Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.847.341ON81814031e-52
Skud_4.957.341ON79803128e-39
Smik_4.767.341ON80802953e-36
YDL160C-A (MHF2)7.341ON80802721e-32
ZYRO0F11528g7.341ON121821934e-20
KNAG0C038107.341ON82791532e-14
TDEL0C020607.341ON88841454e-13
NCAS0A140807.341ON78821411e-12
CAGL0I03432g7.341ON149821442e-12
Kpol_530.377.341ON88811383e-12
NDAI0A019507.341ON122901352e-11
TBLA0E004707.341ON1161021334e-11
Kwal_YGOB_Anc_7.3417.341ON86881307e-11
KLTH0H01452g7.341ON86831281e-10
SAKL0F10956g7.341ON86811272e-10
TPHA0F029107.341ON108991231e-09
Ecym_45207.341ON91851212e-09
KAFR0B009007.341ON78831183e-09
ACL158W7.341ON95841142e-08
KLLA0C16709g7.341ON79761053e-07
Kpol_1032.56.14ON68037612.6
KLTH0D07810g2.561ON49552585.0
TPHA0G029102.446ON68361585.4
NDAI0J024804.310ON223832578.2
KAFR0H020108.384ON86042578.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.84
         (81 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...   159   1e-52
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...   124   8e-39
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...   118   3e-36
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...   109   1e-32
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    79   4e-20
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    64   2e-14
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    60   4e-13
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               59   1e-12
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    60   2e-12
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    58   3e-12
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    57   2e-11
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    56   4e-11
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    55   7e-11
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    54   1e-10
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    54   2e-10
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    52   1e-09
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    51   2e-09
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    50   3e-09
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    49   2e-08
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    45   3e-07
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...    28   2.6  
KLTH0D07810g Chr4 (664551..666038) [1488 bp, 495 aa] {ON} simila...    27   5.0  
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    27   5.4  
NDAI0J02480 Chr10 complement(606429..613145) [6717 bp, 2238 aa] ...    27   8.2  
KAFR0H02010 Chr8 (371079..373661) [2583 bp, 860 aa] {ON} Anc_8.3...    27   8.6  

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score =  159 bits (403), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 81/81 (100%), Positives = 81/81 (100%)

Query: 1  MILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGD 60
          MILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGD
Sbjct: 1  MILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGD 60

Query: 61 GPLELSHLDLERIVGLLLMDM 81
          GPLELSHLDLERIVGLLLMDM
Sbjct: 61 GPLELSHLDLERIVGLLLMDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score =  124 bits (312), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)

Query: 2  ILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61
          +L K+A+IKILSQNN  K+IKIDDKV+PMIQ YL+IFIEEAALRSLQS KD+SG H  DG
Sbjct: 1  MLSKDALIKILSQNNFRKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGH-RDG 59

Query: 62 PLELSHLDLERIVGLLLMDM 81
          PLELSHLDLERIVGLLLMDM
Sbjct: 60 PLELSHLDLERIVGLLLMDM 79

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score =  118 bits (295), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 69/80 (86%)

Query: 2  ILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61
          +L KEA++KILSQNN  K+I+I D+VIPMIQKYL+IFIEEAALRSLQSHKD +  HD   
Sbjct: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60

Query: 62 PLELSHLDLERIVGLLLMDM 81
          PLELSH DLER+VG+LLMDM
Sbjct: 61 PLELSHQDLERVVGVLLMDM 80

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score =  109 bits (272), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%)

Query: 2  ILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61
          +L KEA+IKILSQN    ++KI D+V+PMIQKYL+IFI+EA LRSLQSHKD +G      
Sbjct: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60

Query: 62 PLELSHLDLERIVGLLLMDM 81
          PLELSH DLERIVGLLLMDM
Sbjct: 61 PLELSHQDLERIVGLLLMDM 80

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 79.0 bits (193), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 3/82 (3%)

Query: 2   ILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAH-DG 59
           ++PKE I++IL  Q    ++  I ++ + M+QKYLE+F+ EA  RS+ ++KDS G+H DG
Sbjct: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99

Query: 60  DGPLELSHLDLERIVGLLLMDM 81
           DG ++L+H DLE+I G+LL+DM
Sbjct: 100 DGEIQLNHEDLEKITGMLLLDM 121

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 63.5 bits (153), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 54/79 (68%), Gaps = 6/79 (7%)

Query: 3  LPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDGP 62
          + +E + +IL+Q+  +K+  IDD+ +  +QKY+E +++E  LRSL+ +KD      G  P
Sbjct: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDL-----GVNP 62

Query: 63 LELSHLDLERIVGLLLMDM 81
           EL+  D+ERI+GLLL+DM
Sbjct: 63 AELTERDIERILGLLLLDM 81

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 60.5 bits (145), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 5/84 (5%)

Query: 3  LPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHK----DSSGAH 57
          +PKE I +        +++  I D+ + M+QKY+E+F+ EA LRS  + +    + SGA 
Sbjct: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64

Query: 58 DGDGPLELSHLDLERIVGLLLMDM 81
               + L+H DLE I GLLL+DM
Sbjct: 65 RNSNEIVLTHEDLENITGLLLLDM 88

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 58.9 bits (141), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 5/82 (6%)

Query: 1  MILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDG 59
          M +PKE I +IL  +   + + K+ ++ + MIQ+Y+E+FI EA  RSL + +   G  D 
Sbjct: 1  MAIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD- 59

Query: 60 DGPLELSHLDLERIVGLLLMDM 81
             + +   DLER+VGLLL+DM
Sbjct: 60 ---IVIDEKDLERVVGLLLLDM 78

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 60.1 bits (144), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 1   MILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDG 59
           M +P++ I ++L      DK  +I+  V+  +Q+Y+++F  EA LRS++ H  S    + 
Sbjct: 68  MDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQ 127

Query: 60  DGPLELSHLDLERIVGLLLMDM 81
           +   E++H DLE I GLLL+DM
Sbjct: 128 EQDKEITHTDLENIAGLLLLDM 149

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 57.8 bits (138), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 3  LPKEAIIKILSQNNSD-KNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61
          +PKE I ++L  ++ +  + +I + V+  +QKY+E+F+ EA +RS+++       +   G
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFTG 66

Query: 62 -PLELSHLDLERIVGLLLMDM 81
            +EL+H DLE I GLLL+DM
Sbjct: 67 VRVELTHTDLEEIAGLLLLDM 87

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 56.6 bits (135), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 9/90 (10%)

Query: 1   MILPKEAIIKIL-SQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSS----- 54
           M +  E I KIL S++  +K+  I  + I MIQ+Y+++FI+EA +RS ++   +      
Sbjct: 33  MTILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFD 92

Query: 55  ---GAHDGDGPLELSHLDLERIVGLLLMDM 81
               A + D  +EL+HLDLERIVGLLLM++
Sbjct: 93  DEEDADEEDKTIELTHLDLERIVGLLLMEL 122

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 55.8 bits (133), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 24/102 (23%)

Query: 3   LPKEAIIKILSQNNS--DKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSH---------- 50
           LP+  I +IL Q +S  D+N +I    +  +QKY+E+FI EAALRSL++           
Sbjct: 16  LPENTIARIL-QTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSA 74

Query: 51  -KDSSGAHDGD----------GPLELSHLDLERIVGLLLMDM 81
            K+  G  D              +ELSH  LE I GLLL+DM
Sbjct: 75  VKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score = 54.7 bits (130), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 53/88 (60%), Gaps = 15/88 (17%)

Query: 3  LPKEAIIKILSQNNSDKN--IKIDDKVIPMIQKYLEIFIEEAALRSLQS-------HKDS 53
          +PK+ I +I  Q  S +N   +I +  + ++ +YLEIF+ EA LRS+++       H+D 
Sbjct: 5  VPKDTIARIF-QTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQ 63

Query: 54 SGAHDGDGPLELSHLDLERIVGLLLMDM 81
           G+      + L+H DLER+ GLLL+DM
Sbjct: 64 LGSQ-----VVLTHKDLERVSGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score = 53.9 bits (128), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 3  LPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHD--- 58
          +P + I +I    +  D + +I +  + ++  YLE+F+ EA LRS+++ +     H    
Sbjct: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64

Query: 59 GDGPLELSHLDLERIVGLLLMDM 81
          GD  + L+H DLER+ GLLL+DM
Sbjct: 65 GDQVV-LTHKDLERVSGLLLLDM 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 53.5 bits (127), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 3  LPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDG-D 60
          LPK+ I +I    + +  + +I +  + +  KY+E+F+ EA LRSL++ +      +  D
Sbjct: 6  LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 61 GPLELSHLDLERIVGLLLMDM 81
              LSH DLE I GLLL+DM
Sbjct: 66 NGTVLSHEDLEEISGLLLLDM 86

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 52.0 bits (123), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 21/99 (21%)

Query: 3   LPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSG------- 55
           +PK+ I +IL   +  +  +I  + + ++QKY+E+F+ EA LRS+++ +           
Sbjct: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69

Query: 56  -------------AHDGDGPLELSHLDLERIVGLLLMDM 81
                         H  +G +EL+H DLE I GLLL+DM
Sbjct: 70  APAKANPDQLQTFQHSFNG-IELTHEDLEEISGLLLLDM 107

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 51.2 bits (121), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 6/85 (7%)

Query: 2  ILPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGD 60
          ++P + I +I    + +  + +I +  I + +KY+++F+ EA LRSL+ +KD     DG 
Sbjct: 8  VVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLE-NKDKVKKEDGK 66

Query: 61 GPL----ELSHLDLERIVGLLLMDM 81
          G L     L H DLE I G+LL+D 
Sbjct: 67 GSLIEGPVLHHTDLEEISGILLLDF 91

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 50.1 bits (118), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 7/83 (8%)

Query: 1  MILPKEAIIKILSQ--NNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHD 58
          M +PKE I +IL    N + +N  I+ + +  + KY ++ IEE  LRSL++ ++ + A  
Sbjct: 1  MSIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENIAEATP 60

Query: 59 GDGPLELSHLDLERIVGLLLMDM 81
                L   DLE+I+GLLL+DM
Sbjct: 61 T-----LDVDDLEKIIGLLLLDM 78

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 48.5 bits (114), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 3  LPKEAIIKIL-SQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQS----HKDSSGAH 57
          +P + I ++  + + +  + KI +  + ++++Y+++FI EA LRSL++     +++    
Sbjct: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72

Query: 58 DGDGPLELSHLDLERIVGLLLMDM 81
            +GP+ L H DLE I G+L++D 
Sbjct: 73 FAEGPV-LQHTDLEEISGVLILDF 95

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 45.1 bits (105), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 7  AIIKIL-SQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDGPLEL 65
           I +IL ++   D N +I ++ + +++ Y+E+F+ E  LRSL++  D       D     
Sbjct: 9  TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENKADMLADKTVD----- 63

Query: 66 SHLDLERIVGLLLMDM 81
            +DLE + GLLLMD 
Sbjct: 64 -FVDLEAVAGLLLMDF 78

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score = 28.1 bits (61), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 2/37 (5%)

Query: 16  NSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKD 52
           +S +N K ++ VIP   KY+ +F ++ +++ +Q HKD
Sbjct: 220 HSMENTKYENLVIP--NKYIIVFKKDVSVKDMQIHKD 254

>KLTH0D07810g Chr4 (664551..666038) [1488 bp, 495 aa] {ON} similar
           to uniprot|Q04347 Saccharomyces cerevisiae YMR014W BUD22
           Protein involved in bud-site selection diploid mutants
           display a random budding pattern instead of the
           wild-type bipolar pattern
          Length = 495

 Score = 26.9 bits (58), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 1   MILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKD 52
           ++LP +   K+LSQ+ +DK IK   +++   +  +++F+     RSL S K+
Sbjct: 182 VVLPTKGCEKLLSQSTNDKKIK---ELLAGFENAMDLFMNLKRERSLGSKKE 230

>TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.446
           YMR104C
          Length = 683

 Score = 26.9 bits (58), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 6   EAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDGPLEL 65
           E + ++LS+ NS+++I ID   +P     L +FI  AA   L +H       DG G L L
Sbjct: 286 EKVSQLLSKINSNQDIHIDSFELP-----LSLFINSAANVRLYNHH-WVNLKDGFGKLNL 339

Query: 66  S 66
           S
Sbjct: 340 S 340

>NDAI0J02480 Chr10 complement(606429..613145) [6717 bp, 2238 aa]
           {ON} Anc_4.310
          Length = 2238

 Score = 26.6 bits (57), Expect = 8.2,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 6   EAIIKILSQNNS---DKNIKIDDKVIPMIQKY 34
           E+ ++++   +S   ++NIK+DD ++ MI KY
Sbjct: 831 ESCVRLIMSASSIAHERNIKVDDNLVEMIAKY 862

>KAFR0H02010 Chr8 (371079..373661) [2583 bp, 860 aa] {ON} Anc_8.384
           YLR166C
          Length = 860

 Score = 26.6 bits (57), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 27  VIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDGPLELSHL 68
           ++ +I  Y+E+ +E A  R+  +H  ++ A+D D  L LS L
Sbjct: 593 IMGIINNYIEVALEVAYYRAKSNHHSNTIANDND-VLSLSFL 633

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.138    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,931,000
Number of extensions: 330046
Number of successful extensions: 1386
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1371
Number of HSP's successfully gapped: 33
Length of query: 81
Length of database: 53,481,399
Length adjustment: 53
Effective length of query: 28
Effective length of database: 47,404,101
Effective search space: 1327314828
Effective search space used: 1327314828
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)