Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.837.342ON46246216800.0
Skud_4.947.342ON44746214950.0
Smik_4.757.342ON46046914080.0
YDL161W (ENT1)7.342ON45446513870.0
TDEL0C020507.342ON5012487371e-91
KNAG0C038007.342ON4472446956e-86
ZYRO0F11550g7.342ON5382456895e-84
SAKL0F10934g7.342ON4982516849e-84
Kpol_2001.707.342ON5332446861e-83
NCAS0H006707.342ON4832576742e-82
CAGL0A03872g7.342ON5102556711e-81
KAFR0L014607.342ON5502606653e-80
TPHA0D045607.342ON4872476578e-80
KAFR0B008907.342ON4142406342e-77
Skud_12.2707.342ON6262766284e-74
NDAI0D006107.342ON4862666123e-73
TBLA0E004807.342ON5992736185e-73
Suva_10.3007.342ON6181426162e-72
YLR206W (ENT2)7.342ON6132676125e-72
Kwal_56.246107.342ON5082626049e-72
Smik_12.2647.342ON6122656092e-71
KLTH0H01430g7.342ON5022605847e-69
KLLA0C16731g7.342ON4782485503e-64
Ecym_47317.342ON5142565141e-58
TBLA0E020407.342ON7012554899e-54
KNAG0B026507.342ON6462874833e-53
ACL157C7.342ON5152564599e-51
Kwal_47.168574.346ON3821422368e-21
NDAI0D032004.346ON4351422388e-21
KLTH0D16896g4.346ON4011422361e-20
TBLA0E047604.346ON4261392352e-20
TDEL0D007104.346ON3751422332e-20
Suva_12.2164.346ON4101422323e-20
KNAG0M003804.346ON4031362324e-20
Kpol_1001.24.346ON4181422324e-20
SAKL0G17952g4.346ON4151422315e-20
Skud_10.3494.346ON4101422299e-20
YJR125C (ENT3)4.346ON4081422271e-19
KAFR0B067404.346ON3991422272e-19
Smik_10.4184.346ON4091422272e-19
KLLA0B04587g4.346ON4001422262e-19
ZYRO0B14784g4.346ON4241422228e-19
NCAS0A062104.346ON4231422219e-19
AER155C4.346ON3641422154e-18
TPHA0B004004.346ON3991422075e-17
Ecym_11334.346ON3921422058e-17
CAGL0H04323g4.346ON4121421987e-16
Kwal_55.206114.17ON2541441812e-14
SAKL0H25762g4.17ON2621451716e-13
TDEL0G017404.17ON2571411541e-10
TBLA0B062204.346ON3391411532e-10
Kpol_388.54.17ON2681401513e-10
KLTH0E05874g4.17ON2551441432e-09
TPHA0F002304.17ON2801441381e-08
Ecym_84074.17ON2541331362e-08
ZYRO0G07876g4.17ON2591331344e-08
Suva_10.354.17ON2471331291e-07
TBLA0G006504.17ON4231451321e-07
ACL061C4.17ON2341351245e-07
KLLA0D03949g4.17ON2251201202e-06
NCAS0C058404.17ON2671471141e-05
Skud_12.304.17ON2471271113e-05
CAGL0E03806g4.17ON2601031024e-04
NDAI0H002804.17ON3101491025e-04
YLL038C (ENT4)4.17ON247103998e-04
Smik_12.194.17ON247103960.002
KAFR0I014604.17ON275152920.007
YHR161C (YAP1801)5.84ON63750910.016
KNAG0J028704.17ON329154890.023
SAKL0H02530g5.84ON66946860.069
Skud_8.2255.84ON62150840.10
Smik_8.2455.84ON62779820.20
KLLA0D16654g8.335ON399168800.31
NCAS0B036608.335ON416116750.99
KLLA0A05522g5.84ON56743751.1
CAGL0E01199g8.335ON41298732.2
KAFR0K015603.433ON101976723.2
KLTH0G11902g8.335ON399167713.4
Kpol_344.88.335ON384165704.9
Kwal_YGOB_27.112618.335ON404165695.5
ZYRO0F13684g8.335ON407101696.5
Skud_4.5275.626ON76477688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.83
         (462 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   651   0.0  
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   580   0.0  
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   546   0.0  
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   538   0.0  
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   288   1e-91
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   272   6e-86
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   270   5e-84
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   268   9e-84
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   268   1e-83
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    264   2e-82
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   263   1e-81
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   260   3e-80
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   257   8e-80
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   248   2e-77
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   246   4e-74
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   240   3e-73
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   242   5e-73
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   241   2e-72
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   240   5e-72
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   237   9e-72
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   239   2e-71
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   229   7e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   216   3e-64
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   202   1e-58
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   192   9e-54
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   190   3e-53
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   181   9e-51
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    96   8e-21
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    96   8e-21
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    96   1e-20
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    95   2e-20
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    94   2e-20
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    94   3e-20
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    94   4e-20
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    94   4e-20
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    94   5e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    93   9e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    92   1e-19
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    92   2e-19
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    92   2e-19
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    92   2e-19
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    90   8e-19
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    90   9e-19
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    87   4e-18
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    84   5e-17
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    84   8e-17
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    81   7e-16
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    74   2e-14
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    70   6e-13
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    64   1e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    64   2e-10
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    63   3e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    60   2e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    58   1e-08
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    57   2e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    56   4e-08
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    54   1e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   1e-07
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    52   5e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    51   2e-06
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    49   1e-05
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    47   3e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    44   4e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    44   5e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    43   8e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.002
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    40   0.007
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    40   0.016
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    39   0.023
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    38   0.069
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    37   0.10 
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    36   0.20 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    35   0.31 
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    33   0.99 
KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} simila...    33   1.1  
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    33   2.2  
KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON} Anc_3...    32   3.2  
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    32   3.4  
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    32   4.9  
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    31   5.5  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    31   6.5  
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    31   8.3  

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/462 (72%), Positives = 335/462 (72%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           IVRVKAKELTSLLSDEERLNEE                    SSEDDDDLQRAIDASRMT
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPITP 240
           A              TALQLSKEEEELKRL                 PMYCDIFGNPITP
Sbjct: 181 ADEDERRRKQDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNPITP 240

Query: 241 EEYAXXXXXXXXXXXXXXXXXXXXXXPMYYDMFGNPISPEXXXXXXXXXXXXXXXXXXXX 300
           EEYA                      PMYYDMFGNPISPE                    
Sbjct: 241 EEYAQFQLEQQQQQLLQLQQQQQQQQPMYYDMFGNPISPEELAQFQQEQQQQLYLSSLQQ 300

Query: 301 XXXTSNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMT 360
              TSNNPFAKPNQEASPQRQDQPSMNTSSMP              EPLTQTRTGNQSMT
Sbjct: 301 QQATSNNPFAKPNQEASPQRQDQPSMNTSSMPQQQQQQQQQQQQQQEPLTQTRTGNQSMT 360

Query: 361 DKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNS 420
           DKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNS
Sbjct: 361 DKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNS 420

Query: 421 QYTGLPSTNVVPAQTGYGFXXXXXXXXXXXXXXXXXYALIDL 462
           QYTGLPSTNVVPAQTGYGF                 YALIDL
Sbjct: 421 QYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNSQGYALIDL 462

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/462 (66%), Positives = 317/462 (68%), Gaps = 15/462 (3%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKNLVKGYSSTQVLVRNATSNDN+QVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH+DDEG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           IVRVKAKELT+LLSD+ERLNEE                    + EDDDDLQRAIDASRMT
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPITP 240
           A              TALQLSKEEEELKRL                 PMY DIFGNPITP
Sbjct: 181 AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNPITP 240

Query: 241 EEYAXXXXXXXXXXXXXXXXXXXXXXPMYYDMFGNPISPEXXXXXXXXXXXXXXXXXXXX 300
           EEYA                       MYYD+FGNPISPE                    
Sbjct: 241 EEYA---QFQLQQQQQQLQQQQQQQEAMYYDVFGNPISPE---ELAHFQQQQYIASLQQQ 294

Query: 301 XXXTSNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMT 360
               SNNPFAKPNQE + Q+QDQ  M +SSM               +PLTQTRTGNQSMT
Sbjct: 295 QQVPSNNPFAKPNQEVTSQKQDQSFMASSSM---------QQQQQQQPLTQTRTGNQSMT 345

Query: 361 DKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNS 420
           DKY KLNELL TGTGIDTFGN GD+RVPAQHTKTGTFINSQGTGYRQVSNDPK NPFLNS
Sbjct: 346 DKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDPKQNPFLNS 405

Query: 421 QYTGLPSTNVVPAQTGYGFXXXXXXXXXXXXXXXXXYALIDL 462
           QYTGLPSTN+VP QTGYGF                 Y LIDL
Sbjct: 406 QYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNSQGYTLIDL 447

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/469 (62%), Positives = 313/469 (66%), Gaps = 16/469 (3%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKNLVKGYSSTQVLVRNATSNDN+QVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH+DDEG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSED-DDDLQRAIDASRM 179
           IVRVK+KELT+LLSD+ERLNEE                    SS D D+DLQRA+DASRM
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 180 TAXXXXXXXXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPIT 239
           TA              TALQLSKEEEELKRL                 PMY DIFGNPIT
Sbjct: 181 TAEEDEKRRKMDEDYETALQLSKEEEELKRL-QDLQRMQQLQTQQQQQPMYYDIFGNPIT 239

Query: 240 PEEYAXXXXXXXXXXXXXXXXXXXXXXPMYYDMFGNPISPEXXXXXXXXXXXXXX----- 294
           PEEYA                      P+YYD+FGNPI+PE                   
Sbjct: 240 PEEYA---QFQLQQQQQLQQQQLQQQQPLYYDVFGNPITPEELAQFQQQQQQQQQQQQQY 296

Query: 295 -XXXXXXXXXTSNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTR 353
                       NNPF+K  Q++  + Q Q S   SSM               EPLTQTR
Sbjct: 297 LASVQQQQQGIPNNPFSKSEQKSGIEEQGQSSTVDSSM-----QQQQQQQKQQEPLTQTR 351

Query: 354 TGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPK 413
           TGNQSMTDKY+KLNELL TGTGIDTFGN GD RVPAQHTKTGTFINSQGTGY+QVSNDPK
Sbjct: 352 TGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPK 411

Query: 414 HNPFLNSQYTGLPSTNVVPAQTGYGFXXXXXXXXXXXXXXXXXYALIDL 462
           +NPFL+ QYTGLPSTNVVP QTGYGF                 YALIDL
Sbjct: 412 YNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNNQGYALIDL 460

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 310/465 (66%), Gaps = 14/465 (3%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKNLVKGYSSTQVLVRNATSNDN+QVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRHIAKALTV+DYLIRFGSENCVLWC+ENLYIIKTLKEFRH+DDEG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           IVRVKAKELT+LLSD+ERLNEE                    S E+DDDLQRAI ASR+T
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 181 AXXXXXXXXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPITP 240
           A              TALQLSKEEEELKRL                 PMY DIFGNPITP
Sbjct: 181 AEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNPITP 240

Query: 241 EEYAXXXXXXXXXXXXXXXXXXXXXXPMYYDMFGNPISP---EXXXXXXXXXXXXXXXXX 297
           EEYA                      PMYYD+FGNPI+P                     
Sbjct: 241 EEYA----QFQLQQQQQQQQQQLQQQPMYYDVFGNPITPEELAQFQQQQQLQEQQYLASM 296

Query: 298 XXXXXXTSNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQ 357
                  SNNPFAK  Q +S  +++Q  +  +S P              EPL Q RTGNQ
Sbjct: 297 QQQQQAMSNNPFAKSEQSSSSPKRNQ--LVAASSP-----QQLQQQKQQEPLIQNRTGNQ 349

Query: 358 SMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPF 417
           SMTDKYSKLNELL TGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGYRQVS+DP HNPF
Sbjct: 350 SMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPF 409

Query: 418 LNSQYTGLPSTNVVPAQTGYGFXXXXXXXXXXXXXXXXXYALIDL 462
           LNSQYTGLPST+VVP QTGYGF                 Y LIDL
Sbjct: 410 LNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL 454

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  288 bits (737), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 152/248 (61%), Positives = 171/248 (68%), Gaps = 7/248 (2%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRHIAK+LTVLDYL+RFGSENCVLWC+ENLY+IKTL EFR+DDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSED-DDDLQRAIDASRM 179
           I+RVKAKELT+LLSD+ERL EE                      +  DDDLQRA+D SR+
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 180 TAXXXXXXXXXXXXX----XTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFG 235
           TA                   ALQLSKEEEELKRL                   Y DIFG
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS--QYYDIFG 238

Query: 236 NPITPEEY 243
           NPI+PEEY
Sbjct: 239 NPISPEEY 246

 Score =  153 bits (387), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (88%)

Query: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411
            RTG+ +MT+KY +LN+LL TGTGIDTFGN GD R+PAQHTKTGTFINSQGTGYRQV+ +
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           PK NPFL SQYTG+PS+N+VPA TGYGF
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGF 476

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  272 bits (695), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 169/244 (69%), Gaps = 5/244 (2%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
           ++RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRV 124
           DKGKYWRH+AKALTVLDYL+RFGSENCV+WC+ENLYIIKTL+EF H+D  G D+G+I+RV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTSLLSDEERLNEEXXXXXXXXXX-XXXXXXXXXXSSEDDDDLQRAIDASRMTAXX 183
           KAKELTSLL DEERL EE                     ++  D+DLQRAI+ S+ TA  
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 184 XXXX----XXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPIT 239
                            ALQLS+EEE+L+RL                 PMY D+FGNPIT
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPMYYDVFGNPIT 240

Query: 240 PEEY 243
           PEEY
Sbjct: 241 PEEY 244

 Score =  171 bits (432), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 110/197 (55%), Gaps = 24/197 (12%)

Query: 267 PMYYDMFGNPISPEX----------------XXXXXXXXXXXXXXXXXXXXXXTSNNPFA 310
           PMYYD+FGNPI+PE                                           P  
Sbjct: 229 PMYYDVFGNPITPEEYLQFQQQQALLAQQQQQQAALEQQYWAQQQQNMLAQQQQQQQPLY 288

Query: 311 KPNQEASPQRQDQP-SMNTSSMPXXXXXXXXXXXXXXE-------PLTQTRTGNQSMTDK 362
              Q+  P   + P ++N ++ P              E       PLTQTR+GNQ+++DK
Sbjct: 289 GIQQQTLPTGSNNPFALNNATQPSAPASTTAARPAAIETPATQTKPLTQTRSGNQAISDK 348

Query: 363 YSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNSQY 422
           YS LN LL +GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYRQV+ND K NPFLN QY
Sbjct: 349 YSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQY 408

Query: 423 TGLPSTNVVPAQTGYGF 439
           TGLPSTN+VP QTG+GF
Sbjct: 409 TGLPSTNIVPTQTGFGF 425

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  270 bits (689), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 162/245 (66%), Gaps = 5/245 (2%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  Q VRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+ENLYIIKTL+EFRHDDD   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           I+RVKAKELT+LL D+ERL  E                     +  D ++QRA+DASR+T
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 181 AXXXXXXXXXXXXX----XTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPM-YCDIFG 235
           A                  TALQLSKEEEELKRL                 P  Y DIFG
Sbjct: 181 AEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIFG 240

Query: 236 NPITP 240
           NPI+P
Sbjct: 241 NPISP 245

 Score =  147 bits (371), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 68/120 (56%), Positives = 87/120 (72%), Gaps = 14/120 (11%)

Query: 320 RQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTF 379
           R  QP  NT+  P              +P+   RTGNQS++DKY+ LN+LL   TG+DTF
Sbjct: 405 RPQQPQHNTAPEP--------------QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTF 450

Query: 380 GNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           GN GD R+PAQHTKTGTFINSQGTG++Q SN+PK NPFL +Q+TG+P+++VVP+ TGYGF
Sbjct: 451 GNVGDARIPAQHTKTGTFINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGF 510

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  268 bits (684), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 168/251 (66%), Gaps = 9/251 (3%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK L+R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R+GSENCVLW +ENLYIIKTL+EF H+D+ G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           I+RVKAKELTSLL DEERL EE                      E DDDLQRA++ SR+T
Sbjct: 121 IIRVKAKELTSLLRDEERLTEE-RNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRLT 179

Query: 181 AXXXXXXXXXXXXX------XTALQLSKEEEELKRLXX--XXXXXXXXXXXXXXXPMYCD 232
           A                    TALQLSKEEEEL+RL                   PMY D
Sbjct: 180 AEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYYD 239

Query: 233 IFGNPITPEEY 243
           +FGNPITPEEY
Sbjct: 240 VFGNPITPEEY 250

 Score =  148 bits (374), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 96/136 (70%), Gaps = 3/136 (2%)

Query: 305 SNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMTDKYS 364
           SNNPFA   QE   + Q  P + + S+               + L  TRTGNQS++ KY+
Sbjct: 329 SNNPFALGRQEPD-EEQITPKV-SESVATTAGTTTATTTTQQQALNPTRTGNQSISQKYN 386

Query: 365 KLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND-PKHNPFLNSQYT 423
            LN LL +GTG+DTFGN G TR+PAQHT+TG FINSQGTGY+QV+ND PK+NPFL +QYT
Sbjct: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446

Query: 424 GLPSTNVVPAQTGYGF 439
           GLPST+VVP+ TGYGF
Sbjct: 447 GLPSTSVVPSYTGYGF 462

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  268 bits (686), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 146/244 (59%), Positives = 164/244 (67%), Gaps = 8/244 (3%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQ VRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           I+RVKAKELTSLL+DEERL +E                       DDD+LQRAI+ S+ T
Sbjct: 121 IIRVKAKELTSLLNDEERLRDE---RGMNRRGGRRERARPRRRPSDDDELQRAIEESKRT 177

Query: 181 AXXXXXXXXXXXXX----XTALQLSKEEEELK-RLXXXXXXXXXXXXXXXXXPMYCDIFG 235
           A                  TALQLSKEEEELK                    PMY DIFG
Sbjct: 178 AEDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFG 237

Query: 236 NPIT 239
           NPI+
Sbjct: 238 NPIS 241

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/88 (80%), Positives = 82/88 (93%)

Query: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411
           TRTGNQ +TDK+ +LN+LL +GTGIDTFGN G+ R+PAQHTKTGTFINSQGTGYRQV+ND
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           PK+NPFLNSQYTGLPSTN+VP+ TGYGF
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGF 470

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 267 PMYYDMFGNPIS 278
           PMYYD+FGNPIS
Sbjct: 230 PMYYDIFGNPIS 241

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  264 bits (674), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 174/257 (67%), Gaps = 15/257 (5%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN+VKGYS+TQVLVR+ATSND +  S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRH+DD G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXX-------XXXXXXXXXXXSSEDDDDLQRA 173
           I+RVKAKELTSLL DEERL EE                           + ED D+LQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 174 IDASRMTAXXXXXXXXXXXX-------XXTALQLSKEEEELKRLXXXXXXXXXXXXXXXX 226
           ++ SR+TA                     TALQLSKEEEELK+L                
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 227 XPMYCDIFGNPITPEEY 243
              Y DIFGNPI+P+EY
Sbjct: 241 QG-YFDIFGNPISPDEY 256

 Score =  164 bits (415), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 95/135 (70%), Gaps = 2/135 (1%)

Query: 305 SNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMTDKYS 364
           SNNPFA  N    P  +   +   S+                    QTRTGNQS+TDKYS
Sbjct: 324 SNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPL--KQTRTGNQSITDKYS 381

Query: 365 KLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNSQYTG 424
           +LN LL TGTGIDTFGN G+ R+PAQHT+TGTFINSQGTGYRQV+NDPK+NPFLNSQYTG
Sbjct: 382 QLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTNDPKNNPFLNSQYTG 441

Query: 425 LPSTNVVPAQTGYGF 439
           LPSTN+V  QTGYGF
Sbjct: 442 LPSTNIVSTQTGYGF 456

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  263 bits (671), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 170/255 (66%), Gaps = 16/255 (6%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  QLVRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDD-EGTDQG 119
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRH+D+  G+D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSED-------DDDLQR 172
           QI+RVKAKELTSLL+D+ERL EE                     S         DDDLQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 173 AIDASRMTAXXXXXXXXXXXXXX-------TALQLSKEEEELKRLXXXXXXXXXXXXXXX 225
           A++ SRMTA                      ALQLSKEEEELK+L               
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 226 XXPMYCDIFGNPITP 240
              +Y DIFGNPI+P
Sbjct: 241 QN-VYYDIFGNPISP 254

 Score =  160 bits (404), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 84/89 (94%)

Query: 351 QTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSN 410
           +TRTGNQS++DKYS+LN LL +GTGIDTFGN G+ R+PAQHTKTGTFINSQGTGY+QV+N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 411 DPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           +PK+NPFL+SQYTGLPSTN+VP+ TGYGF
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGF 448

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  260 bits (665), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/260 (56%), Positives = 170/260 (65%), Gaps = 17/260 (6%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN++KGYSSTQVLVR+ATSNDN   + D+L ++A +SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYW+HI K+LTVLDYL+RFGSENCVLWCKENLY+IKTL+EFR++DD G DQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSE-------DDDDLQRA 173
           I+RVKAKELTSLL DEERL EE                    +S        DDDDLQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 174 IDASRMTAXXXXXXXXXXXXX-------XTALQLSKEEEELKR---LXXXXXXXXXXXXX 223
           I+ S+ TA                      ALQLSKEEEELK    L             
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 224 XXXXPMYCDIFGNPITPEEY 243
                +Y D+FGNPI+ +EY
Sbjct: 241 QTSANVYYDVFGNPISYDEY 260

 Score =  144 bits (363), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 64/88 (72%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND- 411
           RTGN+ +T+KYS+LN LL  GTG+DTFGN G  R+PAQHTKTGTFINSQGTGY+QV+N+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
            K+NPFLN+QYTGLPS+N+VP+ TGYGF
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGF 476

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  257 bits (657), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 145/247 (58%), Positives = 168/247 (68%), Gaps = 12/247 (4%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS Q VRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDE--GTDQ 118
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLY+IKTL EFR++D+   G DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASR 178
           GQI+RVKAKELT+LL D+ERL EE                    S   D+DLQRA++ SR
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGS---DEDLQRALEESR 177

Query: 179 MTAXXXXXXXXXX---XXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFG 235
            TA                  ALQLSKEEEELKRL                 P+Y D+FG
Sbjct: 178 RTAEEDERKRRLNQDDSDLQAALQLSKEEEELKRL----QELQSSMHMQQQQPVYYDVFG 233

Query: 236 NPITPEE 242
           NPI+ EE
Sbjct: 234 NPISYEE 240

 Score =  147 bits (370), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 64/87 (73%), Positives = 79/87 (90%)

Query: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDP 412
           RTGN+ MT+KY++LN+LL +GTGIDTFGN G+TR+PAQHT+TGTFINSQGTGYRQ S + 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 413 KHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           K NPFL++QYTGLPS+N++P QTGYGF
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGF 461

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  248 bits (634), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/240 (54%), Positives = 161/240 (67%), Gaps = 9/240 (3%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
           ++RSAKNLVKGYSSTQ LVR+ATSN ++    D L ELAE +Y++ +FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRV 124
            KGKYW+H+ K+L VLDYL+RFGSENCV+WCKENLYIIKTL+EF ++D+ G DQGQ+VRV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRA-IDASRMTAXX 183
           +AKELTSLL DEERL EE                    +S+DDDDL+RA  ++ R     
Sbjct: 121 RAKELTSLLMDEERLREE---RALNRRGGGNRRRAKSRNSDDDDDLERAKEESRRTAREE 177

Query: 184 XXXXXXXXXXXXTALQLSKEEEELKRLXXXXXXXXXXXXXXXXXPMYCDIFGNPITPEEY 243
                        ALQL++EE+EL+                   PMY DIFGNPITPEEY
Sbjct: 178 EELRRRQEAERQFALQLNQEEQELR-----ALQQLQQQQQQQQQPMYYDIFGNPITPEEY 232

 Score =  166 bits (419), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 113/198 (57%), Gaps = 38/198 (19%)

Query: 267 PMYYDMFGNPISPEXXXXXXXXXXXXXXXXXXXXXXXT---------------------- 304
           PMYYD+FGNPI+PE                                              
Sbjct: 217 PMYYDIFGNPITPEEYLQFQQRQAALAQQQALLAQQEQQYWAQQQAAFLSQQQQQQQQPL 276

Query: 305 ---SNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQTRTGNQSMTD 361
              SNNPFA  N++   Q   +PS+  +++                PL QTRTG+QS++D
Sbjct: 277 ATGSNNPFALNNKKLQ-QHTPEPSVIDTTL------------NTQAPLKQTRTGSQSISD 323

Query: 362 KYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPKHNPFLNSQ 421
           KYS LN LL TGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGY+QVS +  +N FLNSQ
Sbjct: 324 KYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGFNNVFLNSQ 383

Query: 422 YTGLPSTNVVPAQTGYGF 439
           YTGLPS+N+VP+QTGYGF
Sbjct: 384 YTGLPSSNIVPSQTGYGF 401

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  246 bits (628), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 167/276 (60%), Gaps = 35/276 (12%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQ VRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXX----------XXXXXXXXXXXXSSEDDDDL 170
           I+RVKAKEL SLL+D+ERL EE                              S    D+L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 171 QRAIDASRMTAXXXXXXXXXXXXX-------XTALQLS----------------KEEEEL 207
           ++ ++ SR+TA                      ALQLS                K+++ L
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 208 KRLXXXXXXXXXXXXXXXXXPMYCDIFGNPITPEEY 243
            ++                 P Y DIFGNPI+ +EY
Sbjct: 241 SQMPVPVQQQQQQQQQQL--PAYYDIFGNPISQDEY 274

 Score =  160 bits (405), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 85/92 (92%)

Query: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407
           PL QTRTGNQS++DKY+ LN LL TGTG+DTFGN G+ R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           V+++PK+NPFL++QYTGLPSTN+VP QTGYGF
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 541

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  240 bits (612), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/266 (52%), Positives = 172/266 (64%), Gaps = 24/266 (9%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN++KGYS+TQVLVR+ATSND++  S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCK+NLYIIKTLKEF+ +DD   D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IVRVKAKELTSLLSDEERLNEEXX------XXXXXXXXXXXXXXXXXXSSEDDDDLQRAI 174
           I+RVKAKELT+LL D+ERL EE                           ++ D+DLQ+A+
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 175 DASRMTAXXXXXXXXXXXXX-------XTALQLSKEEEELKRLXXXXXXXXXXXXXXXXX 227
           + SR+TA                     TALQLSKEEEELK+L                 
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 228 P----------MYCDIFGNPITPEEY 243
                      +Y DIFGNPI+PEEY
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISPEEY 265

 Score =  153 bits (387), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411
           TRTGNQS++DKY++LN LL +GTGIDTFGN GD R+PAQHT+TGTFINSQGTGY+Q+ ND
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 412 P-KHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           P K NPFLN+QYTGLPS+N+VP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  242 bits (618), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 170/273 (62%), Gaps = 30/273 (10%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ +RS KN+VKGYSSTQ+LVR+AT+ND N  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD----DEGT 116
           KRLNDKGKYW+H+AK+LTVLDYLIRFGSENCV WCKENLY+IKTLKEFR DD    + G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXX----XXXXXXXXSSED------ 166
           DQGQIVRV+A ELTSLL D+ERL EE                        S  D      
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 167 ----DDDLQRAIDASRMTAXXXXXXXXXXXXXX-----TALQLSKEEEELKRLXXXXXXX 217
               DDDLQ+AI+ S+ TA                   TALQLSKEEEELK+L       
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 218 XXXXXXXXXXP-------MYCDIFGNPITPEEY 243
                     P       +Y DIFGNPI+ EE+
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  156 bits (394), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/153 (53%), Positives = 101/153 (66%), Gaps = 19/153 (12%)

Query: 305 SNNPFAKPNQEASPQRQDQPSMNTSS--------------MPXXXXXXXXXXXXXX---- 346
           +NNPF+  N   +PQ+Q  P M++SS              +P                  
Sbjct: 406 TNNPFSLSNIN-NPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNASSLPP 464

Query: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406
           +P+ Q RTGNQ ++DKY+ LN LL TGTGIDTFGN GD R+PAQHT TGTFINSQGTGY+
Sbjct: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524

Query: 407 QVSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           Q  NDPK+NPF+++QYTGLPSTNVVP+ TGYGF
Sbjct: 525 QYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGF 557

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  241 bits (616), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 109/142 (76%), Positives = 129/142 (90%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
           I+RVKAKEL SLL+D+ERL EE
Sbjct: 121 IIRVKAKELVSLLNDDERLREE 142

 Score =  164 bits (415), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%)

Query: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407
           PLTQTRTGNQS++DKY+ LN LL TGTG DTFGN G++R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           V N+PK+NPFLNSQYTGLPST++VP QTGYGF
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGF 524

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  240 bits (612), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 164/267 (61%), Gaps = 28/267 (10%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXX----------XSSEDDDDL 170
           I+RVKAKEL SLL+DEERL EE                              S    DDL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 171 QRAIDASRMTAXXXXXXXXXXXXX-------XTALQLSKE-----------EEELKRLXX 212
           ++A++ SR+TA                      ALQLSKE             + ++   
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 213 XXXXXXXXXXXXXXXPMYCDIFGNPIT 239
                          P Y DIFGNPI+
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  165 bits (418), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%)

Query: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407
           PL QTRTGNQS++DKYS LN LL TGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           V+N+PK+NPFL++QYTGLPSTN+VP QTGYGF
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 515

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  237 bits (604), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 165/262 (62%), Gaps = 24/262 (9%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK L+R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLY+IKTL+EF H+D+ G DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           IVRVKA+ELT+LL D+ERL EE                    +  +D+DLQRA++ SR+T
Sbjct: 121 IVRVKARELTALLLDDERLREE-----RSLRTKNRKPRRRPTAGSEDEDLQRAMEESRLT 175

Query: 181 AXXXXXXXXXXXXX--------XTALQLSKEEEELKRLXXXXXXXX-----------XXX 221
           A                      TALQLSKEEEEL+RL                      
Sbjct: 176 AEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQ 235

Query: 222 XXXXXXPMYCDIFGNPITPEEY 243
                 PMY D+FGNPI+ EEY
Sbjct: 236 QTQAQQPMYYDVFGNPISAEEY 257

 Score =  154 bits (390), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (89%)

Query: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411
           TRTGNQS+T+K+S+LN LL +GTG+DTFGN G TR+PAQHTKTG FINSQGTGY+QVS+ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           PKHNPFL  QYTGLPSTNVVP+ TGYGF
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGF 482

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 13/14 (92%)

Query: 267 PMYYDMFGNPISPE 280
           PMYYD+FGNPIS E
Sbjct: 242 PMYYDVFGNPISAE 255

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  239 bits (609), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/265 (50%), Positives = 165/265 (62%), Gaps = 26/265 (9%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXX----------XXXXXXXXXXXSSEDDDDL 170
           I+RVKAKEL SLL+D+ERL EE                              S    +DL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 171 QRAIDASRMTAXXXXXXXXXXXXX-------XTALQLSKEEE---------ELKRLXXXX 214
           ++A++ SR+TA                      ALQLSKEEE          L+      
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 215 XXXXXXXXXXXXXPMYCDIFGNPIT 239
                        P Y DIFGNPI+
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  161 bits (407), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%)

Query: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407
           PL QTRTGNQS++DKY+ LN LL TGTG DTFGN G+ R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           V N+PK+NPFL++QYTGLPSTN+VP QTGYGF
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 516

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  229 bits (584), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 162/260 (62%), Gaps = 22/260 (8%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK L+R AKN+V GYS+TQVL+R ATSND +  S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLYIIKTL+EF H+D+ G DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRMT 180
           IVRVKA+ELT+LL DEERL EE                    S   DDD+QRA++ SRMT
Sbjct: 121 IVRVKARELTALLQDEERLREE-----RELKGRNRRPRRRKNSDSYDDDMQRALEESRMT 175

Query: 181 AXXXXXXXXXXXXX--------XTALQLSK---------EEEELKRLXXXXXXXXXXXXX 223
           A                      TALQLSK         E +  +++             
Sbjct: 176 AEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQ 235

Query: 224 XXXXPMYCDIFGNPITPEEY 243
               PMY D+FGNPI+ EEY
Sbjct: 236 QTQQPMYYDVFGNPISAEEY 255

 Score =  152 bits (384), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 96/149 (64%), Gaps = 16/149 (10%)

Query: 305 SNNPFAKPNQEASPQRQDQPSMNTSSMPXXXXXXXXXXXXXXEPLTQ------------T 352
           SNNPFAK  Q+  P  +D      +S P              E   Q            T
Sbjct: 330 SNNPFAKNAQQ--PSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQT 387

Query: 353 RTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDP 412
           RTGNQS+TDK+S LN LL +GTG+DTFGN G TR+PAQHTKTGTFINSQGTGY+QVSN P
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 413 --KHNPFLNSQYTGLPSTNVVPAQTGYGF 439
             KHNPFL  QYTGLPST+VVP+ TGYGF
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGF 476

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 13/14 (92%)

Query: 267 PMYYDMFGNPISPE 280
           PMYYD+FGNPIS E
Sbjct: 240 PMYYDVFGNPISAE 253

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  216 bits (550), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 151/248 (60%), Gaps = 11/248 (4%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +RSAKNLV GYS  QVLVR+ATSND +  S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDD-EGTDQG 119
           KRLNDKG+ WRH+AK+LT LD+L+R GSENCV WCKENLYIIKTL+EF H D+    D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRM 179
           +IVRVKAKELT+LL DEERL EE                      +  DDLQRA++ SR+
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDD--DDLQRALEESRI 178

Query: 180 TAXXXXXXXXXXXXXX--TALQLSKEEEELKRLXXX------XXXXXXXXXXXXXXPMYC 231
           TA                ++LQ + E  + +                         PMY 
Sbjct: 179 TAEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYY 238

Query: 232 DIFGNPIT 239
           DIFGNPI+
Sbjct: 239 DIFGNPIS 246

 Score =  153 bits (387), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406
           +P+ + RTGNQS++DK+S+LN LL +GTGIDTFGN G+TRVPAQHTKTGTFINSQGTGY+
Sbjct: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 407 QVSND-PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           Q++ND PKHNPFL SQYTG+PS+ + P+ TGYGF
Sbjct: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGF 447

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 267 PMYYDMFGNPIS 278
           PMYYD+FGNPIS
Sbjct: 235 PMYYDIFGNPIS 246

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  202 bits (514), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 148/256 (57%), Gaps = 18/256 (7%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQL+RSAKN++ GYS  QVLVRNATSND    S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W +EN++II+ L EF H D+  GTD G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSEDDDDLQRAIDASRM 179
           Q++RVKAKEL +LL D+ERL EE                        D DL+RA++ SR+
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGV-DPDLKRALEESRI 179

Query: 180 TAXXXXXXXXXXXXX------XTALQLS----------KEEEELKRLXXXXXXXXXXXXX 223
           TA                     ALQLS          + +++ ++              
Sbjct: 180 TAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQVQ 239

Query: 224 XXXXPMYCDIFGNPIT 239
               PMY DIFGNPIT
Sbjct: 240 YQQQPMYYDIFGNPIT 255

 Score =  148 bits (373), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 70/112 (62%), Positives = 82/112 (73%), Gaps = 1/112 (0%)

Query: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411
           TRTGNQS++DKY +LN LL TGTGIDTFGN G  R+ +QHTKT TFINS GTG++QVSN+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 412 -PKHNPFLNSQYTGLPSTNVVPAQTGYGFXXXXXXXXXXXXXXXXXYALIDL 462
            PKHNPFL +QYTGLPSTN+VP+ TGYGF                  +LIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  192 bits (489), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 145/255 (56%), Gaps = 22/255 (8%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS Q VRS KN+ KGYS TQVLVR+AT+N+++  S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W ++N   ++ L++F + D  G DQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXX-------XXXXXXXXSSEDDDDLQRA 173
           ++RVKA EL  LL D ERL  E                             ED++D+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 174 IDASRMTAXXXXXXXXXXXXXXT-----ALQLSKEEEELKRLXXXXXXXXXXXXXXXXXP 228
           ++ S+ TA                    A++LSKEE+ELKRL                 P
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKRL----------QDEANNKP 230

Query: 229 MYCDIFGNPITPEEY 243
            Y D  GNPI+ EE+
Sbjct: 231 QYFDENGNPISQEEW 245

 Score =  110 bits (275), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 60/78 (76%)

Query: 354 TGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPK 413
           TGN  ++ KYS LN+LL  GTGIDTFGN G TR+PAQHTKTGTFINSQGTGY+QV++   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 414 HNPFLNSQYTGLPSTNVV 431
             P L +QYTGLP+   V
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  190 bits (483), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 149/287 (51%), Gaps = 48/287 (16%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS+Q VRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119
           KRLND GKYWRHI K+LTVLDYL+RFGSE+C  W +++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIVRVKAKELTSLLSDEERLN-----------------------------------EEXX 144
           QIVRVKA++L  LL   E+L                                    E+  
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 145 XXXXXXXXXXXXXXXXXXSSEDDDD--LQRAIDASRMTAXXXXXXXXXXX-------XXX 195
                              +  +DD  LQRAI+ S+ T                      
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQ 240

Query: 196 TALQLSKEEEELKRLXXXXXXXXXXXXXXXXXP---MYCDIFGNPIT 239
            ALQLS+EEEELK L                      Y D+FGNP++
Sbjct: 241 AALQLSREEEELKNLQHLQRLQQQQQQQQQQQQLNTAYLDVFGNPVS 287

 Score =  140 bits (352), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 79/96 (82%), Gaps = 3/96 (3%)

Query: 347 EPLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYR 406
           +P+ +  TGNQ +T+KYS+LN LL  GTG+DTFGN G  R+PAQHT+TGTFINSQGTG++
Sbjct: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548

Query: 407 QVSN---DPKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
           QV++   DP  NPFLNSQYTGLPST +VPA TGYGF
Sbjct: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGF 584

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  181 bits (459), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 109/256 (42%), Positives = 142/256 (55%), Gaps = 17/256 (6%)

Query: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQL+RSAKN+V GYS  Q+LVRNATSN+    S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W +ENLY+ + L EF H D+  G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIVRVKAKELTSLLSDEERLNEEXXXXXXXXXXXXXXXXXXXXSSED-DDDLQRAIDASR 178
           QI+RVKA+EL +     +                          +ED D DLQRA++ SR
Sbjct: 121 QIIRVKARELVA--LLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESR 178

Query: 179 MTAXXXXXXXXXXXXXX-------TALQLS------KEEEELKRLXXXXXXXXXXXXXXX 225
           +TA                      ALQLS      ++  EL++                
Sbjct: 179 ITAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQ 238

Query: 226 XXPMYCDIFGNPITPE 241
              MY DIFGNPI+ E
Sbjct: 239 PQAMYYDIFGNPISLE 254

 Score =  154 bits (390), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 1/92 (1%)

Query: 349 LTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQV 408
           L  TRTGNQS+TDKYS+LN LL +GTG+DTFGN G TR+PAQHTKTGTFINSQGTGY+QV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 409 SND-PKHNPFLNSQYTGLPSTNVVPAQTGYGF 439
            N+ PKHNPF+ +QYTGLPSTN+VP+ TGYGF
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGF 489

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 95.5 bits (236), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +LDYLIR G+E  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +A EL  LL D+ ++  E
Sbjct: 135 NVRNRAHELALLLDDDAKVRAE 156

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +AK L  LL D+  + +E
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQE 156

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +LDYLIR G+E  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +A EL  LL D+ ++  E
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTE 156

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 85/139 (61%), Gaps = 1/139 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +L+YLI  G+E  +   + +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IVRVKAKELTSLLSDEERL 139
            VR +A+ +TSLLS ++ +
Sbjct: 135 NVRSRAQAMTSLLSSDDAI 153

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           RL +K    WR I KAL +LDYLIR  SE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +AK L  LLSD+E +  E
Sbjct: 135 NVRNRAKALAELLSDDETIRAE 156

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + K L  LLSD+ ++  E
Sbjct: 135 NVRTRVKALVELLSDDSKIRAE 156

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 82/136 (60%), Gaps = 1/136 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  ++  +  VR AT+N+    S   + ++A+ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLIR GSE  +   +  L I++ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKAKELTSLLSDE 136
            VR +AK++  LL D+
Sbjct: 135 NVRNRAKQIVELLQDD 150

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N++  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + +L +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR KA+ LT+LL D+E++  E
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAE 156

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + +++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +A+EL  LL++++++  E
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAE 156

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + K L  LLSD+ ++  E
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAE 156

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + K L  LLSD+ ++  E
Sbjct: 135 NVRTRVKALIELLSDDNKIRAE 156

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I K+L +LDYLIR GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +AK L  LLSD+ ++ +E
Sbjct: 135 NVRNRAKALGELLSDDTKIRQE 156

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + K L  LLSD+ ++  E
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAE 156

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +L+YL++ GSE  +   + NL ++K L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +A +L  LL  +E++ +E
Sbjct: 135 NVRNRASQLVKLLESDEQIRQE 156

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + ++ ++K L+ F + D +G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +AK LT LL D+ ++  E
Sbjct: 170 NVRTRAKALTELLGDDNKIRAE 191

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ ++K L+ F + D EG DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +   L  LL D+  + +E
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQE 156

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I K++ +L+YL++ GSE  +   + NL +I+ L+ F + D +G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + K L  LL D+E +  E
Sbjct: 135 NVRNRTKALVKLLEDDELIRAE 156

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I K+L + DYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR KA+ L + L D++ +  E
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAE 156

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N++       + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K    WR I K++ +L+YLI  GSE  +   +  L +IK L+ F + D +G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR + + L  LL+++E++  E
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIE 156

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I KAL +L+YLI+ GSE  +   + ++ I+K L+ F + D +G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKAKELTSLLSDEERLNEE 142
            VR +A  LT+LL+D+  +  E
Sbjct: 135 NVRNRAAALTALLADDSSIRAE 156

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 77/144 (53%), Gaps = 8/144 (5%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L+++ +N+  G SST+V  RNAT++D +  +  SL+ EL+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQ 118
           +        K   H+ K LT++ YLI  GS+  V+W +  LY+I TLKEF          
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIVRVKAKELTSLLSDEERLNEE 142
              +R  A  L ++L DEE L + 
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQR 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 70.5 bits (171), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 80/145 (55%), Gaps = 12/145 (8%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
            +RS +N+  G S+T+V V+ AT +D    +  +L+ E++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGT 116
           +  G Y +       HI K LT++ YLI  GS + V W ++  Y++ TL+EF    D+  
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DQGQIVRVKAKELTSLLSDEERLNE 141
              + VR+ + +L+ LL D+  L E
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQE 143

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 77/141 (54%), Gaps = 8/141 (5%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L+ S + LV+  S+T++ V+ AT  + +  +  +L+ E++  +Y      EI+ ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  NDKG-----KYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQ 118
              G     K   H+ K LT++ YL+  GS + + W + N+ ++  LKEF   D      
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI 120

Query: 119 GQIVRVKAKELTSLLSDEERL 139
           GQ +R  +++L +L+ D++ L
Sbjct: 121 GQQIRAMSQDLCTLIKDDDLL 141

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 1/141 (0%)

Query: 2   SKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+  R A+N +   +  +  VR AT+ND    S   + ++   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120
           R  +K G  WR I K++ +L YL+  GS   V   K NL +IK L  F   DD+G +Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IVRVKAKELTSLLSDEERLNE 141
            +    + L  L++D+  LN+
Sbjct: 135 KISKATERLIELMTDDHLLND 155

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (53%), Gaps = 12/140 (8%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V+ AT ++    +  +L+ E++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFR--HDDDEGTDQG 119
            K        HI K +T++ YLI  GS + + W + N+ I + LK+F   H+DDE     
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDE--KMA 121

Query: 120 QIVRVKAKELTSLLSDEERL 139
           + +R  A +L  L++D+E L
Sbjct: 122 EQIRYIAGDLCILINDDELL 141

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 73/144 (50%), Gaps = 8/144 (5%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L+R+ ++   G S T++  +NAT++D    +  SL+ E++  +Y S    EI  ++ KRL
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 64  ---NDKGKYWR--HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQ 118
              N K  +    HI K LT+  YLI  GS   V W +  +Y+I +LKEF          
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERM 120

Query: 119 GQIVRVKAKELTSLLSDEERLNEE 142
              +R  A  L+ +L D+E L + 
Sbjct: 121 AVQIRSLASTLSVILRDDELLRQR 144

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 74/144 (51%), Gaps = 8/144 (5%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L  S +N V+  S T+  VR AT +D    +  +L+ E++  +Y      EI+ +L KRL
Sbjct: 3   LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 64  N-----DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQ 118
                 +  K   HI K LT++ YLI  GS + + W + N+ + + LK F   + E    
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKM 120

Query: 119 GQIVRVKAKELTSLLSDEERLNEE 142
           GQ +     ++ ++++D++ L ++
Sbjct: 121 GQQIVFICNDICNIINDDDMLEQK 144

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 10/133 (7%)

Query: 15  GYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKYWR-- 71
           G SST V V+ AT +  +  +  SL+ E+A  +Y      EI  +L KRL   G Y +  
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL--VGNYKKTP 68

Query: 72  -----HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKA 126
                ++ K LT++ +L+  GSE C+ W + +L +I++ ++F   D E       +++ +
Sbjct: 69  SKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQMVNQIQLLS 128

Query: 127 KELTSLLSDEERL 139
            +L  LL+D   L
Sbjct: 129 CKLCQLLTDSNLL 141

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 6/133 (4%)

Query: 13  VKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKYWR 71
           V G SST++ VR AT+ D    +  +L+ E++  +Y      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKA 126
           H     I KALT++ YLI  GSE  V W + NL   + LK             + +R  +
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMS 128

Query: 127 KELTSLLSDEERL 139
            ++   + D+E L
Sbjct: 129 NQICDCVKDDELL 141

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 7/133 (5%)

Query: 17  SSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKAKEL 129
              + K LT++ YL+  GS   + W K N+ +I+ L++F+  D      G+ +R  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 TSLLSDEERLNEE 142
             LL D+E L  +
Sbjct: 133 HELLQDDELLERQ 145

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 75/145 (51%), Gaps = 9/145 (6%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           +  S +N V+  S T++ VR AT ++ N  +  +L+ E++  +Y +    EI+ +L KRL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  NDKGKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQ 118
              GK   H     I K LT++ YL+  GS   + W  EN  + + +K F   D    ++
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEK 120

Query: 119 GQI-VRVKAKELTSLLSDEERLNEE 142
             I +R  ++ +  L+++ E L ++
Sbjct: 121 FAIQIRDLSERILELINNRELLEQK 145

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 15  GYSSTQVLVRNATSNDNNQVSKDSLI--ELAEKSYDSADFFEIMDMLDKRLNDKG----- 67
           G S T   VR AT +DN  V   S +  E+   +Y      ++  +L KRL+        
Sbjct: 11  GSSPTAAKVRKAT-DDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSH 69

Query: 68  KYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKAK 127
           K   HI KALT+ +YLI  GSE+ V W +    +++ LK+F   ++  +     +R  + 
Sbjct: 70  KNAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSL 129

Query: 128 ELTSLLSDEERLNEE 142
            L  L+ +   L + 
Sbjct: 130 SLLELMQNPALLEDH 144

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 68/120 (56%), Gaps = 10/120 (8%)

Query: 15  GYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT ++ +  +  +L+ EL+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKA 126
                 + K LT+++YL+  GSE  VLW + +L  I+ LK++   +D+  D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L  + K+ V+  S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ +L KRL
Sbjct: 3   LFETVKSFVQ--SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRL 60

Query: 64  NDKGKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTL----KEFRHDDDE 114
           +   +   H     I K LT++ YLI  GS   V W + N  +I  L     E+  DD  
Sbjct: 61  SGYSRKTSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKM 120

Query: 115 GTDQGQIVRVKAKELTSLLSDEERLNE 141
           G +   I    A +L  L+ D++ L E
Sbjct: 121 GPEIKSI----AADLMELIQDDDLLEE 143

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 17  SSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQIVRVKAKEL 129
              + K LT++ YL+  GS   + W K N+ +I+ L+ F   D     + + +R  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 TSLLSDE 136
             LL D+
Sbjct: 133 LELLQDD 139

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 14  KGY--SSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLN-----D 65
           KG+  S T++ VR AT ++    +  +L+ E++  +Y      +++ ++ KRL+     +
Sbjct: 8   KGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRN 67

Query: 66  KGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEF 108
             +   H+ K LT++ YL+  GS + + W K + Y+I+ L  F
Sbjct: 68  SHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 78/149 (52%), Gaps = 17/149 (11%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           L  + KN V+  + T+  V+ AT ++    +  +L+ E++  +Y      +I+ ++ KRL
Sbjct: 3   LFDTVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  ND---KGKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKE---FRHDD 112
           +      K   H     I K LT++ YLI  GS   + W + N Y+++ + +   F+  D
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQD 120

Query: 113 DEGTDQ--GQIVRVKAKELTSLLSDEERL 139
           +    +  GQI +V A+++T+L+++E  L
Sbjct: 121 NSADSKMIGQI-KVIAEDMTNLINNENLL 148

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD 112
              + K LT++ YL+  GS   + W K N+ +I+ L++F+  D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNNQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD 112
              + K LT++ YL+  GS   + W K N+ +++ L++F+  D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 77/152 (50%), Gaps = 21/152 (13%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNNQVSKDS---LIELAEKSYDSADFFEIMDMLDKRL- 63
           S +NLV  YS T++ VR AT  D N++ + +   + E++  +Y +    EI+ +L K+L 
Sbjct: 6   SVRNLV--YSQTELKVRQAT--DENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKLS 61

Query: 64  ------NDKG----KYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDD 113
                 N  G    K    + K  T++ YL+  GS + + W K N  +++ L +   ++ 
Sbjct: 62  LLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNNH 121

Query: 114 EGTDQGQIVRVKAKELTS---LLSDEERLNEE 142
              D+   +  +A+++T    LL ++ +L E+
Sbjct: 122 ITDDEDLHILNQAQKITKDIILLINDNKLLEK 153

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL-WCKENL 99
          DF+EI+  LD R+ND    W  + K+L V+  +IR GS++  L +   NL
Sbjct: 36 DFYEIVKGLDSRINDTA--WTIVYKSLLVVHLMIREGSKDVALRYYSRNL 83

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 21/154 (13%)

Query: 5   LVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDS----LIELAEKSYDSADFFEIMDMLD 60
           L  S +N V   S+T++ V+ AT  D+++V   S    + E++  +Y      EI  +L 
Sbjct: 3   LFDSVRNFVN--STTELKVKQAT--DDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLR 58

Query: 61  KRLNDKGKYWRHIA--------KALTVLDYLIRFGSENCVLWCKENLYIIKTLK-----E 107
           KR +      R +         K LT++ +L+  GS   V W K N+   + L+     E
Sbjct: 59  KRFHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITE 118

Query: 108 FRHDDDEGTDQGQIVRVKAKELTSLLSDEERLNE 141
           F   D       + +R  A ++  L+ D+  L E
Sbjct: 119 FSFTDKADLPMYEQIRQSASDILQLIGDDNLLEE 152

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 48 DSADFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL 93
          DS++F EIM  L+ R+ND    W  + K+L V+  ++R G  +  +
Sbjct: 33 DSSEFMEIMKALESRINDTA--WTIVYKSLIVIHLMMRDGDRDVTI 76

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL-WCKENL 99
          DF+EI+  LD R+ND    W  + K L V+  ++R G ++  L +   NL
Sbjct: 36 DFYEIVKALDSRVNDTA--WTIVYKTLLVVHLMMREGKKDVALRYYSRNL 83

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 22 LVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVLD 81
          LV+ AT   +    +  L  +   +    DF+EI+  L+ R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLIRFGSENCVL-WCKENL 99
           +IR G+++  L +   NL
Sbjct: 65 LMIREGAKDVALRYYSRNL 83

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 71/168 (42%), Gaps = 29/168 (17%)

Query: 3   KQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFF-------EI 55
           +   R A+N++  Y   Q+ +R AT+ D+   +   L ++    Y+ + F         +
Sbjct: 17  RNAARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRL 76

Query: 56  MDMLDKRLNDK-----------GKYWRHIAKALTVLDYLI----RFGSENCVLWCKENLY 100
           +D + KR  +            G  WR + K L +L+YL+    R    + VL C +   
Sbjct: 77  VDHMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHK 136

Query: 101 IIKTLKEFRHDDDEGTDQGQI------VRVKAKELTSLLSDEERLNEE 142
            I T +  ++  D  +D G++      ++ K + +  L+ D   L  E
Sbjct: 137 HILTKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIEDTSYLKRE 183

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 47/116 (40%), Gaps = 24/116 (20%)

Query: 3   KQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKR 62
           +   R A+N++  Y   QV +R AT+ D    +   L ++    Y     + +++   KR
Sbjct: 17  RNAARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKR 75

Query: 63  LNDK-------------------GKYWRHIAKALTVLDYLIRFGSE----NCVLWC 95
           L D                    G  WR + K L V+D+LI   SE    N VL C
Sbjct: 76  LVDHIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} similar
          to uniprot|P53309 Saccharomyces cerevisiae YGR241C
          YAP1802 Yeast Assembly Polypeptide, member of AP180
          protein family, binds Pan1p and clathrin; member of
          clathrin assembly polypeptide AP180 family
          Length = 567

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL 93
          DF EI++ L++R+ND    W  + K+L V   +IR G ++  L
Sbjct: 36 DFGEIVNALEERINDSA--WTVVFKSLAVAHLMIRDGDKDIAL 76

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHIAKALTVLDYLI 84
                               G  WR + K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON}
           Anc_3.433 YGR094W
          Length = 1019

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 28  SNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKA-LTVLDYLIRF 86
           S +   + K  L  +AE S    D F++ D     L    ++WR I    +    Y++R 
Sbjct: 745 SGNETMIEKWILHTMAETSNTMNDCFKLRDFSGATLAIH-QFWRSICDVYIEYFKYILRS 803

Query: 87  GSENCVLWCKENLYII 102
           G+E  +  CKE LY +
Sbjct: 804 GTEAQIASCKETLYTV 819

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 67/167 (40%), Gaps = 33/167 (19%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+   +   L ++    Y       + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYL---IRFGSE-----NCVLWCKEN 98
                               G  WR + K L VL+YL   +  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LYIIKTLKEFRHD---DDEGTDQGQIVRVKAKELTSLLSDEERLNEE 142
           L   + + +FR D   D +     + ++ K +++   + D   L  E
Sbjct: 139 L--TRDVMQFRVDFSADGKMEVHERGIKKKCEQMIQYIEDPAYLKRE 183

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 71/165 (43%), Gaps = 31/165 (18%)

Query: 7   RSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFF-------EIMDML 59
           R  +N++  Y   Q+ +R AT+ D    +   L ++    Y    +         I+D L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 60  DKR---LNDK--------GKYWRHIAKALTVLDYLIRFGSE----NCVLWCKENLY---- 100
            KR   L +K        G  WR I K L V++YL+   SE    N V  C EN      
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIFN 140

Query: 101 --IIKTLKEFRHDDD-EGTDQGQIVRVKAKELTSLLSDEERLNEE 142
             I+    EF +D   E  ++G  ++ K + + +L+ D E L EE
Sbjct: 141 SNILNYKIEFCNDGKMEVHERG--IQKKCEVIINLVDDPEFLREE 183

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 66/165 (40%), Gaps = 29/165 (17%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+   +   L ++    Y       + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYL---IRFGSE-NCVLWC--KENLY 100
                               G  WR + K L VL+YL   +  GSE + V+ C       
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 101 IIKTLKEFRHD---DDEGTDQGQIVRVKAKELTSLLSDEERLNEE 142
           + + + +FR D   D +     + ++ K +++   L D   L  E
Sbjct: 139 LSRDVMQFRVDFSADGKMEVHERGIKKKCEQILQYLEDPSYLKRE 183

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 42/101 (41%), Gaps = 20/101 (19%)

Query: 3   KQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKR 62
           +   R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I +   KR
Sbjct: 17  RNAARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKR 75

Query: 63  LNDK-------------------GKYWRHIAKALTVLDYLI 84
           L D                    G  WR + K LTV++YL+
Sbjct: 76  LIDHIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 11/77 (14%)

Query: 24  RNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLDKRL-----------NDKGKYWRH 72
           RN  ++ N++V +D L+     +    D   + +M+  RL           +  G +W  
Sbjct: 58  RNEQADHNDEVEEDPLLTRYHTACQKGDLATVKEMIHGRLLEVNKDGDTVEHITGLHWAS 117

Query: 73  IAKALTVLDYLIRFGSE 89
           I   L+V+D+LI  G++
Sbjct: 118 INNRLSVVDFLISQGAD 134

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,193,366
Number of extensions: 1476529
Number of successful extensions: 3984
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3951
Number of HSP's successfully gapped: 128
Length of query: 462
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 349
Effective length of database: 40,524,141
Effective search space: 14142925209
Effective search space used: 14142925209
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)