Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_5.1na 1ON1611618531e-118
Skud_5.22na 1ON1611617082e-96
YEL066W (HPA3)na 1ON1791617074e-96
Smik_5.21na 1ON1611616985e-95
Skud_16.497na 2ON1551524651e-59
KAFR0D02290singletonON1621564652e-59
YPR193C (HPA2)na 2ON1561524494e-57
Suva_16.525na 2ON1551514415e-56
NCAS0A09820na 2ON1501504285e-54
NDAI0C02350na 2ON1581484209e-53
SAKL0B12606gsingletonON1551534209e-53
Smik_16.457na 2ON1591524164e-52
KNAG0B02050singletonON1531514016e-50
KNAG0B02060singletonON1541503512e-42
AAL102C8.697ON15986671.4
Ecym_61898.183ON48458681.5
NDAI0D036604.94ON30448671.7
TBLA0B044808.570ON60890672.3
Kwal_27.125343.331ON17464643.9
KLTH0E14806g3.331ON17495634.0
SAKL0H06006g8.697ON16946634.7
Skud_13.674.343ON1054104645.3
KLTH0D11748g8.697ON16270625.6
Kwal_26.88778.697ON16270617.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_5.1
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)       333   e-118
Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)    277   2e-96
YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino a...   276   4e-96
Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)    273   5e-95
Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {O...   183   1e-59
KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON}     183   2e-59
YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}  ...   177   4e-57
Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {O...   174   5e-56
NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON}             169   5e-54
NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON}     166   9e-53
SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} simil...   166   9e-53
Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {O...   164   4e-52
KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON}               159   6e-50
KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON}               139   2e-42
AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON} Sy...    30   1.4  
Ecym_6189 Chr6 complement(348408..349862) [1455 bp, 484 aa] {ON}...    31   1.5  
NDAI0D03660 Chr4 (869405..870319) [915 bp, 304 aa] {ON} Anc_4.94       30   1.7  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    30   2.3  
Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR05...    29   3.9  
KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} simil...    29   4.0  
SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {O...    29   4.7  
Skud_13.67 Chr13 complement(115055..118219) [3165 bp, 1054 aa] {...    29   5.3  
KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar...    28   5.6  
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    28   7.5  

>Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  333 bits (853), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60
           MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK
Sbjct: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60

Query: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120
           LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH
Sbjct: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH
Sbjct: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161

>Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  277 bits (708), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (88%)

Query: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60
           M+  ESEK+ NDRIVVRAIE  DEE WN+LWV+YQGFQKIVMP EV +T+FARFLDP VK
Sbjct: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60

Query: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120
           LWGALA DT TG AIG  HYLSH+T+W VEEV+Y+NDLYVTE ARIKGVGRKLIEFVYKH
Sbjct: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           ADELGTP+VYWVTDH+NHRAQLLYTKV YKT+KVVYKR G+
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161

>YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino acid
           N-acetyltransferase, catalyzes N-acetylation of D-amino
           acids through ordered bi-bi mechanism in which
           acetyl-CoA is first substrate bound and CoA is last
           product liberated; similar to Hpa2p, acetylates histones
           weakly in vitro
          Length = 179

 Score =  276 bits (707), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 144/161 (89%)

Query: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60
           M++ E EK+ NDRIVV+AIEP+DEE WN+LW EYQGFQK VMP EVA TTFARF+DP VK
Sbjct: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78

Query: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120
           LWGALAFDT TG AIGF HYL+H+T+W VEEVVYMNDLYVTE AR+KGVGRKLIEFVY  
Sbjct: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138

Query: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           ADELGTP+VYWVTDH+NHRAQLLYTKVAYKT+KV+YKR G+
Sbjct: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179

>Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  273 bits (698), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 145/161 (90%)

Query: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60
           M++ E EK+T+DRIVVRAIEP+DE+ W++LW EYQGFQK  MP EVA T FARFLDP VK
Sbjct: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60

Query: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120
           LWGALAFDT TG+AIGF HYLSH+T+W VEEV+YMNDLYVTE ARIKGVGRKLIEFVYK 
Sbjct: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120

Query: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           ADELGTP+VYWVTDH+NHRAQLLYTKVAYKT+KV+YKR G+
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161

>Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  183 bits (465), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 109/152 (71%)

Query: 10  TNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFDT 69
           T D ++VR +   D+E W  LW  +Q F  +  P+E+    F RFLDP VK+W A+A D+
Sbjct: 4   TGDSVIVRFVTEDDKEGWQGLWRSFQDFYSVSFPNELDEFNFKRFLDPNVKMWAAVAVDS 63

Query: 70  VTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSV 129
            +G  IG +++LSH+T W  ++ VY+NDLYV E++R+KGVGR+LI+FVY+ AD+L TP+V
Sbjct: 64  TSGKIIGMINFLSHMTTWDFKDKVYINDLYVDESSRVKGVGRELIQFVYEEADKLDTPNV 123

Query: 130 YWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           YW TD  NHRAQLLYTK+ YK  K +YKR G+
Sbjct: 124 YWCTDESNHRAQLLYTKIGYKAPKSLYKRNGY 155

>KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON} 
          Length = 162

 Score =  183 bits (465), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 108/156 (69%)

Query: 6   SEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGAL 65
           +E   N+ I VR ++  D+  W  LW  +  FQ+  +P E     F RF+DP+V +W AL
Sbjct: 7   TESTENNDITVRLVDKDDKNSWKELWTLFMEFQQTSLPEEQEELNFRRFIDPEVNMWSAL 66

Query: 66  AFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELG 125
           A D  +G AIG  ++ SH++ W + +++Y+NDLYV E  R +G+GRKLI+FVY+HAD++G
Sbjct: 67  AIDEASGRAIGMANFFSHMSTWDLTDIIYLNDLYVREDVRTRGIGRKLIDFVYEHADKMG 126

Query: 126 TPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           TP VYW TD  NHRAQLLYTKV  +T KVVYKR+G+
Sbjct: 127 TPKVYWWTDEHNHRAQLLYTKVGKRTPKVVYKRIGY 162

>YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}
           HPA2Tetrameric histone acetyltransferase with similarity
           to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates histones
           H3 and H4 in vitro and exhibits autoacetylation activity
          Length = 156

 Score =  177 bits (449), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%)

Query: 10  TNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFDT 69
           + D I VR +   D+E W RLW  YQ F ++  P ++    F RFLDP +K+W A+A ++
Sbjct: 5   SEDNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVES 64

Query: 70  VTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSV 129
            +   IG +++ +H+T W  ++ +Y+NDLYV E +R+KG G KLI+FVY  AD+LGTPSV
Sbjct: 65  SSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSV 124

Query: 130 YWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           YW TD  NHRAQLLY KV YK  K++YKR G+
Sbjct: 125 YWCTDESNHRAQLLYVKVGYKAPKILYKRKGY 156

>Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  174 bits (441), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 105/151 (69%)

Query: 11  NDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFDTV 70
           +D +VVR +   D++ W RLW  YQ F K+  P+E+    F RFLDP VK+W A+A +  
Sbjct: 5   DDSVVVRLVTEDDKDGWQRLWRSYQDFYKVSFPNELDDFNFERFLDPTVKMWAAVAVNGS 64

Query: 71  TGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVY 130
           +G  IG +++ SH++ W  ++ +Y+NDLYV   +R+KGVGRKLI+ VY+ AD+L TPSVY
Sbjct: 65  SGEVIGMINFFSHMSTWDFKDKIYINDLYVDGNSRVKGVGRKLIQLVYEEADKLETPSVY 124

Query: 131 WVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           W TD  N+ AQLLYTK+ YK  K +YKR G+
Sbjct: 125 WCTDESNYSAQLLYTKIGYKAHKTIYKRNGY 155

>NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON} 
          Length = 150

 Score =  169 bits (428), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 106/150 (70%)

Query: 9   ITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFD 68
           ++ ++I+VR +   DEEDW RLW  YQ   ++ +  EVA   F  FL+P V++W A+A +
Sbjct: 1   MSEEKIIVRPVSLNDEEDWKRLWKHYQEHYEVHLSEEVAERNFKNFLEPGVEMWAAIAIN 60

Query: 69  TVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPS 128
           T TG  IG V+YL H+T W +   + ++DL+V E +RIKGVGRKL+E+V+  AD++G   
Sbjct: 61  TETGVPIGMVNYLHHLTTWDIRGKMLLHDLFVEEGSRIKGVGRKLMEYVFHEADKMGIEI 120

Query: 129 VYWVTDHFNHRAQLLYTKVAYKTEKVVYKR 158
           VYW TDH+NHRAQLLYTK+ +K  KV+Y+R
Sbjct: 121 VYWTTDHYNHRAQLLYTKIGHKNSKVIYER 150

>NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON} 
          Length = 158

 Score =  166 bits (420), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 75/148 (50%), Positives = 100/148 (67%)

Query: 14  IVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFDTVTGS 73
           +V+R I+  D++DW  LW +YQ      M  ++   TF RFLDP+VK+W A A +T T  
Sbjct: 7   VVIRPIQETDKDDWLLLWKQYQKCYNRTMKEDIPLLTFERFLDPEVKMWAAFAINTTTNK 66

Query: 74  AIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVT 133
            IG V YL H T W ++  ++++DL+V E  R+KGVGRKL+EFVY  +D +  P VYW T
Sbjct: 67  PIGMVTYLHHFTTWNLDGKIFLHDLFVQEDQRVKGVGRKLMEFVYDASDRMDVPFVYWTT 126

Query: 134 DHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           D FNHRAQLLYTKV  KT KV+Y+R G+
Sbjct: 127 DDFNHRAQLLYTKVGKKTSKVLYERGGY 154

>SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} similar
           to uniprot|Q06592 Saccharomyces cerevisiae YPR193C HPA2
           Tetrameric histone acetyltransferase with similarity to
           Gcn5p, Hat1p, Elp3p, and Hpa3p
          Length = 155

 Score =  166 bits (420), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 100/153 (65%)

Query: 6   SEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGAL 65
           S     D ++VR +   DEE+W RLW  Y  F K  +P EVA   F RFL P+VK+W AL
Sbjct: 2   SANPCKDSVIVRLVGTEDEEEWKRLWKLYLVFYKSSLPEEVAELNFKRFLKPEVKMWSAL 61

Query: 66  AFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELG 125
           A DTVT   IG V+Y  H   W V++ + +NDLYV E  R+KGVGR+LI  VY HA++L 
Sbjct: 62  AIDTVTNKPIGMVNYFGHFHTWDVKDKILLNDLYVDENFRVKGVGRRLITHVYGHAEKLE 121

Query: 126 TPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKR 158
             +VYW TD FNHRAQLLYTK+  +T KV Y+R
Sbjct: 122 IWNVYWHTDFFNHRAQLLYTKIGERTTKVQYRR 154

>Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {ON}
           YPR193C (REAL)
          Length = 159

 Score =  164 bits (416), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 101/152 (66%)

Query: 10  TNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFDT 69
           + D I++R +   D+E W RLW  YQ F K+   +++    F RFLD  +K+W A+A + 
Sbjct: 8   SEDNIIIRFVTENDKEGWQRLWKSYQKFYKVSFSNDLDDFNFNRFLDSNIKMWTAVAVER 67

Query: 70  VTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSV 129
            +G  IG +++ SH+T W  ++ VY+NDLYV   +R K  G KLIEFVY   D+LGTPSV
Sbjct: 68  SSGKNIGMINFFSHVTTWDFKDKVYVNDLYVDVGSRAKVTGVKLIEFVYGEIDKLGTPSV 127

Query: 130 YWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
           YW TD  N+RAQLLYTK+ YK  K++YKR G+
Sbjct: 128 YWCTDESNYRAQLLYTKIGYKAPKIMYKRKGY 159

>KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON} 
          Length = 153

 Score =  159 bits (401), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (66%), Gaps = 1/151 (0%)

Query: 9   ITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGALAFD 68
           + +D I +R +   D+E+W RLW+ ++    I +P  +    F R +D  V +W A A D
Sbjct: 1   MASDSIAIRYVTDGDKEEWTRLWLGFRAHYDIPIPDGLGDANFKRIMDDSVDMWSAFAVD 60

Query: 69  TV-TGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTP 127
           T      IG V+++S  + W + ++VY++DLYV E  R++GVGRKLIEFVY  AD+ GTP
Sbjct: 61  TSRDDKPIGLVNWVSRPSTWDLTDIVYLHDLYVDENERVRGVGRKLIEFVYSEADKRGTP 120

Query: 128 SVYWVTDHFNHRAQLLYTKVAYKTEKVVYKR 158
            VYW TDH+NHRAQLLYTKVA KT KV+Y+R
Sbjct: 121 LVYWTTDHYNHRAQLLYTKVAKKTSKVIYER 151

>KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON} 
          Length = 154

 Score =  139 bits (351), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 94/150 (62%), Gaps = 2/150 (1%)

Query: 14  IVVRAIEPRDEEDWNRLWVEYQGFQKIV--MPSEVARTTFARFLDPQVKLWGALAFDTVT 71
           + VR ++P D E+  RL+  Y  F K +  +P+      F RFLDP+ ++W A+A DT T
Sbjct: 5   VEVRYVQPGDREELARLFTLYLNFYKSLDKVPATQFDLNFKRFLDPKERMWAAVAIDTST 64

Query: 72  GSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYW 131
           G  IG V +  H + W+ E  + +NDLYV E +R+ GVGR L+EFV+   D++G  +VYW
Sbjct: 65  GKHIGMVQWFHHTSTWEPEGCILLNDLYVDEDSRLGGVGRALMEFVFSEGDKIGVGNVYW 124

Query: 132 VTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161
            TD  NHRAQLLYTKV Y + +  Y R G+
Sbjct: 125 HTDTSNHRAQLLYTKVGYLSSQCRYVRNGY 154

>AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR253W
          Length = 159

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query: 45  EVARTTFARFLDPQVKLWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETA 104
           E  +  F+   D +  L+  LAF      A+G V   + I   +    V ++ L V E  
Sbjct: 34  EFGKELFSSKKDDKSTLYSQLAF--YGEVAVGAVK--ARIQDMRGHSAVVIDTLAVLEAY 89

Query: 105 RIKGVGRKLIEFVYKHADELGTPSVY 130
           R KGVG KL+++V K        ++Y
Sbjct: 90  RGKGVGTKLLDYVEKETKPFQPRAIY 115

>Ecym_6189 Chr6 complement(348408..349862) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AFR012C
          Length = 484

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 9   ITNDRIVVRAIEPRDEEDWNRLWVEYQG---FQKIVMPSEVARTTFARFLDPQVKLWG 63
           IT  + +  A+ P +E+DW + + +YQ    F+++     +    F  F++   +LWG
Sbjct: 119 ITEWKPITGAVPPMNEKDWEKEFAKYQASPEFKQLNSHITIEDFKFIYFMEWAHRLWG 176

>NDAI0D03660 Chr4 (869405..870319) [915 bp, 304 aa] {ON} Anc_4.94
          Length = 304

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 89  VEEVVYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVTDHF 136
           V++V +++  Y   + +I  +G  ++ F+Y+H  EL  P  Y    HF
Sbjct: 107 VKKVYFLSYKYFISSCKINELGGTILSFLYEHRYELDVPKEYIDVYHF 154

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 35/90 (38%), Gaps = 17/90 (18%)

Query: 7   EKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWG--- 63
           EK   DR  +R IE  ++  WN       G QK V   E  +  + +   P +K +G   
Sbjct: 342 EKFEGDREEIREIESLNDPRWN--LCSNLGIQKPVSDDEQFKQLYPKPPKPTLKQYGKLF 399

Query: 64  ------------ALAFDTVTGSAIGFVHYL 81
                       A  F +  G ++ F H+L
Sbjct: 400 IYPPITLVSTSIAFLFSSYYGFSVTFAHFL 429

>Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR051W
           (MAK3) - N-acetyltransferase [contig 260] FULL
          Length = 174

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 94  YMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEK 153
           Y+  L V +T R +G+ +KL+E   +    +G   V   T+  N  A  LY  + +   K
Sbjct: 77  YIGMLAVAQTYRRRGIAKKLVEVAIEKMQAIGCDEVMLETEVENKAALKLYEGMGFIRLK 136

Query: 154 VVYK 157
            +++
Sbjct: 137 RMFR 140

>KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} similar
           to uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 174

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 65  LAFDTVTGSAIGFV--HYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKHAD 122
           LAF   T + +G V   Y +H  A       Y+  L V +  R +G+ +KL+E   +   
Sbjct: 49  LAFSNDTENPVGCVVCKYETHRGARLRG---YIGMLAVDQKYRRRGIAKKLVEQAIQKMQ 105

Query: 123 ELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYK 157
           E+G   +   T+  N  A  LY  + +   K +++
Sbjct: 106 EIGCDEIMLETEVENTTALQLYEGMGFIRLKRMFR 140

>SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 169

 Score = 28.9 bits (63), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 11/46 (23%)

Query: 93  VYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNH 138
           VY+  L V    R KG+G KL+EF+ +              DHF H
Sbjct: 86  VYIEVLAVLSAYRDKGIGSKLLEFIEQQC-----------KDHFQH 120

>Skud_13.67 Chr13 complement(115055..118219) [3165 bp, 1054 aa] {ON}
           YLR450W (REAL)
          Length = 1054

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 18/104 (17%)

Query: 29  RLWVEYQGFQKIVMPSEVARTTFARFLDPQVKLWGAL---AFDTVTGSAIGF-------V 78
           ++W++ +  Q  +  +  A + FAR    Q  L G L    F T TG A+G         
Sbjct: 762 KIWIDSEEGQNTIKKAFNATSRFARLQHVQTCLAGDLLFIRFRTTTGDAMGMNMISKGVE 821

Query: 79  HYLSHIT---AWQVEEVVYMNDLYVTETAR-----IKGVGRKLI 114
           H L  +     W+  EVV ++  Y T+        I+G G+ ++
Sbjct: 822 HSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAVNWIEGRGKSVV 865

>KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 162

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 16/70 (22%)

Query: 93  VYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNHRAQLLYTKVAYKTE 152
           VY+    V E  R KGVG +L++FV +               HF H    +Y  VA   E
Sbjct: 79  VYIQIFAVLENYRGKGVGSQLLKFVEEQCKA-----------HFQHN---IYVHVAVDNE 124

Query: 153 KVV--YKRVG 160
           K +  Y+R G
Sbjct: 125 KGIQWYQRKG 134

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 28.1 bits (61), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 16/70 (22%)

Query: 93  VYMNDLYVTETARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNHRAQLLYTKVAYKTE 152
           VY+  L V E  R KG+G +L+ FV +   +           HF H    LY  VA   E
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQCKK-----------HFQHN---LYVHVATDNE 124

Query: 153 KVV--YKRVG 160
           K +  Y++ G
Sbjct: 125 KALSWYQKKG 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,997,748
Number of extensions: 655583
Number of successful extensions: 1629
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1627
Number of HSP's successfully gapped: 28
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)