Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.106.11ON55355329780.0
Skud_5.316.11ON55755726330.0
Smik_5.296.11ON55555425900.0
YEL058W (PCM1)6.11ON55755625300.0
TPHA0M002106.11ON54555416090.0
Kpol_1032.26.11ON53954815420.0
SAKL0E00902g6.11ON54455015080.0
KAFR0L003406.11ON54055415070.0
TBLA0G009806.11ON55857115000.0
NDAI0K028906.11ON56156814930.0
NCAS0F002006.11ON54955814920.0
TDEL0G046006.11ON52854314790.0
ZYRO0F00506g6.11ON55055914480.0
CAGL0B03597g6.11ON54055214420.0
KLTH0C11506g6.11ON54455314170.0
Kwal_56.223556.11ON54155014120.0
Ecym_30146.11ON55155314040.0
ACR015W6.11ON55253413900.0
KLLA0D00858g6.11ON54155013750.0
KNAG0E009406.11ON53855613610.0
Skud_13.4508.840ON62241900.024
TDEL0B005708.840ON63044900.027
Kpol_1068.88.840ON63231890.031
KNAG0J002708.840ON62574880.044
KLLA0D01573g8.840ON60731880.046
NDAI0K004108.840ON62650870.065
CAGL0M02981g8.840ON61728860.073
YMR278W (PGM3)8.840ON62228860.078
Kwal_27.102588.840ON62031860.080
Suva_13.4668.840ON62228860.084
TPHA0I002508.840ON62935850.11
TBLA0B032508.840ON64328850.11
Smik_13.4918.840ON62228840.12
ZYRO0G14190g8.840ON61028840.13
NCAS0C004108.840ON62551830.16
KLTH0C03872g8.840ON62196830.17
ABL126W8.840ON62427830.18
Ecym_46118.840ON63052820.21
KAFR0B039208.840ON62427820.21
SAKL0D01474g8.840ON62427820.26
CAGL0J10472g5.559ON134587810.34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.10
         (553 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)  1151   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)  1018   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)  1002   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   979   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   624   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   598   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   585   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   585   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   582   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   579   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   579   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   574   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   562   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   560   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   550   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   548   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   545   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   540   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   534   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   528   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    39   0.024
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    39   0.027
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.031
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    39   0.044
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.046
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    38   0.065
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.073
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.078
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.080
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    38   0.084
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    37   0.11 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.11 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.12 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    37   0.13 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    37   0.16 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.17 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.18 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.21 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    36   0.21 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.26 
CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} hi...    36   0.34 

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 1151 bits (2978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/553 (100%), Positives = 553/553 (100%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 121 EKIDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNK 180
           EKIDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNK
Sbjct: 121 EKIDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNK 180

Query: 181 RQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLA 240
           RQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLA
Sbjct: 181 RQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLA 240

Query: 241 SKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDAD 300
           SKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDAD
Sbjct: 241 SKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDAD 300

Query: 301 RVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYI 360
           RVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYI
Sbjct: 301 RVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYI 360

Query: 361 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS 420
           KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS
Sbjct: 361 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS 420

Query: 421 LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPD 480
           LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPD
Sbjct: 421 LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPD 480

Query: 481 RSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQ 540
           RSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQ
Sbjct: 481 RSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQ 540

Query: 541 FCNEVVEYVKSSV 553
           FCNEVVEYVKSSV
Sbjct: 541 FCNEVVEYVKSSV 553

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/557 (87%), Positives = 519/557 (93%), Gaps = 4/557 (0%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDY+QLRKLY+ETC TKN+QYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLANAASFA  F+EFYAELVKLIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 121 EKIDLDA---APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNL 177
           EKIDL A   APH+VVGRDSRESSP+LLRCLTSTMASVFHA V+DLGCVTTPQLHY+T+L
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 178 SNKRQREGGSA-QVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLK 236
           SN+R+REG SA   ATEQDYYSFFI AFNELFTT  +EKRLSVPKLF+DTANGIGGPQLK
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 237 KLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFD 296
           KLLASKDW VPSD+IEI+NDKSDVPKLLN ECGADYVKTNQRLPKGLSPSS +SLYCSFD
Sbjct: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300

Query: 297 GDADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSS 356
           GDADRVVFYYVD E KFHLLDGDKISTLFAKFLSKQLE+ANL  SLKIGVVQTAYANGSS
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 357 TSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR 416
           T+YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFHQTIESELS+
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 417 AQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKC 476
             G  LAL TL CFA LINQTVGDA+SDMLAVLATL+IL MAP +WD+EY DLPNKLVKC
Sbjct: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 477 IVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPT 536
           IVPDRSIFQTTDQERKLQNP GLQ+KIDSVI KY MGRSFVRASGTEDAVRVYAECQD +
Sbjct: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540

Query: 537 KLDQFCNEVVEYVKSSV 553
           KLDQFCNE+V YVK+SV
Sbjct: 541 KLDQFCNEIVGYVKASV 557

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/554 (84%), Positives = 516/554 (93%), Gaps = 2/554 (0%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MKIDY+QL +LY++TC TKN+QYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA WEPYAMQLAN ASFA+ F+EF AEL +LIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 121 EKIDLDAA--PHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178
           EKI LD +  PH+VVGRDSRESSP+LLRCLTSTM SVFHA V+DLGCVTTPQLHY+T+LS
Sbjct: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKL 238
           NKR+REGGSA+VATEQDYYSFFI AFNELF+T +IEKRLSVP+LF+D ANGIGGPQLKKL
Sbjct: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240

Query: 239 LASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298
           L SKDW VP D+IE++NDKSDVP+LLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300

Query: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358
           ADRVVFYYVD ES+FHLLDGDKISTLFAKFLSKQLELA+L +SL+IGVVQTAYANGSST+
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ 418
           YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFHQ I+SELSRA+
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420

Query: 419 GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIV 478
           G +LAL TL CF+ LINQTVGDA+SDMLAVLATL+I+ MAP DWDKEYTDLPNKLVKCIV
Sbjct: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480

Query: 479 PDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKL 538
           PDRSIFQT DQERKLQNP GLQ KID VI KY MGRSFVRASGTEDAVR+YAECQD ++L
Sbjct: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540

Query: 539 DQFCNEVVEYVKSS 552
           DQFCNE+VE VK+S
Sbjct: 541 DQFCNEIVELVKAS 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/556 (83%), Positives = 515/556 (92%), Gaps = 4/556 (0%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           MK+DY+QL KLY++TC TKN+Q+SYGTAGFRTLAK+LDTVMF+TGILAVLRSLKLQGQYV
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA WEPYAMQLANAASFA  F+EF  EL KLIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 121 EKIDLD--AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178
           EKIDL+    PH+VVGRDSRESSP+LLRCLTS+MASVFHA V+DLGCVTTPQLHY+T+LS
Sbjct: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKL 238
           N+R+ EG +A VATEQDYYSFFI AFNELF T Q+EKRLSVPKLF+DTANGIGGPQLKKL
Sbjct: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240

Query: 239 LASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298
           LAS+DW VP++++E++ND+SDVP+LLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300

Query: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358
           ADRVVFYYVD  SKFHLLDGDKISTLFAKFLSKQLELA+L  SLKIGVVQTAYANGSST+
Sbjct: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ 418
           YIK+TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFH+TI+SELS+++
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 419 --GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKC 476
             G  LAL TL+CF+ LINQTVGDAISDMLAVLATL+IL M+P DWD+EYTDLPNKLVKC
Sbjct: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480

Query: 477 IVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPT 536
           IVPDRSIFQTTDQERKL NP GLQ KID V+ KY MGRSFVRASGTEDAVRVYAEC+D +
Sbjct: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540

Query: 537 KLDQFCNEVVEYVKSS 552
           KL QFC+EVVE+VK+S
Sbjct: 541 KLGQFCDEVVEHVKAS 556

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/554 (57%), Positives = 392/554 (70%), Gaps = 12/554 (2%)

Query: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           + ++ L  ++E  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGV
Sbjct: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122
           MITASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  +  EF   L +     K
Sbjct: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120

Query: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQ 182
           +D    P +VVGRDSR+S P LL+CL S    +    ++D G +TTPQLH++TN  N  +
Sbjct: 121 VDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180

Query: 183 REGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASK 242
               S    TE DYYSFF++A+  + T     K L  P+L++D ANGIGGP++ KL   +
Sbjct: 181 ----SRAPVTEDDYYSFFMDAWVSI-TALHGIKVLQSPRLYIDAANGIGGPKVSKLF--E 233

Query: 243 DWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSP---SSPDSLYCSFDGDA 299
            W   + +  +VN+    P LLN +CGADYVKTNQRLPK + P   S P +LYCSFDGDA
Sbjct: 234 VWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDA 292

Query: 300 DRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSY 359
           DR+VFYY D ++ FHLLDGDKISTLFA F+SKQL+ A LT+ + +GVVQTAYANG+ST+Y
Sbjct: 293 DRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352

Query: 360 IKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQG 419
           +++ L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +T ES L     
Sbjct: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNE 412

Query: 420 SLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVP 479
           S L + TL  FA+LINQTVGDAISDML VLA LSI+ + P+ WDKEYTDLPN L K +VP
Sbjct: 413 S-LEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVP 471

Query: 480 DRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLD 539
           DRS+F TTDQERKL  P G QTKID+++ KY  GRSFVRASGTEDAVRVYAE   P    
Sbjct: 472 DRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAA 531

Query: 540 QFCNEVVEYVKSSV 553
               EV + V +SV
Sbjct: 532 ALNEEVSKAVLASV 545

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/548 (56%), Positives = 394/548 (71%), Gaps = 16/548 (2%)

Query: 10  KLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69
           KL+E+ C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASHN
Sbjct: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYA---ELVKLIEHEKIDLD 126
           P +DNGVKIVEP+G+ML  +WEP A +LAN A+  +TFD+  A   E VK    E     
Sbjct: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAA-NSTFDDLKAYVEEKVKKFSPES-GSK 121

Query: 127 AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGG 186
             P VVVGRDSRES  +LL CL ++  +  +A +++ G +TTPQLH++TN  N ++    
Sbjct: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK---- 177

Query: 187 SAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAV 246
            +    E  YY++FI ++N++     I   L    L +DTANGIGGP++++LL  K W  
Sbjct: 178 -SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KSWPF 233

Query: 247 PSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDS-LYCSFDGDADRVVFY 305
            S ++ +VN++ + P LLN  CGAD+VKTNQ+LP G+S +S ++ LYCS+DGDADR+VFY
Sbjct: 234 AS-KVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFY 292

Query: 306 YVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLH 365
           + D + +FHLLDGDKISTLFAK ++K L  ANL   + +GVVQTAYANGSST+Y++ TL+
Sbjct: 293 FQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLN 352

Query: 366 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSLLALN 425
            PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS  F+Q  E EL +A    +A+N
Sbjct: 353 VPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESIAVN 411

Query: 426 TLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQ 485
           TL   ++LINQTVGDAISDML VL+ LSI+ ++   WD EYTDLPN L K IVPDRS+F 
Sbjct: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471

Query: 486 TTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEV 545
           TTDQERKL +P GLQ+KID  I +++ GRSFVRASGTEDAVRVYAE     +  +    V
Sbjct: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531

Query: 546 VEYVKSSV 553
            + VK SV
Sbjct: 532 TKLVKESV 539

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/550 (55%), Positives = 380/550 (69%), Gaps = 17/550 (3%)

Query: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67
           L +LY++ C T    Y+YGTAGFR  A  LDTVMFTTGILA +RS+ L+GQYVGVMITAS
Sbjct: 7   LEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITAS 65

Query: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127
           HNP QDNGVKIV+P G ML  AWEP+A +LAN+AS      E    L KLI    ID   
Sbjct: 66  HNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLITKLGIDDTE 123

Query: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGS 187
           +  + + RDSRES P LL+ +      + +  VVD   +TTPQLH++T   N+     GS
Sbjct: 124 SAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-----GS 178

Query: 188 AQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLASKDWAV 246
           +    E  YYS F +A+ ++   C +    S+P ++ +D ANGIGGP++ ++L    +  
Sbjct: 179 SSKVEESTYYSAFSSAWTKI---CGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFF- 234

Query: 247 PSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDS-LYCSFDGDADRVVFY 305
            S  + ++N++   P+LLN  CGADYVKTNQ  PKG+S +S +  +YCSFDGDADR+VFY
Sbjct: 235 -SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFY 293

Query: 306 YVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLH 365
           Y D +SKF+LLDGDKISTLFAKF  + L  A   + LK+GVVQTAYANGSST Y+   L 
Sbjct: 294 YHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILE 353

Query: 366 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ--GSLLA 423
            PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS +FH+TI+ +L   Q   +  A
Sbjct: 354 VPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAKA 413

Query: 424 LNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSI 483
           L TL  F NLINQTVGDAISDMLAVLA L IL  +P  WD+EYTDLPNKLVK IVPDRS+
Sbjct: 414 LKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSV 473

Query: 484 FQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCN 543
           F+T++ ER+L +P GLQ KIDS + ++  GRSFVRASGTEDAVRVYAE     K D+   
Sbjct: 474 FKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAA 533

Query: 544 EVVEYVKSSV 553
            V + V  SV
Sbjct: 534 SVSDLVSRSV 543

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/554 (53%), Positives = 378/554 (68%), Gaps = 21/554 (3%)

Query: 4   DYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVM 63
           D  QL   + + C T+N  Y+YGTAGFR  A  LDTVMFTTGI+A+LRSL LQG+Y+GVM
Sbjct: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 64  ITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKI 123
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS    F  F   L ++I    I
Sbjct: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIAKLNI 121

Query: 124 DLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQR 183
           D    P ++VG DSRESSP+L+ CL +  A VF   V++   +TTPQLHY+T L N    
Sbjct: 122 DETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQN---- 176

Query: 184 EGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKD 243
                 V TE DYY FF  ++N LF+    +  L+   L VD ANG+G  Q  K L    
Sbjct: 177 -----DVVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLP--- 227

Query: 244 WAVP--SDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADR 301
             +P  +    I+NDK +VP++LN +CGAD+VKTNQ+LP G+   +P  LY SFDGDADR
Sbjct: 228 -YLPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADR 286

Query: 302 VVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIK 361
           +VFYYVD   KFHLLDGDKIST+  K L   L  + L + + +GVVQTAYANGSST YI 
Sbjct: 287 IVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346

Query: 362 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS- 420
            +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++ ++  +     S 
Sbjct: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406

Query: 421 --LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIV 478
               A  +L  F+ LINQTVGD+++D+LAV+ATLSIL ++P+DWD EY DLPN L KC V
Sbjct: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466

Query: 479 PDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKL 538
            +R +F+TTD ERKL +P+GLQ KID+ + KY  GRSFVRASGTEDAVR+YAE +   ++
Sbjct: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526

Query: 539 DQFCNEVVEYVKSS 552
           +    EV + V++S
Sbjct: 527 EALSKEVTQLVENS 540

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/571 (53%), Positives = 396/571 (69%), Gaps = 34/571 (5%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
            ++D  +   L+ + C TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS     DE    LV+ +  
Sbjct: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS-QGKIDE----LVQFVNA 117

Query: 121 EKIDLDA--APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178
           + I+L++   P ++VGRDSRESS  LL CL      +F A +VD   +TTPQLH++TN  
Sbjct: 118 KLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAY 177

Query: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTT---CQIEKRLSVPKLFVDTANGIGGPQL 235
           N  +       +  E DYY  F NA+++L +            +  L +D+ANGIGGP++
Sbjct: 178 NLEK------DLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231

Query: 236 KKLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLS-----PSSPDS 290
           + LL  K W   + ++ ++N+    P+ LN  CGADYVKTNQ+LP G++      SS + 
Sbjct: 232 ENLL--KYWKT-NYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNV 288

Query: 291 LYCSFDGDADRVVFYYVDPESK-FHLLDGDKISTLFAKFLSKQLELANL--TDSLKIGVV 347
           ++CSFDGDADRVVFYY DP+S  F+LLDGDKISTLFA F+S QL+LA +   + +K+GVV
Sbjct: 289 IHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVV 348

Query: 348 QTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFH 407
           QTAYANGSST+Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFS+ F+
Sbjct: 349 QTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFY 408

Query: 408 QTIESEL---SRAQGS--LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDW 462
           + I  ++   S+ + +  L AL TL+  + LINQTVGDAISDM+ V+A L+IL+  P  W
Sbjct: 409 KIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIW 468

Query: 463 DKEYTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGT 522
           +KEYTDLPNKL K +VPDRS+F+TTDQERKL +PAGLQ+KI+ ++ KY  GRSFVRASGT
Sbjct: 469 NKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGT 528

Query: 523 EDAVRVYAECQDPTKLDQFCNEVVEYVKSSV 553
           EDAVRVYAE  D   +++ C EV++    SV
Sbjct: 529 EDAVRVYAEASD--DVNKLCQEVLDATAESV 557

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/568 (54%), Positives = 386/568 (67%), Gaps = 29/568 (5%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQY- 59
           M  + DQL+  + E C TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 60  ---VGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVK 116
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+   +FDEFY  L+ 
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAA-NESFDEFYQLLID 123

Query: 117 LIEHEKIDLD--AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYV 174
            I   + DL+    P +++G DSR+SSP L+  +  +   +F+A +++   VTTPQLH++
Sbjct: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183

Query: 175 TNLSNKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQ 234
           T           +   A E +YY  F N +     +      L    L +D ANGIG PQ
Sbjct: 184 T-------NLTNTTGTAEEINYYDHF-NKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQ 235

Query: 235 LKKLLASKDWAVP---SDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPD-- 289
           ++KLL +K+   P    + I+I+N+ S  P LLN  CGADYVKTNQ+LP+G+ P   D  
Sbjct: 236 VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGI-PKDIDAN 294

Query: 290 -SLYCSFDGDADRVVFYYVDP-ESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVV 347
            +L+CS+DGDADR+VFYY+DP  + F+LLDGDKI+TLFAKF S  L +A L   LK+GVV
Sbjct: 295 STLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVV 354

Query: 348 QTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFH 407
           QTAYANGSST+YI   L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS KFH
Sbjct: 355 QTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH 414

Query: 408 QTIESELSRAQ--GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKE 465
               SEL++ +  GS   + TL  F+ LINQTVGDA+SDMLAV+A LSIL ++P  WDKE
Sbjct: 415 ----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKE 470

Query: 466 YTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDA 525
           Y DLPNKL K IVPDRS F TTDQERKL  P GLQ  ++  +   ++GRSFVRASGTEDA
Sbjct: 471 YKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDA 530

Query: 526 VRVYAECQDPTKLDQFCNEVVEYVKSSV 553
           VRVYAE +   + +    +V + V  SV
Sbjct: 531 VRVYAEAKTQEETEWLSKKVCQLVIESV 558

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/558 (51%), Positives = 391/558 (70%), Gaps = 16/558 (2%)

Query: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60
           M ID   L+++Y  TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+   +F++ Y  ++++ + 
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAA-NESFEKVYDFILEVSKD 119

Query: 121 EKIDL-DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSN 179
            K    +  P +++G DSRESSP L + L +T   +++A + + G VTTPQLH++T+L N
Sbjct: 120 PKFPFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWN 179

Query: 180 KRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLL 239
            +  +  +  V +  +YY++F  ++++           S   L +D+ANGIGGP++  L+
Sbjct: 180 AKYNKN-TNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLI 238

Query: 240 ASKDWAVPS---DEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFD 296
           ++  W  PS     + I+N+  + P LLN +CGADYVKTNQ+LPKG+   S  +L+CSFD
Sbjct: 239 ST--W--PSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFD 294

Query: 297 GDADRVVFYYV-DPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGS 355
           GDADR+VFYY+ + + KFHLLDGDKI+TLFAKFLS  L+  NLTD LK+GVVQTAYANGS
Sbjct: 295 GDADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGS 354

Query: 356 STSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELS 415
           ST+Y+ + L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FS++F Q +++E  
Sbjct: 355 STNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPK 414

Query: 416 RAQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVK 475
                  A  TL  F  +INQTVGDA++DML V+  LS+  + P+ WD+ Y DLPNKL K
Sbjct: 415 TT-----ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAK 469

Query: 476 CIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDP 535
            IVPDRS+F TT+QER+L +P GLQ KID  + K   GRSFVRASGTEDAVRVYAE    
Sbjct: 470 VIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQ 529

Query: 536 TKLDQFCNEVVEYVKSSV 553
            + ++   EV ++V SSV
Sbjct: 530 EETEKLSQEVCKFVLSSV 547

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 374/543 (68%), Gaps = 22/543 (4%)

Query: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67
           L  L E+ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127
           HNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     ++  A++ +L   E      
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGES---SV 120

Query: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGS 187
            P ++VGRDSR S P LL CL ++  S+F A + D G +TTPQLH++TN +        +
Sbjct: 121 RPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNETMI------T 174

Query: 188 AQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVP 247
                EQ Y++ F+ A++++       + + +P + VD ANGIGGP++  LL    W   
Sbjct: 175 GAHVDEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ--WGF- 227

Query: 248 SDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADRVVFYYV 307
           + +  ++NDK D P+LLN  CGAD+VKT+QRLP G+ P++ D LYCSFDGDADRVVFYY+
Sbjct: 228 AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVVFYYL 286

Query: 308 DPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLHCP 367
           D    FHLLDGDKISTLFA F++K L+   L   L +GVVQTAYANGSST Y++D L  P
Sbjct: 287 DQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVP 346

Query: 368 VSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSLLALNTL 427
           VSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+T+ +   +       L  L
Sbjct: 347 VSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP----ELKIL 402

Query: 428 RCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQTT 487
           +  A LINQTVGDAISDM+AVLA LSIL  +P+ WD+E+TDLPNKL K +V DRS F TT
Sbjct: 403 KYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTT 462

Query: 488 DQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEVVE 547
           DQER+L +PAGLQ KID  + +   GRSFVRASGTEDAVRVYAE    ++ DQ  + V +
Sbjct: 463 DQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGD 522

Query: 548 YVK 550
            V+
Sbjct: 523 LVR 525

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/559 (52%), Positives = 375/559 (67%), Gaps = 26/559 (4%)

Query: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           D L KL ++ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64

Query: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHE-KID 124
           ASHNP  DNGVK+VEPDGSM+  +WEP A +LAN  +   +  E        ++ E K  
Sbjct: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124

Query: 125 LDAA---------PHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVT 175
           L +A         P +VVGRDSRES P LL CL ++   +FHA + D G +TTPQLH++T
Sbjct: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184

Query: 176 NLSNKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRL-SVPKLFVDTANGIGGPQ 234
           + + K     G A V TE  YY  F+ A++ +     I + L ++  L +D ANGIG P+
Sbjct: 185 SETAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238

Query: 235 LKKLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCS 294
           +++LL+   WA    ++  +NDK   P+LLN ECGAD+VK+NQR P G + S+   L CS
Sbjct: 239 VQELLS--QWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCS 293

Query: 295 FDGDADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANG 354
           +DGDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L   L +GVVQTAYANG
Sbjct: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353

Query: 355 SSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESEL 414
           +ST Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ I+ + 
Sbjct: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQK 413

Query: 415 SRAQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLV 474
            R+    +A+ TL  F+ LINQTVGDAISDML VLA LSI    P  W +E+TDLPN+L 
Sbjct: 414 ERS----VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469

Query: 475 KCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQD 534
           K +VPDRS+F TTDQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVRVYAE   
Sbjct: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529

Query: 535 PTKLDQFCNEVVEYVKSSV 553
              +++  N V E V  SV
Sbjct: 530 LEDVEKLSNTVKELVVKSV 548

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/552 (54%), Positives = 376/552 (68%), Gaps = 25/552 (4%)

Query: 10  KLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHN 69
           +LY + C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDAAP 129
           P +DNGVKIVE DGSMLL  WEP A +LAN+    A +  F + L  +++   I    AP
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSV---ADYHTFESTLNAIMQELNISPGHAP 120

Query: 130 HVVVGRDSRESSPFLLRCLTSTMASVF-HAHVVDLGCVTTPQLHYVTNLSNKRQREGGSA 188
            +VVG DSRESSP LL  L   + +V   A + + G +TTPQLH++T            A
Sbjct: 121 QIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT------------A 168

Query: 189 QVATEQDYY-SFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVP 247
             A  +DYY  +F++A+N+LF    IE   S  KL +DTANGIGGPQ  K+L+     +P
Sbjct: 169 NPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLP 228

Query: 248 S------DEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADR 301
                   +I+I N+    P +LN  CGAD+VKTNQRLP+G++ + P +LYCSFDGDADR
Sbjct: 229 HLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGIN-ADPRNLYCSFDGDADR 287

Query: 302 VVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIK 361
           VVFYYVD    FHLLDGDKISTL A F++  L+ A L + LK+GVVQTAYANGSST+Y+ 
Sbjct: 288 VVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVT 347

Query: 362 DTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSL 421
             L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++ IE  L++     
Sbjct: 348 KKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK-NAHD 406

Query: 422 LALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDR 481
            +  TLR  + LINQT+GDAISDMLA++  L IL  +P  WD EYTDLPNKL K +VPDR
Sbjct: 407 KSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDR 466

Query: 482 SIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQF 541
           SIF TTDQER+L +PAGLQ KID ++     GRSF+RASGTEDAVRVYAE Q     ++ 
Sbjct: 467 SIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKL 526

Query: 542 CNEVVEYVKSSV 553
             EV + +  +V
Sbjct: 527 STEVTDALIETV 538

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/553 (52%), Positives = 375/553 (67%), Gaps = 18/553 (3%)

Query: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           +D   L  LYE T C     Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 2   LDTKTLETLYE-THCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F A L  L+    
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVSELG 118

Query: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQ 182
           +D DA   + V RDSRES P LL  L +    + +  + D G +TTPQLH++T+  N+  
Sbjct: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178

Query: 183 REGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLAS 241
            +    +      YY  F++A++++   C I+   S+P KL +D ANGIG P++K++L++
Sbjct: 179 NDTAIDRFF----YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEMLST 231

Query: 242 KDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGDAD 300
             +        +VND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGDAD
Sbjct: 232 HKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDAD 289

Query: 301 RVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYI 360
           R+VFY+ D E +F LLDGDK++TLFAKF    L  ANL + L +GVVQTAYANGSST YI
Sbjct: 290 RIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYI 349

Query: 361 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELS---RA 417
           +  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FSKKF + + S LS   ++
Sbjct: 350 ERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQS 408

Query: 418 QGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCI 477
             SL +L  L  FANLINQTVGDAISDM+ VLA LSIL   P  W++EYTDLPNKLVK +
Sbjct: 409 DSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVL 468

Query: 478 VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTK 537
           VPDR++F+TT+ ER+L +P GLQ KI++++ +Y   RSFVRASGTEDAVRVYAE     +
Sbjct: 469 VPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREE 528

Query: 538 LDQFCNEVVEYVK 550
            D   + V + V+
Sbjct: 529 ADSLASRVSQVVE 541

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/550 (52%), Positives = 376/550 (68%), Gaps = 22/550 (4%)

Query: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62
           +D   L+ LYE  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF A + +L+   +
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLE 118

Query: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNK-- 180
           +  +    +VV RDSRES P LL    S +  + +  V D G +TTPQLH++T+ SN+  
Sbjct: 119 VGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELP 178

Query: 181 RQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLL 239
           +  E G +       YY  F++A+ E+   C+I+   S+P KL +D ANGIG P + ++L
Sbjct: 179 KGTEIGKSL------YYDNFLSAWVEIAELCKID---SLPYKLEIDAANGIGAPVVTEML 229

Query: 240 ASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGD 298
           +   +        +VND+ + P  LN  CGAD+VKTNQ+LP G++P    + + CSFDGD
Sbjct: 230 SQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGD 287

Query: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358
           ADR+VFYY      FHLLDGDK++TLFAKF  + L  A L D L++GVVQTAYANGSST+
Sbjct: 288 ADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTA 347

Query: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR-- 416
           YI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I+ +LS   
Sbjct: 348 YIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKL 406

Query: 417 -AQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVK 475
            +  +  +L  L  FA LINQTVGDAISDMLAVLA LSIL  +P  WD+EYTDLPNKL+K
Sbjct: 407 ESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIK 466

Query: 476 CIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDP 535
            +VPDR++F+T + ER+L +PAG+Q KID+++  ++ GRSFVRASGTEDAVRVYAE   P
Sbjct: 467 VLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATP 526

Query: 536 TKLDQFCNEV 545
            + +    +V
Sbjct: 527 QETEALSQQV 536

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/553 (52%), Positives = 369/553 (66%), Gaps = 16/553 (2%)

Query: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           +++ KLY++ CC++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDL 125
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS      +F   L +L+    I  
Sbjct: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGK--HQFLHRLQELMNQFGIKA 121

Query: 126 DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREG 185
           D+   +VV RDSRES   LL+ L    +   +  +VD   +TTPQLH++T   N RQ E 
Sbjct: 122 DSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLN-RQMES 180

Query: 186 GSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWA 245
                  E  YYS F++A  EL     I   L  P L +D ANG+GG + ++L     + 
Sbjct: 181 ERVIEVNEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNTFF 238

Query: 246 VPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGDADRVVF 304
              D   I+N       LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV+F
Sbjct: 239 --KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIF 296

Query: 305 YYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTL 364
           YY D +  FHLLDGDKISTLFAKF    L +A + D++K+GVVQTAYANGSST Y+ + L
Sbjct: 297 YYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVL 356

Query: 365 HCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGSL--- 421
             PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFS+ F+ T+   L   +GSL   
Sbjct: 357 IVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLK--EGSLSAE 414

Query: 422 --LALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVP 479
             +AL TL+ F+ LINQTVGDA+SDM+AVLA L IL   P  WD EYTDLPN L+K +VP
Sbjct: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474

Query: 480 DRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLD 539
           DRS+F+TT+ ER+L +P GLQ +ID VI  Y   RSFVRASGTEDAVR+YAE     + D
Sbjct: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQAD 534

Query: 540 QFCNEVVEYVKSS 552
               ++ + V S+
Sbjct: 535 DLSIKISQLVISA 547

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/534 (53%), Positives = 359/534 (67%), Gaps = 14/534 (2%)

Query: 23  YSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPD 82
           Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+TASHNP +DNGVK+V+P 
Sbjct: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80

Query: 83  GSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDAAPHVVVGRDSRESSP 142
           G ML A WE +A  LAN AS      E    L  L++   +DL     VVV RDSR S P
Sbjct: 81  GEMLAAEWEKHATALANCASQGQ--QELLDALHMLVDRLGLDLALRARVVVARDSRASGP 138

Query: 143 FLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGSAQVATEQDYYSFFIN 202
            LL  L      +    VVD G +TTPQLH++T   N+R    GSA    E  YY+ F+ 
Sbjct: 139 QLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER----GSAAGVREDLYYAHFVA 194

Query: 203 AFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVPSDEIEIVNDKSDVPK 262
           A  EL     +E  L  P L VDTANG+G  + ++L   +   +  + + I+ND     +
Sbjct: 195 ALEELAALHGLET-LPFP-LVVDTANGVGALKARELF--RRSPLFKNRVSIINDNWSQHE 250

Query: 263 LLNFECGADYVKTNQRLPKGLSPSS-PDSLYCSFDGDADRVVFYYVDPESKFHLLDGDKI 321
           LLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV+FYY+D + +FHLLDGDKI
Sbjct: 251 LLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKI 310

Query: 322 STLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHE 381
           STL AKFL   L  A + D + +GVVQTAYANGSST Y+ + L  PVSCT TGVKHLH E
Sbjct: 311 STLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHRE 370

Query: 382 AATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR---AQGSLLALNTLRCFANLINQTV 438
           A  +YD+GIYFEANGHGT+IFS+ F  T+E  L     +  + L+L TL+ FANLINQT+
Sbjct: 371 AVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTI 430

Query: 439 GDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAG 498
           GDAI+DMLAV+A LSILH +P DWDK+YTDLPN LVK +VPDRS+F+TT+ E++L +PAG
Sbjct: 431 GDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAG 490

Query: 499 LQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEVVEYVKSS 552
           LQ  ID ++  Y  GRSFVRASGTEDAVR+YAE     + D+   +V   V  S
Sbjct: 491 LQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/550 (53%), Positives = 380/550 (69%), Gaps = 21/550 (3%)

Query: 8   LRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITAS 67
            R LYE+  C +   Y+YGTAGFR     LDTVMFTTGI+AVLRS+ L+ ++VGVMITAS
Sbjct: 3   FRDLYEQ-YCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITAS 61

Query: 68  HNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDA 127
           HNP +DNGVK+VEP G ML+  WEP A +LANAAS  ++F +  + L  +I    ID   
Sbjct: 62  HNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNIDTTQ 119

Query: 128 APHVVVGRDSRESSPFLLRCLTSTMASVFHA-HVVDLGCVTTPQLHY-VTNLSNKRQREG 185
             ++ V RDSRES P LL  L + + SVF A  ++D   +TTPQLH+ V +L+   Q   
Sbjct: 120 LANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLVYSLNTSSQ--- 175

Query: 186 GSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLASKDW 244
             +QV  +  YY  F++ +N+L    Q+ +   +P  L +D ANGIG  ++K+L+ S+  
Sbjct: 176 -PSQV-RDSTYYDHFVSIWNQL---TQLYEVTELPFHLTIDCANGIGADKVKQLI-SQAG 229

Query: 245 AVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGDADRVVF 304
            +  + +  VN ++   +LLN  CGAD+VKTNQ  P   +P  P  LYCSFDGDADRVVF
Sbjct: 230 HMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPK-PSQLYCSFDGDADRVVF 288

Query: 305 YYVD-PESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDT 363
           YYVD  E+KFHLLDGDKI+TL AK ++  L    L+D+LK+GVVQTAYANGSST YI D 
Sbjct: 289 YYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDK 348

Query: 364 LHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQGS--- 420
           L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS++F +T++S L    G+   
Sbjct: 349 LKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQ 408

Query: 421 LLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPD 480
             +L +L+  + LINQTVGDAISDMLAV+ATLSI ++ P DWD  Y DLPN+L K IVPD
Sbjct: 409 YKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPD 468

Query: 481 RSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQ 540
           RS+F +T+ ER+L +P GLQ KID ++ ++   RSFVRASGTEDAVRVYAE +      +
Sbjct: 469 RSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIE 528

Query: 541 FCNEVVEYVK 550
              +V E VK
Sbjct: 529 LATKVGELVK 538

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/556 (50%), Positives = 361/556 (64%), Gaps = 29/556 (5%)

Query: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65
           + +R +++  C TK   Y+YGTAGFR  A  LDTVMF TG +AVLRS +L G  VGVM+T
Sbjct: 4   EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDL 125
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+   TFD+++     L+E    + 
Sbjct: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAA-NGTFDQWWEYWTSLVEEG--NY 120

Query: 126 DAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHV-VDLGCVTT-PQLHYVTNLSNKRQR 183
                + VG D+RESSP LL+ L     +V    + +    +T  PQLHY+T+L    QR
Sbjct: 121 TGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL----QR 176

Query: 184 EGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKD 243
           +G    V     Y   F   + +LF    +       +LF+DTANG+G  QL++    K 
Sbjct: 177 DG----VTDAAAYNDHFQGCWQKLFPDGVVA--WPFDRLFIDTANGVGAVQLQQFF--KG 228

Query: 244 WAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLP------KGLSPSSPDSLYCSFDG 297
           WAV  ++  ++N     P+ LN +CGAD+VKTN RLP      +G S + PD LYCSFDG
Sbjct: 229 WAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPD-LYCSFDG 287

Query: 298 DADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSST 357
           DADR+VFY+V    +FHLLDGDKISTLFAKF+ +    A   D L +GVVQTAYANG+ST
Sbjct: 288 DADRIVFYFVK-NKQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNST 346

Query: 358 SYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRA 417
            YI   L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS KF++ +    S  
Sbjct: 347 RYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVASTN 406

Query: 418 QGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCI 477
                A +TL  F+ LINQTVGDAI+DML VLA L  L   P  W  EYTDLPN L K +
Sbjct: 407 D----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVV 462

Query: 478 VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTK 537
           VPDRSIF+TTDQER+L +P GLQ KID+ +G++   RSFVRASGTE+AVR+Y E +DP +
Sbjct: 463 VPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQE 522

Query: 538 LDQFCNEVVEYVKSSV 553
           + +   +V E V +SV
Sbjct: 523 VQELSKQVTEAVLNSV 538

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANA 100
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANA 100
           G  VGVMITASHNP  DNG K+   +G  ++    P+  ++A +
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDSEIAQS 196

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 28  AGFRTLAKDL-DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           AGF+ L  +  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180

Query: 87  LAAWEPYAMQLANA 100
           +    P+ + +A +
Sbjct: 181 IP---PHDLNIARS 191

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDE 109
           +GVMITASHNP  DNG K+   +G  ++           +  + AAT DE
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIP---------PHDKNIAATIDE 194

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 53  LKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           + L    +GVMITASHNP  DNG K+   +G  ++
Sbjct: 150 INLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 28  AGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKI 78
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K+
Sbjct: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKV 171

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 10/96 (10%)

Query: 38  DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQ- 96
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++   +    Q 
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193

Query: 97  -LANAASFAATFD--EFYAELVK---LIEHEKIDLD 126
            LAN   +   +D     AE V+   LI+ +K+ +D
Sbjct: 194 ILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVD 229

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 35  KDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           KD+++ + T  +   + +++  G   G+MITASHNP  DNG K+   +G  +
Sbjct: 139 KDVESYVHTPMVPFTVSNIE-GGASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQII 184

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} highly
            similar to uniprot|P38931 Saccharomyces cerevisiae
            YDR443c SCA1 DNA-directed RNA polymerase II
          Length = 1345

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 5/87 (5%)

Query: 466  YTDLPNKLVKCI-----VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRAS 520
            Y  LPNK++K       +P++  F+T+ Q    +  A +       + K  M  +   ++
Sbjct: 1054 YNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFKYDAYIHLAYSRSVDKQWMFAALSDSA 1113

Query: 521  GTEDAVRVYAECQDPTKLDQFCNEVVE 547
            G E+ ++ +       K D+ CN + E
Sbjct: 1114 GKENMMKTWYLGSSKNKFDEACNHIWE 1140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,429,492
Number of extensions: 2465212
Number of successful extensions: 6296
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6334
Number of HSP's successfully gapped: 44
Length of query: 553
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 438
Effective length of database: 40,294,809
Effective search space: 17649126342
Effective search space used: 17649126342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)