VGSSIVVVRSSFIENDFLYEDYLIWGGGMXXXXXXXXXIVFISTTINFNYQTKV 233
           V SSI+VVRSSFIENDFLYEDYLI+   +         I+FISTTINFNYQTKV
Sbjct: 181 VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234

>NDAI0D04060 Chr4 (954472..956115) [1644 bp, 547 aa] {ON} Anc_4.186
           YGR041W
          Length = 547

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 13/120 (10%)

Query: 35  SFLERNITKQLDTLPLFPKTLPPNHETRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDN 94
           S + RN  +QL    L  K LP   E+R+NRT          L  +     R     L  
Sbjct: 300 SPIYRNSRRQLSVSILNNKILPSPTESRVNRT--------VSLNKMPSHMDRTNSEPLTY 351

Query: 95  LAATLHDQVLKLQAKLFPIAILKQVHLNKDNVENKKILKEITYEYLSKKNCQRESKFGAF 154
             AT   Q  KLQ+   P      V   +  +E   ++ E  +EY  ++N +RE +  +F
Sbjct: 352 TYATCEKQQPKLQSPTSPQTEETHVKYTQSQIE---LIMETMHEY--RENVRREHEPYSF 406

>KLTH0H13926g Chr8 complement(1212915..1214606) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P39968 Saccharomyces
           cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
           protein that interacts with Atg13p required for the
           cytoplasm-to-vacuole targeting (Cvt) pathway interacts
           with Nvj1p to form nucleus-vacuole junctions
          Length = 563

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 58/137 (42%), Gaps = 25/137 (18%)

Query: 33  KISFLERNITKQLDTLPLFPKTLPPNHE-------------TRINRTRRTKGSW---GTQ 76
           K+  L+ NI +      L P T   N E             +RIN   R   SW   G  
Sbjct: 410 KVDLLDSNILE-----ALIPMTFSKNQEVSGNAAAALANLCSRINNYARIIESWETPGDG 464

Query: 77  LKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVHLNKDNVENKKILKEIT 136
           ++  L  + R E  T +++A     Q+L+   +     +LK +  NK+ ++N K L E+ 
Sbjct: 465 IRGFLIRFLRSEYPTFEHIALWTILQLLESHDE----TVLKLIKGNKEIIKNIKHLSEVN 520

Query: 137 YEYLSKKNCQRESKFGA 153
           +E   K +    S+ G+
Sbjct: 521 FESAQKASAAMNSQAGS 537

>Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}
           YOL128C (REAL)
          Length = 378

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 40  NITKQLDTLPLFPKTLPPNHETRINRTRRTKGS-WGTQLKNLLGIYSRDEISTLDNLAAT 98
           N   QLD +      LPP HE+ +N ++  KG+    + K  +  +   E   ++ L   
Sbjct: 253 NAKSQLDEIAKLLGRLPPEHESSVNESQELKGALHDCKFKKFMRWFPNIEFFDVEFLLKV 312

Query: 99  L-HDQVLKLQAK 109
           L +D V +  AK
Sbjct: 313 LVYDSVKRWDAK 324

>TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7.418
           YBL088C
          Length = 2786

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 124 DNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDL 164
           D  E +  + +    Y S K C +  +FG+ IV RI  GD+
Sbjct: 633 DQHETRSFILQEEAMYKSIKECSKIERFGSIIVERIVIGDI 673

>TBLA0B00150 Chr2 (20203..23442) [3240 bp, 1079 aa] {ON} Anc_2.8
           YNL236W
          Length = 1079

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 91  TLDNLAATLHDQVLKLQAKLFPIAILKQVHLNKDNVENKKILKE 134
           T+D L     D V KL  +L P   L+QV+   D +E K+  KE
Sbjct: 157 TIDKLTMLFQDNVYKLHNQLLP---LQQVNEKSDKIERKETKKE 197

>KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {ON}
           Anc_5.368 YHR079C
          Length = 1118

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 71  GSWGTQLKNLL---GIYSRDEISTLDNLAATLHDQVLKLQ---AKLFPIAILKQV-HLNK 123
           GS   Q K++L   G+   D  STLDNL  +L   +L ++   AK+ P  I +Q    + 
Sbjct: 38  GSKRLQSKSILPLEGVLQSDTYSTLDNLYPSLSSSILNVELENAKVEPTRISEQKGSTDV 97

Query: 124 DNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFG 162
           +N +  + L  +T+  LS+++  + S     I   I  G
Sbjct: 98  NNQQYGEPLNSLTHPSLSRRSIDKLSLTNILIAADIEGG 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,470,912
Number of extensions: 955265
Number of successful extensions: 2861
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2938
Number of HSP's successfully gapped: 29
Length of query: 233
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 127
Effective length of database: 41,326,803
Effective search space: 5248503981
Effective search space used: 5248503981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)