Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.827.343ON75575536330.0
Skud_4.937.343ON75575531930.0
Smik_4.747.343ON84575631640.0
YDL164C (CDC9)7.343ON75575531380.0
NCAS0A141107.343ON75373525690.0
TDEL0C020407.343ON70572025050.0
CAGL0I03410g7.343ON72472124840.0
NDAI0A019407.343ON76560824800.0
KNAG0C037407.343ON72772124380.0
KAFR0B008307.343ON71071724070.0
ZYRO0F11572g7.343ON73172423840.0
Kpol_2001.717.343ON72672923500.0
SAKL0F10912g7.343ON69361923360.0
Kwal_56.246167.343ON71572822620.0
KLTH0H01408g7.343ON72361022400.0
TPHA0D045707.343ON73673721820.0
KLLA0D12496g7.343ON70061321390.0
ACL155W7.343ON69772020710.0
TBLA0E020507.343ON72063120280.0
TPHA0M002606.18ON9664232711e-23
ACR008W6.18ON9814182612e-22
ZYRO0C07854g6.18ON9444352541e-21
KNAG0F028706.18ON9542672532e-21
TDEL0G045106.18ON9694092522e-21
TBLA0G010406.18ON9722402478e-21
Smik_15.1746.18ON9454072471e-20
YOR005C (DNL4)6.18ON9444432433e-20
NCAS0D026506.18ON9502402372e-19
CAGL0E02695g6.18ON9463812362e-19
Suva_15.1806.18ON9484232362e-19
KLLA0D01089g6.18ON9073722334e-19
Skud_15.1666.18ON9474172254e-18
KLTH0C11286g6.18ON9513942254e-18
Kwal_56.224146.18ON9632592245e-18
NDAI0I022606.18ON9672682147e-17
KAFR0A050506.18ON9482362148e-17
Kpol_1032.76.18ON9652242085e-16
KNAG0E028106.4ON716141880.062
Skud_10.331.154ON12380750.59
KNAG0A071902.571ON48939708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.82
         (755 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...  1404   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...  1234   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1223   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...  1213   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   994   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   969   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   961   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   959   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   943   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   931   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   922   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   909   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   904   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   875   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   867   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   845   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   828   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   802   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   785   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   108   1e-23
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   105   2e-22
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   102   1e-21
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   102   2e-21
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   101   2e-21
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   100   8e-21
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   100   1e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    98   3e-20
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    96   2e-19
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    96   2e-19
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    96   2e-19
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    94   4e-19
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    91   4e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    91   4e-18
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    91   5e-18
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    87   7e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    87   8e-17
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    85   5e-16
KNAG0E02810 Chr5 (564828..566978) [2151 bp, 716 aa] {ON} Anc_6.4...    39   0.062
Skud_10.33 Chr10 (58265..58636) [372 bp, 123 aa] {ON} YJL184W (R...    33   0.59 
KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa] ...    32   8.8  

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1404 bits (3633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/755 (91%), Positives = 691/755 (91%)

Query: 1   MHRSLAGLILTSVRPXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGGSSSPE 60
           MHRSLAGLILTSVRP                AGKKPKQATLARFFTSMKNKPSGGSSSPE
Sbjct: 1   MHRSLAGLILTSVRPSSSKLLLFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPE 60

Query: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMXXXXXXXXXXXXXXXGVDAS 120
           KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDM               GVDAS
Sbjct: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDAS 120

Query: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180
           QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK
Sbjct: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLG 240
           QSSKNLIPTTYLFINR                  MKTISESCGKSMNQIKLKYKEIGDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480
           DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ
Sbjct: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480

Query: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540
           GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540

Query: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDESLQQL
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660

Query: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720
           HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN
Sbjct: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1234 bits (3193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/755 (81%), Positives = 646/755 (85%)

Query: 1   MHRSLAGLILTSVRPXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGGSSSPE 60
           M R LAGL+ +  R                 AGKKPKQATLARFF+SMKN+PSG SSSPE
Sbjct: 1   MRRLLAGLLFSPARSLNPRLSLLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPE 60

Query: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMXXXXXXXXXXXXXXXGVDAS 120
           KA KHK+EN  +  SSEGA A KKLK +S VQT V  S M               GVD S
Sbjct: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVS 120

Query: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180
           Q+SRE TP+VE+E    DNDHYSSNIPYSEVCEVFN+IEAISSRLEIIRICSDFFIKIM 
Sbjct: 121 QESREFTPQVEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMN 180

Query: 181 QSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLG 240
           QSSKNLIPTTYLFINR                  MKTISESCGKSM+QIKLKYKE+GDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPK LTVGEVFKNLR+IAKTQGKDSQLRKMKLIKRMLTACQGVEAK
Sbjct: 241 EIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLH  N ENS   +IPMDVLESAQQ+IRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCL HGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480
           DGERAQVHLL+DGTMRIYSRNGENMTERYPEIKITDFIQDL++TKNLILDCEAVAWDKEQ
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQ 480

Query: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540
            KILPFQ+LSTRKRKDVEL DVKV+VCLFAFD+LC+N ERLINKSLRERRE L KVTKVV
Sbjct: 481 KKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVV 540

Query: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI+T+NLDELQKFLDESVN SCEGLMVKML+GPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720
           HERLTPTIIDGPKATFVFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TF KGVSL
Sbjct: 661 HERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSS+QI+ELYENQSHVQN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1223 bits (3164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/756 (79%), Positives = 639/756 (84%), Gaps = 1/756 (0%)

Query: 1   MHRSLAGLILTSVRPXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGGSSSPE 60
           M R L GL+++S  P                AGKKPKQATLARFFTSMKNKPSG +S P+
Sbjct: 90  MRRLLGGLLISSTHPLILRLPLSMSSSLPSSAGKKPKQATLARFFTSMKNKPSGNTSPPD 149

Query: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMXXXXXXXXXXXXXXXGVDAS 120
           K+ KH +++  ++ SS G   +KK + ++  Q    Q  M               G D S
Sbjct: 150 KSAKHMLQDSVDDDSSVGVRNVKKSQQVAVAQAATVQPFMSSFPSSLPSSAPSSSGADLS 209

Query: 121 QKSRELTPKVEE-EQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIM 179
           QK + L PKVE+ E    D+DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269

Query: 180 KQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDL 239
           KQSSKNLIPTTYLFINR                  MKTISESCGKSM+QIKLKYKEIGDL
Sbjct: 270 KQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDL 329

Query: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEA 299
           GEIAMGARNVQPTMFKPKPLTVGEVFKNLR+IAKTQGKDSQLRK+KLIKRMLTACQGVEA
Sbjct: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389

Query: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFC 359
           KFLIRSLESKLRIGLAEKTVLISLSKALLLH  N ENS   DIPMDVLESAQQKIRDAFC
Sbjct: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449

Query: 360 QVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419
           QVPNYEIVINSCLEHGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509

Query: 420 YDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKE 479
           YDGERAQVHLL+DGTMRIYSRNGENMTERYPEIKITDFIQDLD TKNLILDCEAVAWDK+
Sbjct: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569

Query: 480 QGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKV 539
           Q KILPFQVLSTRKRKDVEL+DVKVRVCLFAFD+LCHN ERLIN SLRERRE LTKVTKV
Sbjct: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629

Query: 540 VPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKK 599
           VPGEFQYATQI+T+NLDELQKFLDESVN SCEGLMVKML+G ESHYEPSKRSRNWLKLKK
Sbjct: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689

Query: 600 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQ 659
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ 
Sbjct: 690 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749

Query: 660 LHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVS 719
           LH RLTPTIIDGPKAT+VFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTF KGVS
Sbjct: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809

Query: 720 LRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755
           LRFPRFLRIREDKGVEDATSS+QIVELYENQSHVQN
Sbjct: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 1213 bits (3138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/755 (79%), Positives = 637/755 (84%)

Query: 1   MHRSLAGLILTSVRPXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGGSSSPE 60
           M R L G +L+S RP                AGKKPKQATLARFFTSMKNKP+ G+ SP+
Sbjct: 1   MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK 60

Query: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMXXXXXXXXXXXXXXXGVDAS 120
           K+ KH +E+  + +S E   A KKLK  +   T    S M                 D+ 
Sbjct: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP 120

Query: 121 QKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMK 180
           Q+S+ L  +VE+     +NDHYSSNIPYSEVCEVFN+IEAISSRLEIIRICSDFFIKIMK
Sbjct: 121 QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK 180

Query: 181 QSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLG 240
           QSSKNLIPTTYLFINR                  MKTISE+CGKSM+QIKLKYK+IGDLG
Sbjct: 181 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG 240

Query: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAK 300
           EIAMGARNVQPTMFKPKPLTVGEVFKNLR+IAKTQGKDSQL+KMKLIKRMLTAC+G+EAK
Sbjct: 241 EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK 300

Query: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQ 360
           FLIRSLESKLRIGLAEKTVLISLSKALLLH  N E+S   D+PMDVLESAQQKIRDAFCQ
Sbjct: 301 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ 360

Query: 361 VPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420
           VPNYEIVINSCLEHGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
Sbjct: 361 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 420

Query: 421 DGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQ 480
           DGERAQVHLL+DGTMRIYSRNGENMTERYPEI ITDFIQDLD TKNLILDCEAVAWDK+Q
Sbjct: 421 DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ 480

Query: 481 GKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVV 540
           GKILPFQVLSTRKRKDVEL+DVKV+VCLFAFD+LC+N ERLINKSL+ERRE LTKVTKVV
Sbjct: 481 GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV 540

Query: 541 PGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600
           PGEFQYATQI T+NLDELQKFLDESVN SCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
Sbjct: 541 PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD 600

Query: 601 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQL 660
           YLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L
Sbjct: 601 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 660

Query: 661 HERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSL 720
           H+RLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TF KGVSL
Sbjct: 661 HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL 720

Query: 721 RFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755
           RFPRFLRIREDKGVEDATSS+QIVELYENQSH+QN
Sbjct: 721 RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/735 (67%), Positives = 569/735 (77%), Gaps = 22/735 (2%)

Query: 34  KKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAVQT 93
           KK KQATLA+FF+SMKN+       PE +     E  +  +S   A++ K  + +  +  
Sbjct: 27  KKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPS--LSPYTANSKKTFEEI--LNR 82

Query: 94  PVEQ--------SDMXXXXXXXXXXXXXXXGVDASQKSRE---LTPKVEEEQGPIDNDH- 141
           P           SD+               G D  ++  E   L P  E     +  D  
Sbjct: 83  PASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDST 142

Query: 142 --YSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXX 199
             Y S+IPY EVC +F EIE+ SSRL II++CSDFFIKIMK++ +NLIP TYLFIN+   
Sbjct: 143 KPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGP 202

Query: 200 XXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPL 259
                          MKTISESCGKS+ Q++ KY+E+GDLG+IAM ARNVQPTMFKPKPL
Sbjct: 203 DYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPL 262

Query: 260 TVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTV 319
           TVGEVF+NLR IAK++GKDSQ RK+KLIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTV
Sbjct: 263 TVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTV 322

Query: 320 LISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNL 379
           LISLSKALL+H    E     D  M++LE+A+QKIRDAFCQVPNYEIVINSCL++GIM L
Sbjct: 323 LISLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMEL 378

Query: 380 DKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYS 439
           +  C+L+PGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL DGTMRIYS
Sbjct: 379 ETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYS 438

Query: 440 RNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVEL 499
           RNGENMTERYPEI I DFI D   T  LILDCEAVAWD EQ KILPFQVLSTRKRKDV+L
Sbjct: 439 RNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDL 498

Query: 500 SDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559
            DVKV+VCLFAFD+LCHN E+LINKSLRERR+ L +VTK V GEFQYAT++ + NLDELQ
Sbjct: 499 KDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQ 558

Query: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
           KFLD+SV+ SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+     
Sbjct: 559 KFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYG 618

Query: 620 XXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFD 679
                     FLLGCYNQDTGEFETCCKIGTGFSDE LQQL+ RLTPT++DGPKATFV+D
Sbjct: 619 RGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYD 678

Query: 680 SSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATS 739
           SSAEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+ KG+SLRFPRF+R REDKGVEDATS
Sbjct: 679 SSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATS 738

Query: 740 SEQIVELYENQSHVQ 754
           SEQI+ELYENQ+H Q
Sbjct: 739 SEQIIELYENQAHTQ 753

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/720 (67%), Positives = 555/720 (77%), Gaps = 41/720 (5%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISS---EGASAIKKLKHLSAVQT 93
           KQATLARFF++++   +          K K+      I S   +     KK K  S V+ 
Sbjct: 23  KQATLARFFSAVQKDDT----------KEKVNGDVKIIESRDNQDEPVTKKFKSSSPVK- 71

Query: 94  PVEQSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCE 153
                                  +  S  S   +  VE    P+  D Y S +PYS+VC 
Sbjct: 72  -----------------------LQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCN 108

Query: 154 VFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXX 213
           VF EIE  SSRL II+ICS+FF +IMK + +NLIPTTYLFINR                 
Sbjct: 109 VFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGL 168

Query: 214 XMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAK 273
            MKTISE+CGKS+ Q+K +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF+NLR+IA 
Sbjct: 169 LMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAH 228

Query: 274 TQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHGGN 333
           +QGKDSQ RK+KLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL + G 
Sbjct: 229 SQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGE 288

Query: 334 GENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKP 393
                  +  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM LDK C L+PGIPLKP
Sbjct: 289 TGK----EPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKP 344

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIK 453
           MLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL+DGTMRIYSRNGENMTERYPEI 
Sbjct: 345 MLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIS 404

Query: 454 ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDV 513
           I DF+ DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE  DVKVRVCLFAFD+
Sbjct: 405 IRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDI 464

Query: 514 LCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGL 573
           +CHNGER INKSLRERRE L +VTK V GEFQYA ++ T +++ELQKFLD+SV  SCEGL
Sbjct: 465 ICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGL 524

Query: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKML+GPESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLG
Sbjct: 525 MVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLG 584

Query: 634 CYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693
           CYNQD+GEFETCCKIGTGFSDE LQQL+ER + T +DGPKAT+VFDSSAEPDVWFEPTTL
Sbjct: 585 CYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTL 644

Query: 694 FEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHV 753
           FEVLTADLSLSP+YKAG++T+ KGVSLRFPRF+R+R+DK VEDATSS QIVELY++QSHV
Sbjct: 645 FEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/721 (66%), Positives = 559/721 (77%), Gaps = 27/721 (3%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVK-HKIENGTNEISSEGASAIKKLKHLSAVQTPV 95
           +QATLARFF+S+K    G     +  VK   ++  ++E+ +   S +KK+K        +
Sbjct: 29  RQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDA-NKSPLKKMK--------L 79

Query: 96  EQSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVF 155
           E +                 G   +   R++  K            +   +PYS++C +F
Sbjct: 80  ESTGSLTATKNGNQGKEEHEGTPIASTPRQVDSK------------FFCKVPYSDLCNLF 127

Query: 156 NEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXM 215
            EIE  SSRL II++CSDFFIKIMK+  +NLIP TYLFIN+                  M
Sbjct: 128 EEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLM 187

Query: 216 KTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQ 275
           KTISESCGKSM QIK +Y+EIGDLG+IA+ ARNVQPTMFKPKPL VGEVF+NL++IAK+Q
Sbjct: 188 KTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQ 247

Query: 276 GKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGE 335
           GKDSQ +KMKLIKRMLTACQG EAKFLIRSLESKLRIGLAEKTVLI+LSKALL+H    +
Sbjct: 248 GKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIH----D 303

Query: 336 NSHVNDIP-MDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPM 394
             + N  P MDV+E A+QKIRDAFCQVPNYE+VIN+CL++GIM LD+ CT++PGIPLKPM
Sbjct: 304 EKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPM 363

Query: 395 LAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKI 454
           LAKPTKAINEVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I
Sbjct: 364 LAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQI 423

Query: 455 TDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVL 514
            DF+ D  +T +LILDCEAVAWDKEQ KILPFQVL+TRKRKDV +++VKVRVCLFAFD+L
Sbjct: 424 KDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDIL 483

Query: 515 CHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLM 574
            HN  RLIN+ L +RRE L +VTK V GEFQYATQ+ T NLDELQKFLDESV  SCEGLM
Sbjct: 484 LHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLM 543

Query: 575 VKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGC 634
           VKM++G ES+YEPSKRSRNWLKLKKDYLEGVGDSLDLCVL               FLLGC
Sbjct: 544 VKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGC 603

Query: 635 YNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLF 694
           YN D+ +FETCCKIGTGFS+E LQ L+E+L+PT+IDGPK T+VFDSSAEPDVWFEPT LF
Sbjct: 604 YNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLF 663

Query: 695 EVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQ 754
           EVLTADLSLSPIYKAGS+ + KG+SLRFPRFLRIR+DK VEDATSSEQI+E+Y+NQSHV 
Sbjct: 664 EVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVA 723

Query: 755 N 755
           N
Sbjct: 724 N 724

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/608 (76%), Positives = 515/608 (84%), Gaps = 5/608 (0%)

Query: 146 IPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXX 205
           IPY EVC++F EIE  SSRL II++CSDF IKIMKQ  +NLIP TYLFIN+         
Sbjct: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGL 218

Query: 206 XXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 265
                    MKTISESCGKS+ QI+ +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF
Sbjct: 219 ELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278

Query: 266 KNLRSIAKTQGKDSQLRKMKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 324
            NL+ IAK  GKDSQ +K+KLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338

Query: 325 KALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCT 384
           KALL+     E     D  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL++ C+
Sbjct: 339 KALLVK----EFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394

Query: 385 LKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGEN 444
           L+PGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL+DGTMRIYSRNGEN
Sbjct: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454

Query: 445 MTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKV 504
           MTERYPEI I DF++D + TK LILDCEAVAWDKEQ KILPFQVLSTRKRKDV   DVKV
Sbjct: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514

Query: 505 RVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDE 564
           RVCLFAFD+LCHN  +LIN SL+ERRE L +VT   PGEFQYAT++ T NLDELQKFLD+
Sbjct: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574

Query: 565 SVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXX 624
           SVN SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL          
Sbjct: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRT 634

Query: 625 XXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEP 684
                FLLGCYN +TGEFETCCKIGTGFSDE LQQLHE+L  T+IDGPKAT+++DSSAEP
Sbjct: 635 GTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694

Query: 685 DVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIV 744
           DVWFEP+ LFEVLTADLSLSPIYKAGS+ + KGVSLRFPRF+RIREDKGVEDATSSEQI+
Sbjct: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754

Query: 745 ELYENQSH 752
           ELYENQSH
Sbjct: 755 ELYENQSH 762

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/721 (65%), Positives = 556/721 (77%), Gaps = 14/721 (1%)

Query: 34  KKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAVQT 93
           K  +Q TL  FFTS+K      +++P      K+E   +       +A +K +++     
Sbjct: 20  KMKRQMTLNNFFTSVKK---SDTNTPASTTPKKMEKDESPQIPATKTAEEKHENMDVDTD 76

Query: 94  PVEQSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCE 153
           PV  S                  V  S+K      K+++E    D   + S +PY+++C 
Sbjct: 77  PVISSSEVSAKRNSPLTSPSPTPV-VSKKI-----KIQDENN--DTKEFYSTVPYADLCN 128

Query: 154 VFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXX 213
           +F EIE ISSRL II++CS F I +MK   +NLIP TYLFIN+                 
Sbjct: 129 LFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENL 188

Query: 214 XMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAK 273
            +KTI+ESCG+S+ QIK KY EIGDLG+IA+ AR VQPTMFKPKPLTVGEVF+NL+SIA 
Sbjct: 189 LIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIAS 248

Query: 274 TQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHGGN 333
           +QGKDSQ +K+KLIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALL++   
Sbjct: 249 SQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYE-Y 307

Query: 334 GENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKP 393
           GE+    DI M+ +E+A+QKIRDAFCQVPNYE+VI+SCL+HGIMNLD+ C+L+P IPLKP
Sbjct: 308 GESD--KDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKP 365

Query: 394 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIK 453
           MLAKPTK+I+E+ DRFQ + FT EYKYDGERAQVHLL+DGTMRIYSRNGENMTERYPEI 
Sbjct: 366 MLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIH 425

Query: 454 ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDV 513
           I DF+ DL  TK+LILDCEAVAWDKEQ KILPFQVLSTRKRKDV+++++KVRVCLFAFD+
Sbjct: 426 IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDI 485

Query: 514 LCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGL 573
           L HN E+LINKSL+ERR+ L  +TK V GEFQ+AT++ T NL+ELQ FLD+SV  SCEGL
Sbjct: 486 LLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGL 545

Query: 574 MVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 633
           MVKMLEG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FLLG
Sbjct: 546 MVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLG 605

Query: 634 CYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTL 693
           CYNQDTGEFET CKIGTGFSDE LQQLHERL  T+ID PKAT+VFD SAEPDVWFEPT L
Sbjct: 606 CYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLL 665

Query: 694 FEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHV 753
           FEVLTADLSLSP+YKAGS+T+ KGVSLRFPRFLR+REDKGVEDATSSEQIVE+YENQ+++
Sbjct: 666 FEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANL 725

Query: 754 Q 754
           Q
Sbjct: 726 Q 726

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/717 (64%), Positives = 559/717 (77%), Gaps = 40/717 (5%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVE 96
           +QATLARFFTS+K      +S    +      + ++  ++ G+S +KK K      +P+E
Sbjct: 32  RQATLARFFTSIKPSADDQNSKTSSSPVPPPSSSSSSTTANGSSPLKKPK-----LSPIE 86

Query: 97  QSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFN 156
            S                        S E T K E          +  +IPY++VC +F 
Sbjct: 87  SS---------------------KTDSSETTVKQE----------FVCDIPYADVCVLFQ 115

Query: 157 EIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMK 216
           EIE ISSRL+II++CS+FF K MKQ++ NLIP TYLFIN+                  MK
Sbjct: 116 EIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMK 175

Query: 217 TISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQG 276
           TISESCGKS+ Q+KL YK+IGDLG IAM ARNVQPTMFKPKPLTVG VF+NL+ IAK+ G
Sbjct: 176 TISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSG 235

Query: 277 KDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGEN 336
           KDSQL+K++LIK++LTAC+G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL++    E 
Sbjct: 236 KDSQLKKIRLIKKLLTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLIN----EY 291

Query: 337 SHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLA 396
           ++  D  M+++E A+QKIRDAFCQ+PNYEIVINSCL++GIMNLD+ C+L+PGIPLKPMLA
Sbjct: 292 NNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLA 351

Query: 397 KPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITD 456
           KPTK I EV DRFQ   FTSEYKYDGERAQVHL++DG+MRIYSRNGENMTERYPEI +TD
Sbjct: 352 KPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTD 411

Query: 457 FIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCH 516
           FI+DL+ TK+LI+DCEAVAWD+E+ KILPFQVLSTRKRKDV++ D+KVR+CLFAFD+LCH
Sbjct: 412 FIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCH 471

Query: 517 NGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVK 576
           N E+LINKSLRERRE L  VT+ V GEF YA ++ T+NLDELQ FLD+SV  SCEGLMVK
Sbjct: 472 NDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVK 531

Query: 577 MLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 636
           +L+G +SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN
Sbjct: 532 VLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYN 591

Query: 637 QDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEV 696
           QDTGEFET CKIGTGFSDE LQ L++RL  T IDGPKAT+++DSSA+PDVWFEPT LFEV
Sbjct: 592 QDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEV 651

Query: 697 LTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHV 753
           LTADLS+SPIYKAG++T++KG+SLRFPRF+R+REDK VE+ATSSEQI+ELYENQSHV
Sbjct: 652 LTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/724 (64%), Positives = 552/724 (76%), Gaps = 24/724 (3%)

Query: 34  KKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAVQT 93
           K+ KQATLA+FF+S+K++     +SP K      +N T    +   + +K+   + +   
Sbjct: 27  KQAKQATLAKFFSSVKDR-----NSPTK------KNATPAFPT--TTNVKRESPVRSNSN 73

Query: 94  PVEQSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPID----NDHYSSNIPYS 149
             E S M               G++          K+E +         +DH+S+ +PY+
Sbjct: 74  EKESSPMFDDSNGRSSACSSA-GLEMESAPAPKKLKMESDSNSTSKNNQDDHFST-VPYA 131

Query: 150 EVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXX 209
           +VC +F EIE+ SSRL II+ICSDFF +I+K+ S+NL+PTTYLFIN+             
Sbjct: 132 DVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGL 191

Query: 210 XXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLR 269
                MKTISESCGKS+ Q+K +Y+E+GDLG+IAM ARNVQPTMFKPKPLTVGEVF NLR
Sbjct: 192 GEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLR 251

Query: 270 SIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 329
           +IA  QGKDSQ +K+KLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL 
Sbjct: 252 NIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLR 311

Query: 330 HGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGI 389
           H   G +   +D   + ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L K C L PGI
Sbjct: 312 HE-QGLDVEPSD---EAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGI 367

Query: 390 PLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERY 449
           PLKPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERY
Sbjct: 368 PLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERY 427

Query: 450 PEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLF 509
           PEI I DF+ D  +T++LILDCEAVAWDKEQGKILPFQVLSTRKRKDV+  DVKVRVCLF
Sbjct: 428 PEIDIRDFLSD-PSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLF 486

Query: 510 AFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQS 569
           AFD+LCHNGE LINKSLRER++ L KVTK V GEF+YA +++T N++ELQ FLD+SV  S
Sbjct: 487 AFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDS 546

Query: 570 CEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXX 629
           CEGLMVKML+GPESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               
Sbjct: 547 CEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGG 606

Query: 630 FLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFE 689
           FLLGCYNQDTGE+ETCCKIGTGFS+E LQQL++RL PT ++ P A +V+DS+ +PDVWFE
Sbjct: 607 FLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFE 666

Query: 690 PTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYEN 749
           PT LFEVL ADLSLSP+YKAGS  + KG+SLRFPRFLRIR+DK VE+ATSSEQ+V+LYE 
Sbjct: 667 PTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEA 726

Query: 750 QSHV 753
           Q+H+
Sbjct: 727 QAHL 730

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/729 (62%), Positives = 541/729 (74%), Gaps = 30/729 (4%)

Query: 32  AGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAV 91
            G   KQATLARFF+SM          P++ +       +  I+ +  S   K   L++ 
Sbjct: 23  GGGAKKQATLARFFSSM----------PKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSD 72

Query: 92  QTPVEQSDMXXXXXXXXXXXXXXXGVDASQKSRELTP-KVEEEQGPIDNDHYSSNIPYSE 150
           +TP   +                  + +S +   +TP KV     P+    + S +PY++
Sbjct: 73  ETPTTSAG--------SVTSKDEPSLTSSPQKPIVTPAKVPSNTKPV---KFFSTVPYAD 121

Query: 151 VCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXX 210
           +CEVF E+E+ SSRL II+ICSDF IK+MKQ  +NL+P TYLFIN+              
Sbjct: 122 LCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLG 181

Query: 211 XXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRS 270
               MKTISESCGKSM Q+K +Y+EIGDLG+IA  ARNVQPTMFKPKPLTVGEVF+NL+ 
Sbjct: 182 EGLLMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKD 241

Query: 271 IAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH 330
           IA++QGKDSQ RKM+LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL+
Sbjct: 242 IAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLN 301

Query: 331 GGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIP 390
               E     D  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD  C L+PGIP
Sbjct: 302 ----EYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIP 357

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYP 450
           LKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL +G MRIYSRNGENMTERYP
Sbjct: 358 LKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYP 417

Query: 451 EIKITDFI----QDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRV 506
           E+ I DF+     + D   +LILDCE VAWD EQ KILPFQVLSTRKRK VEL DVKVRV
Sbjct: 418 ELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRV 477

Query: 507 CLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESV 566
           CLFAFD+L +NGE LI K+LRERR+ L +VTK VPGEFQYAT ++T  LDE+QKFLD+++
Sbjct: 478 CLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAI 537

Query: 567 NQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXX 626
             SCEGLMVK+L+G ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+            
Sbjct: 538 KDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGT 597

Query: 627 XXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDV 686
              FLLGCYNQD+GE+ETCCKIGTGFSDE L +L+E      I+ PK+ + FDSSAEPD+
Sbjct: 598 YGGFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDI 657

Query: 687 WFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVEL 746
           WFEP  LFEVLTADLSLSPIYKAGS T+ KG+SLRFPRFLRIR+DK VEDATSS+QI+E+
Sbjct: 658 WFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEM 717

Query: 747 YENQSHVQN 755
           YENQSH+Q+
Sbjct: 718 YENQSHIQS 726

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/619 (69%), Positives = 508/619 (82%), Gaps = 5/619 (0%)

Query: 136 PIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFIN 195
           P+    + S IPYS+VC +F+EIE+ SSRL I++ICS+FF  ++KQ+  NL+P TYLFIN
Sbjct: 79  PVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFIN 138

Query: 196 RXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFK 255
           R                  MKTI+ESCGKS+ Q++ KY+EIGDLGE+A  AR VQPTMFK
Sbjct: 139 RLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFK 198

Query: 256 PKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLA 315
           PKPLTVGEVF NL+SIAK+QGKDSQ RK++LIKRMLTACQGVEAKFLIRSLESKLRIGLA
Sbjct: 199 PKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLA 258

Query: 316 EKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHG 375
           EKTVLISLSKALL +  +GE         +++E+A+Q++RDAFCQVPNYEIVIN+CLEHG
Sbjct: 259 EKTVLISLSKALLSYEHDGEEPS-----SELVENAEQRVRDAFCQVPNYEIVINTCLEHG 313

Query: 376 IMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTM 435
           IM ++K C LKPGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M
Sbjct: 314 IMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSM 373

Query: 436 RIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRK 495
            IYSRNGENMTERYPE+ I D++ D + T +LILDCEAVAWD EQGKILPFQ+LSTRKRK
Sbjct: 374 NIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRK 433

Query: 496 DVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555
            VE  DVKVRVCLFAFD+LC+NG+ LIN SL ERRE L +V K V G+FQ+A ++ + NL
Sbjct: 434 GVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNL 493

Query: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLX 615
           +++QK+L++SV  +CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL 
Sbjct: 494 EDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLG 553

Query: 616 XXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKAT 675
                         FLLGCYNQDTGEFETCCKIGTGFSDE L  L+E+L P+ ++ PKA 
Sbjct: 554 AYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAF 613

Query: 676 FVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVE 735
           +V+DSSAEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VE
Sbjct: 614 YVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVE 673

Query: 736 DATSSEQIVELYENQSHVQ 754
           DATSSEQIVELYE+Q ++Q
Sbjct: 674 DATSSEQIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/728 (60%), Positives = 534/728 (73%), Gaps = 38/728 (5%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEI--SSEGASAIKKLKHLSAVQTP 94
           KQATLA+FF+S K + +     P+++ K    N  +    SS+G+       +   +Q P
Sbjct: 14  KQATLAKFFSS-KKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETLQKP 72

Query: 95  VEQSDMXXXXXXXXXXXXXXXGVDASQKSRE--LTPK---VEEEQGPIDNDHYS----SN 145
                                 + A++   E  + P    VE+  G +     S    SN
Sbjct: 73  ---------------------QLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSN 111

Query: 146 IPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXX 205
           + YSE+C VFNEIE  SSRL+I+++CSDF   ++ ++ K+L+P TYL IN+         
Sbjct: 112 VMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGL 171

Query: 206 XXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 265
                    MKTISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPKPLT G VF
Sbjct: 172 ELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVF 231

Query: 266 KNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSK 325
            NL+ IA+ QGKDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSK
Sbjct: 232 ANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSK 291

Query: 326 ALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTL 385
           A+L H   G+         D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K C L
Sbjct: 292 AILTHEHGGKEPS-----SDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVL 346

Query: 386 KPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENM 445
            PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENM
Sbjct: 347 TPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENM 406

Query: 446 TERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVR 505
           TERYPEI I+DF+   D T  LILDCEAVAWDK++  ILPFQVLSTRKRK V   DVKVR
Sbjct: 407 TERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVR 466

Query: 506 VCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDES 565
           VCLFAFD+LC+N E LINKSL ERR  L ++ K VPGE Q A+++ T +LDE+Q +LD+S
Sbjct: 467 VCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQS 526

Query: 566 VNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXX 625
           V   CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL           
Sbjct: 527 VKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTG 586

Query: 626 XXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPD 685
               FLLGCYNQDTGEFETCCKIGTGFSDE LQ L+E+L+PT I  PKA +V+  SA+PD
Sbjct: 587 TYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPD 646

Query: 686 VWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVE 745
           VW EP+ LFEVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSSEQ++E
Sbjct: 647 VWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIE 706

Query: 746 LYENQSHV 753
            YE+QSH+
Sbjct: 707 FYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/610 (67%), Positives = 488/610 (80%), Gaps = 5/610 (0%)

Query: 144 SNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXX 203
           S I Y+E+C VFNEIE  SSRL+I+++C DF   ++ ++ K+++P TYL IN+       
Sbjct: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177

Query: 204 XXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGE 263
                      MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPKPLT GE
Sbjct: 178 GLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237

Query: 264 VFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 323
           VF NL++IA++QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297

Query: 324 SKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFC 383
           SKALL +  NG+         +++++A+QKIRDAFCQVPNY+IVI + LEHGIM LDK C
Sbjct: 298 SKALLTYEHNGKEPS-----SELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGE 443
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412

Query: 444 NMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK 503
           NMTERYPEI+I+DFI D   T  LILDCEAVAWDKE+  ILPFQVLSTRKRK V + DVK
Sbjct: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472

Query: 504 VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLD 563
           VRVCLFAFD+LC+N E LI + L ERR CL +    VPGE Q A+++ T +LDELQ +LD
Sbjct: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532

Query: 564 ESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXX 623
           ++V   CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKR 592

Query: 624 XXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAE 683
                 FLLGCYNQD+GE+ETCCKIGTGFS+E LQ L +RL+PT I  PKA +V   SA 
Sbjct: 593 TGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652

Query: 684 PDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQI 743
           PDVWFEPT LFEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSSEQ+
Sbjct: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712

Query: 744 VELYENQSHV 753
           VE YE+QSHV
Sbjct: 713 VEFYESQSHV 722

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/737 (59%), Positives = 521/737 (70%), Gaps = 64/737 (8%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVE 96
           KQATLARFFTSM     G  + P   V  K E+  N +        KK K    V+    
Sbjct: 46  KQATLARFFTSM-----GKKTPPAVEVATKQESPENHVD-------KKRK----VEVHPS 89

Query: 97  QSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVCEVFN 156
           QS                  V AS+K+         E  P   D   S + YSEVC +F 
Sbjct: 90  QS------------------VGASEKA---------ESPP---DQTKSTVLYSEVCNLFQ 119

Query: 157 EIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXXXXMK 216
           +IE  SSRL II++CS+FFI+++K +  ++I   YLFINR                  +K
Sbjct: 120 QIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIK 179

Query: 217 TISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQG 276
           TISE+ GKS+ QIKL+ KE GDLG IA  ARN+QPTMFKPKPLT+ +VF NL+ IA   G
Sbjct: 180 TISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATG 239

Query: 277 KDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH-----G 331
           KDSQLRK+KLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTVLISLSKALLLH      
Sbjct: 240 KDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEK 299

Query: 332 GNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPL 391
           G  +    +   MD++E A+ K+R+A CQVPNYEIVIN CL+ GI+N+DK CTL+PGIPL
Sbjct: 300 GESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPL 359

Query: 392 KPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPE 451
           KPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL+ G MRIYSRNGENMTERYPE
Sbjct: 360 KPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPE 419

Query: 452 IKITDFI-------------QDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
           + + DF+               +   K++ILDCE VAWD EQ KILPFQVL+TRKRK+V+
Sbjct: 420 LDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVD 479

Query: 499 LSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDEL 558
           L DVKVRVCLFAFD+L  N E +INKSLRER+E L KVT +VPGEFQYAT ++T ++DEL
Sbjct: 480 LKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDEL 539

Query: 559 QKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXX 618
           Q FLD++V  SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDL V+    
Sbjct: 540 QTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYF 599

Query: 619 XXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVF 678
                      FLLGCYN+DT EFETCCKIGTGFSDE L  LH  L PT ID P  T+++
Sbjct: 600 GKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIY 659

Query: 679 DSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDAT 738
           DSSAEPDVWF+   LFEVLTADLSLSP+YKAG++ + KG+SLRFPRFLRIREDK V D T
Sbjct: 660 DSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGT 719

Query: 739 SSEQIVELYENQSHVQN 755
           +SE I+E YE+QSH+QN
Sbjct: 720 TSEDIIEFYESQSHIQN 736

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/613 (64%), Positives = 475/613 (77%), Gaps = 5/613 (0%)

Query: 142 YSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXX 201
           + SNIP++E+C+ F  IE  SSRL I  ICS F   ++++  ++L+P TYLFI++     
Sbjct: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDY 152

Query: 202 XXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 261
                        +KTISE+CGKS+ QI+ KY+EIGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 153 EPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212

Query: 262 GEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321
           GEVF NL SIAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272

Query: 322 SLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381
           S+SKA+L H  NG+         +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 273 SVSKAILTHEHNGQEPST-----EMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 382 FCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRN 441
              L+PGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387

Query: 442 GENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSD 501
           GE+MTERYPEI +  +++DL ATK+ I+D EAVAWD+EQGKILPFQVLSTRKRK VEL D
Sbjct: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447

Query: 502 VKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKF 561
           VKVRVCL+AFD+LC N E LINKS  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507

Query: 562 LDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 621
           LD+SV  SCEGLMVKMLEG ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRG 567

Query: 622 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSS 681
                   FLLGCYN D+ EFETCCKIGTGFSDE LQ L+ +L  T ++ P    ++DSS
Sbjct: 568 KRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627

Query: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSE 741
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSS+
Sbjct: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687

Query: 742 QIVELYENQSHVQ 754
           Q++E YE+Q+H++
Sbjct: 688 QVIEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/720 (56%), Positives = 498/720 (69%), Gaps = 35/720 (4%)

Query: 37  KQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEG----ASAIKKLKHLSAVQ 92
           KQATL RFFT++K +P  G+++     K K+E      +  G    A     L  L+   
Sbjct: 6   KQATLGRFFTALK-RPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKP 64

Query: 93  TPVEQSDMXXXXXXXXXXXXXXXGVDASQKSRELTPKVEEEQGPIDNDHYSSNIPYSEVC 152
            P                     GV     S      V   Q        S+++ Y+++C
Sbjct: 65  AP--------------------GGVLPQAAS-----AVPRAQSSPVKPAASTSVMYADLC 99

Query: 153 EVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRXXXXXXXXXXXXXXXX 212
            VF  +EA SSRL I ++C+DF   ++K    +LIP TYLFINR                
Sbjct: 100 AVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEG 159

Query: 213 XXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIA 272
             +KTIS++CGKS  Q++  Y+E GDLG +A  AR VQPTMFKPKPLTV +VF  L++IA
Sbjct: 160 ILIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIA 219

Query: 273 KTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHGG 332
           + +GKDSQ +K++LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L H  
Sbjct: 220 QAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH 279

Query: 333 NGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLK 392
           +G+      +     ++A+  +RD FCQVPNYE++IN+ L++GIMNL + C L PGIPLK
Sbjct: 280 DGKEPSPEQV-----DAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLK 334

Query: 393 PMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEI 452
           PMLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL++DGT+RIYSRN ENMTERYPEI
Sbjct: 335 PMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEI 394

Query: 453 KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFD 512
           +   F+ +   T++LI+DCEAVAWD E+ KILPFQVLSTRKRK VEL DVKVRVCLFAFD
Sbjct: 395 QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFD 454

Query: 513 VLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEG 572
           +L  NGE L+  SL +RR+ L  V KVVPGE Q+A +I T  L ELQ +L++SV+ SCEG
Sbjct: 455 LLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEG 514

Query: 573 LMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLL 632
           LMVKML+G ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL               FLL
Sbjct: 515 LMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLL 574

Query: 633 GCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTT 692
           GCYN D  EFETCCKIGTGFS+E LQ LH +L  T+I  P+    +D S+ PDVWFEP  
Sbjct: 575 GCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAM 634

Query: 693 LFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752
           LFEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSS+QIVE Y+ Q++
Sbjct: 635 LFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/631 (60%), Positives = 473/631 (74%), Gaps = 13/631 (2%)

Query: 127 TPKVEEEQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNL 186
           TP+  ++  P      +S++PY+++C++F  IE+ SSRL I  +C+ FF + ++     L
Sbjct: 101 TPRPTKKSKPA-----TSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLL 155

Query: 187 IPTTYLFINRXXXXXXXXXXXXXXXXXXMKTISESCGKSMNQIKLKYKEIGDLGEIAMGA 246
           +P TYL IN+                  +K I  +CG S  Q+KL+Y+++GDLG++AM  
Sbjct: 156 VPVTYLCINKLGPDYSGVELGLGEGLL-LKAIGSACGVSQQQLKLQYRKLGDLGQLAMST 214

Query: 247 RNVQPT--MFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIR 304
           R +QPT  MFK +PLT+ +VF  L  IA +QGKDSQ +K+ +IKR+LT+CQGVEAKFLIR
Sbjct: 215 RVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIR 274

Query: 305 SLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNY 364
           SLESKLRIGLAEKTVL SL++AL++H    +N   +D       +A+Q I+D+FCQ+PNY
Sbjct: 275 SLESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDD-----YSNAEQIIKDSFCQIPNY 329

Query: 365 EIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGER 424
           EI+I + L++G+  L     L PGIPLKPMLAKPTK+I+EVLD FQ   FTSEYKYDGER
Sbjct: 330 EIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGER 389

Query: 425 AQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKIL 484
           AQVHLL DG+MRIYSRNGE+MT+RYPE+ I D++ D   T  LILDCEAVAWD E  KIL
Sbjct: 390 AQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKIL 449

Query: 485 PFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEF 544
           PFQVLSTRKRK V+L D+KVRVCLFAFD+L HN + LIN +LRERR+ L  +TK  PG+F
Sbjct: 450 PFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQF 509

Query: 545 QYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEG 604
           Q+AT++ T NLDELQ FLD+++  SCEGLMVK L+G +SHYEPSKRSRNWLKLKKDYL+G
Sbjct: 510 QFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQG 569

Query: 605 VGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERL 664
           +GDSLDLCVL               FLL CYNQDT EFETCCKIGTGFSDE LQ L+  L
Sbjct: 570 MGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGL 629

Query: 665 TPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPR 724
             T I+ P+A FVFDSSAEPDVWF PT +FEVLTADLSLSPIYKAGST + KG+SLRFPR
Sbjct: 630 KETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPR 689

Query: 725 FLRIREDKGVEDATSSEQIVELYENQSHVQN 755
           F+RIR DK V DATSSEQ+++ YENQSH+Q+
Sbjct: 690 FIRIRTDKSVNDATSSEQVIDFYENQSHLQS 720

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 106/423 (25%), Positives = 178/423 (42%), Gaps = 69/423 (16%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERY 449
            +P LAK      EVL R     FT E K DGER Q+H +D G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 450 PEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVR 505
            + K    I+ ++Q  +  K  ILD E V++DK +  ILPF ++ +     +++  ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 506 VC---LFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFL 562
           +C      FDVL  NG  L N  L +R+E L+ +        +     +  + + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 563 DESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXX 622
             +++   EG+++K     +S Y    R+ +W+K+K +YLE  G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKY---DSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 623 XXXXXXXFL----------------LGCYNQDT---------------GEFETCCKIGTG 651
                   L                L   + D+                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 652 FSDESLQQLHER----LTPTIIDGPKATFVFDSSAEPDVWFEP--TTLFEV----LTADL 701
            S+E  +++  +          + P   ++   +  P  W  P  + + EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 702 SLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIV----------ELYENQS 751
           +L   +K G T +  G   R     RIR DK   D  +   +V          ELY N S
Sbjct: 621 ALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHS 673

Query: 752 HVQ 754
           H++
Sbjct: 674 HIK 676

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 106/418 (25%), Positives = 172/418 (41%), Gaps = 66/418 (15%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442
           +++ G    P +A+  K   E +    G  F  E K DG+R QVH +D G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 443 ENMTERYPEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
            N T  Y E      I++ ++ ++  K  ILD E V++DKE   ILPF +  +     V 
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 499 L-----SDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTD 553
                 ++   R     FD+L  NG+ L N+ + +R+E L K+           +     
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 554 NLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 614 LXXXXXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETC 645
           +               F+      D  E                            F + 
Sbjct: 524 I------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 646 CKIGTGFSDESLQQLHERLT-----PTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLT 698
           C I  G S+E  +++ +RLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636

Query: 699 ADL----SLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752
             +    S S +YK GST +            RIR DK    A++  +     E +S+
Sbjct: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSY 687

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 111/435 (25%), Positives = 184/435 (42%), Gaps = 53/435 (12%)

Query: 355 RDAFCQVPNYEIVINSCLE--HGIMNLDKFCTLKPGIPLKPMLAKPTK-AINEVLDRFQG 411
           RD    V + + V +   +  H + N D    L  G+P  P LAK    + ++V  R + 
Sbjct: 220 RDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNL--GLPFAPFLAKRLYISYDKVALRLKS 277

Query: 412 ETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERYPEI----KITDFIQDLDATKN 466
           + +  E K DGER Q+H +D G  ++ +SR G + T  Y E      +  ++Q     + 
Sbjct: 278 DFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRE 336

Query: 467 LILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV---KVRVCLFAFDVLCHNGERLIN 523
            +LD E +++D E+  +LPF ++ +  R  +    +     R      D L  NG  LIN
Sbjct: 337 CVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLIN 396

Query: 524 KSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPES 583
             L  R++ L+ +    P   +    +   +   ++  L++++    EG+++K  +   S
Sbjct: 397 VPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---S 453

Query: 584 HYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG---------- 633
            YE   R+ NW+K+K +YLE  G++LDL V+                L G          
Sbjct: 454 KYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDK 513

Query: 634 -CYNQDTGE----------FETCCKIGTGFSDESLQQLHERLTP-----TIIDGPKATFV 677
              N D+ E          F + C I  G S E  +Q+ ER T      T    P     
Sbjct: 514 QVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFKQI-ERKTAGKWKNTEDHKPPKILE 572

Query: 678 FDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVE 735
           F S   P+ W  P  + + EV    L  +   ++    F  G +L      RIREDK   
Sbjct: 573 FGSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSGRKFKVGCTLHGGYCRRIREDK--- 625

Query: 736 DATSSEQIVELYENQ 750
           + T    + EL++ +
Sbjct: 626 NWTECYTLYELWQER 640

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 131/267 (49%), Gaps = 11/267 (4%)

Query: 356 DAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFT 415
           D F  V +   V     E  +   ++  TLK G    P LAK      E + +  G  F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 416 SEYKYDGERAQVHLLDDGT-MRIYSRNGENMTERY----PEIKITDFIQDLDATKNLILD 470
            E K DGER Q+H +D G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 471 CEAVAWDKEQGKILPFQVLSTRKRKDV---ELSDVKVRVCLFAFDVLCHNGERLINKSLR 527
            E V +D+E+  ILPF ++ +  +  +    +S+        AFD++  NG  L++  L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 528 ERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEP 587
           +R++ L+K+     G     +    +NL+ + K L  +++   EG+++K L    S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456

Query: 588 SKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/409 (23%), Positives = 167/409 (40%), Gaps = 55/409 (13%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNGENMT 446
           G    P LAK      E +       F  E K DGER QVH +D G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 447 ERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV 502
           + Y E      + +++      ++ +LD E + +D ++  +LPF ++ +  R+ +    +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 503 ---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559
                R  L   D++  NG  LI   L +R+E L +V K  P   +    +       ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
           K L++S++   EG+++K  +   + YE   R+  W+K+K +YLE  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLKSYK---ARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 620 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 649
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 650 TGFSDESLQQLHERLTPTIIDG----PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSL 703
            G S +  +++  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 704 SPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752
           +   ++    FA G +L      RIR+DK   D T      EL++ + H
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 120/240 (50%), Gaps = 13/240 (5%)

Query: 384 TLKPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRN 441
           ++K G    P LAK    + + + +R   + F  E K DGER Q+H ++ G T++ +SR+
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326

Query: 442 GENMTERYPEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV 497
           G + T  Y   K    I  F++     K  +LD E V +D    K+LPF ++ +     +
Sbjct: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386

Query: 498 ELSDV---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDN 554
              D+           FD+L  NG  LI+  L +R+E L  V        +  + I   +
Sbjct: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446

Query: 555 LDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
             +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 447 SIQIKKGLDAAISVGSEGIVLKQYI---SKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 103/407 (25%), Positives = 168/407 (41%), Gaps = 49/407 (12%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442
           T+K G    P LAK      E + R     F  E K DGER QVH ++ G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 443 ENMTERY-PEIKITDFIQDLDATKNL---ILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
            + T  Y   +        LD T N+   +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366

Query: 499 ---LSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555
              +++V        FD+L  NG  L    L +R+E L  +   V    +        N+
Sbjct: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426

Query: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLX 615
           + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++ 
Sbjct: 427 ESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVIIG 483

Query: 616 XXXXXXXXXXXXXXFL-------------LGCYNQDTGE-----------FETCCKIGTG 651
                          L              G  N    E             + C +  G
Sbjct: 484 RDPGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANG 543

Query: 652 FSDESLQQLHERL-----TPTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLS 704
            S E  +++  +        + +  P + F F S   P  W EP  + + E+ +  L  +
Sbjct: 544 ISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKI-PAEWIEPNESIVLEIKSRSLDNT 602

Query: 705 PIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQS 751
              +     +A   +L      RIR DK   D T    + ELY+++S
Sbjct: 603 ---ETNMQKYATSCTLYGGYCKRIRFDK---DWTDCFTLNELYDSRS 643

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 100/443 (22%), Positives = 187/443 (42%), Gaps = 63/443 (14%)

Query: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    + + ++V +   +  +   D   ++K G    P LAK      E + R   + F
Sbjct: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277

Query: 415 TSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERY----PEIKITDFIQDLDATKNLIL 469
             E K DGER QVH ++ G +++ +SR G + T  Y        I+  ++  D+ K  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337

Query: 470 DCEAVAWDKEQGKILPFQVLSTRKRKDVE---LSDVKVRVCLFAFDVLCHNGERLINKSL 526
           D E V +D ++  ILPF ++    ++ +    +++V        FD+L  NG  L    L
Sbjct: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 527 RERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYE 586
            +R++ L  +   +    +         ++ ++K L+ +++   EG+++K      S Y 
Sbjct: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYN 454

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFE--- 643
            + R+ NW+K+K +YLE  G++LDL V+               F+LG    D  E++   
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQ 508

Query: 644 ---------------------------TCCKIGTGFSDESLQQL------HERLTPTIID 670
                                      + C I  G S E  +++      H + T  +  
Sbjct: 509 GDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEV-- 566

Query: 671 GPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRI 728
            P A+ +   S  P  W +P  + + E+ +  L  +   +     +A   +L      RI
Sbjct: 567 APPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRI 623

Query: 729 REDKGVEDATSSEQIVELYENQS 751
           R DK   D  +   + +LYE+++
Sbjct: 624 RYDKEWTDCYT---LNDLYESRT 643

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 118/240 (49%), Gaps = 13/240 (5%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442
            + PG    P LAK      E +       F  E K DGER Q+H  D G  ++ +SR G
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 443 ENMTERYPEIKITDFI-QDLDATKNL---ILDCEAVAWDKEQGKILPFQVLSTRKR---- 494
            + T  Y E     FI + L   K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 495 KDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDN 554
           KD  +++   +     FD++  NG  L N  L  R+E L  +    P   +  +     N
Sbjct: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 555 LDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            D ++K L+ +++   EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/381 (24%), Positives = 162/381 (42%), Gaps = 48/381 (12%)

Query: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNGENMT 446
           G+   P LA       + +    G  F  E K DGER Q+H  + G+ ++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 447 ERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV 502
             Y        + +FI      K+ +LDCE V +D     +LPF ++ +  +  +    +
Sbjct: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385

Query: 503 KVR---VCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559
             +     L  FDVL  NG  L++    +RRE L ++        +    I  ++   ++
Sbjct: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445

Query: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
           K L+++++   EG+++K  +   S Y  + RS +W+K+K +YLE  G+++DL ++     
Sbjct: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM----- 497

Query: 620 XXXXXXXXXXFLLGCY-------------NQDTGE--------FETCCKIGTGFSDESLQ 658
                      +LG               N  + E        F + C I  G S+E  +
Sbjct: 498 -GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYK 556

Query: 659 QLHERLTPTIIDG---PKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTT 713
           ++  +      D    P   ++   S  P  W +P  + + E+    L  +   ++    
Sbjct: 557 EIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERK 613

Query: 714 FAKGVSLRFPRFLR-IREDKG 733
           FA G +L F  + R IREDK 
Sbjct: 614 FAAGCTL-FGGYCRQIREDKN 633

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 104/423 (24%), Positives = 180/423 (42%), Gaps = 72/423 (17%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442
           ++K G    P LAK      E +       F  E K DGER QVH ++ G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERYP----EIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
            + T  Y        I+ +++  D+ K  +LD E V +D  +  ILPF ++    ++ + 
Sbjct: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366

Query: 499 LSDVK---VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIV---- 551
            +D+           FD+L  NG  L    L +R+E L+ +  ++P   +   +IV    
Sbjct: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSI--LIPS--KSVVEIVRYSR 422

Query: 552 TDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 611
             + + ++K L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYDAESVKKSLEVAISLGSEGVVLKHYS---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479

Query: 612 CVLXXXXXXXXXXXXXXXFLLGCY---NQDTGEFE------------------------- 643
            ++               F+LG      Q+TG+ +                         
Sbjct: 480 III------GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVR 533

Query: 644 ---TCCKIGTGFSDESLQQL------HERLTPTIIDGPKATFVFDSSAEPDVWFEP--TT 692
              + C I  G S E  +++      H + T  +   P  + +   S  P  W EP  + 
Sbjct: 534 KVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGL--SPPPSILEFGSKLPAEWIEPSESI 591

Query: 693 LFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752
           + E+ +  L  +   +     +A   +L      RIR DK   D T    + ELYEN+  
Sbjct: 592 VLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDK---DWTECYTLDELYENRRT 645

Query: 753 VQN 755
             N
Sbjct: 646 KSN 648

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 160/372 (43%), Gaps = 35/372 (9%)

Query: 391 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNGENMTERY 449
            +P LAK T    E +       F  E K DGER Q+H ++ G  ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 450 PEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV--ELSDV- 502
            E      I+  ++     K+ ILD E + +D E+  +LPF ++ +     +  EL+ + 
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 503 ---KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQ 559
                +    AFD++  NG+ L N +L  R++ LTK+   V    +    +   N + ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 560 KFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 619
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 620 XXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDESLQQLHERLTPTII---- 669
                     F  G    D  E      F + C I  G S+E  + +  +          
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 670 DGPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLR 727
           D P    +   +  P  W  P  + + EV    +      ++    +  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 728 IREDKGVEDATS 739
           IR DK  +   S
Sbjct: 595 IRYDKDWKTVAS 606

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 173/417 (41%), Gaps = 70/417 (16%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442
           ++K G    P LAK      E + R     F  E K DGER QVH ++ G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 443 ENMTERY----PEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
            + T  Y        I+ +++  +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 499 LSDVK---VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTD-- 553
            SD+     R     FD+L  N   L    L +R++ L+ +  + P  F+   +IV    
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSI--LTP--FKNVVEIVQSTR 422

Query: 554 --NLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 611
             ++  ++  L+ +++   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL
Sbjct: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479

Query: 612 CVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFE---------------------------- 643
            ++               F+LG    D  E E                            
Sbjct: 480 III------GRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKV 533

Query: 644 ----TCCKIGTGFSDESLQQLHER----LTPTIIDGPKATFVFDSSAEPDVWFEP--TTL 693
               + C +  G S E  ++++ R       T    P +   F S   P  W EP  + +
Sbjct: 534 KKVLSFCSVANGISHEEFKEINRRTRGHWKRTSDFSPPSILQFGSRI-PAEWIEPSDSIV 592

Query: 694 FEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQ 750
            E+ +  L  +   +     +A   +L      RIR DK   D T    + +LYE++
Sbjct: 593 LEIKSRSLDNT---ETSIRRYATSCTLYGGYCRRIRYDK---DWTDCYTLAQLYEDR 643

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 166/394 (42%), Gaps = 47/394 (11%)

Query: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNG 442
           ++  G    P LAK      E +       F  E K DGER Q+H ++ G+ ++  SR G
Sbjct: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317

Query: 443 ENMTERY-PEIK---ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498
            + +  Y  E+    I+ +++     ++ +LD E V++DK++  ILPF ++ +    ++ 
Sbjct: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377

Query: 499 LSDVK-----VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTD 553
            S+V       R     FD++  NG  L    L  R+E L ++   VP   +    I   
Sbjct: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437

Query: 554 NLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613
           +   ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 614 LXXXXXXXXXXXXXXXFLLGCYNQDT-------GEFE------------TCCKIGTGFSD 654
           +                + G    D+       G  E            + C +  G SD
Sbjct: 495 I------GRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSD 548

Query: 655 ESLQQLHERLTPTIID----GPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYK 708
           E  ++++ +   + +      P  + +   S  P  W +P  + + EV    +  S   +
Sbjct: 549 EEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---E 605

Query: 709 AGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQ 742
             S  +  G +L      RIR DK     TS  Q
Sbjct: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 125/259 (48%), Gaps = 14/259 (5%)

Query: 367 VINSCLEHGIMNLDKF-CTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 425
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 426 QVHLLDDGT-MRIYSRNGENMTERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQ 480
           Q+H ++ G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DKE+
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 481 GKILPFQVLSTRKRKDVELSDVKV-----RVCLFAFDVLCHNGERLINKSLRERRECLTK 535
             +LPF ++ +   +++  SD KV     R     FD++  NG  L    L  R+  L  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 536 VTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWL 595
           +   V    +  + +     + ++  L+ ++    EG+++K    P   YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSP---YEIGARNDSWI 490

Query: 596 KLKKDYLEGVGDSLDLCVL 614
           K+K +Y E +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 124/268 (46%), Gaps = 11/268 (4%)

Query: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETF 414
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 415 TSEYKYDGERAQVHLLDDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLDATKNLIL 469
             E K DGER Q+H  D G  +   SR G + T  Y E IK   ++ ++   +  +N +L
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353

Query: 470 DCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK---VRVCLFAFDVLCHNGERLINKSL 526
           D E V +DKE+  +LPF ++ +  R  +    V     R  L  FD++  NG  L+N  L
Sbjct: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413

Query: 527 RERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYE 586
            +R+  L K+        +        +   ++  L+ +++   EG+++K      S Y 
Sbjct: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470

Query: 587 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
            + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 471 VASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 388 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNGENM 445
           G    P LAK  + + +++  + + + F  E K DGER Q+H +D G  ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 446 TERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV---E 498
           T  Y E      I  +++     K  +LD E V +D++Q  +LPF ++ +     +   E
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 499 LSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDEL 558
           +S       L  FD++  NG  L+   L +R++ L  V +      Q        N + +
Sbjct: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429

Query: 559 QKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           +K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 430 RKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 114/224 (50%), Gaps = 12/224 (5%)

Query: 399 TKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNGENMTERYPEIK---- 453
           T + + +  R + + F  E K DGER Q+H ++ G  ++  SR G + +  Y + +    
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 454 ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK---VRVCLFA 510
           I  ++      K  ILD E V +D  +  ILPF ++ +   + + +SD++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 511 FDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSC 570
           FD++  NG  L    L +R+  L K+    P   +    +  ++   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 571 EGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614
           EG+++K  +   S Y  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>KNAG0E02810 Chr5 (564828..566978) [2151 bp, 716 aa] {ON} Anc_6.4
           YPL269W
          Length = 716

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 20/141 (14%)

Query: 454 ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDV 513
           I+D + + + T +L        WD    + +  Q++   K+ D  LS V   + +   + 
Sbjct: 52  ISDILSNSELTDDL------TQWDVSLPRQILQQLVDDLKKVDPTLSHV---LDILELEQ 102

Query: 514 LCHNGERLINKSLRERRECLT----------KVTKVVPGEFQYATQIVTDNLDELQKFLD 563
              N +  +++++    EC T          K  K+V G F   T+IV DN+  LQK LD
Sbjct: 103 NTANSDITLSETVDLIEECTTMAHRNLDSNLKELKIVSGVFLEFTEIVNDNMTTLQKILD 162

Query: 564 ESVNQSCEGLMVKMLEGPESH 584
           E++ Q  E +  K  E P  H
Sbjct: 163 ENIEQLFE-IQEKRFESPVRH 182

>Skud_10.33 Chr10 (58265..58636) [372 bp, 123 aa] {ON} YJL184W
           (REAL)
          Length = 123

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 259 LTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLE---SKLRIGLA 315
           L  G++ ++  S  K     SQL  +  ++  LT  Q    +FL R +E   +K + G  
Sbjct: 42  LNAGQIDRDKPSDPKYTADGSQLTYLSQLRTQLTGLQDDINEFLTRRMELAKNKKKAGAE 101

Query: 316 EKTVLISLSKALLLHGGNGE 335
           EK +   +++  LL GG+GE
Sbjct: 102 EKRIQEEINQ--LLDGGDGE 119

>KNAG0A07190 Chr1 complement(1129595..1131064) [1470 bp, 489 aa]
           {ON} Anc_2.571 YKL047W
          Length = 489

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 26/39 (66%)

Query: 344 MDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKF 382
           + +L++  ++IR    ++  YE+++N+ L  GI NLD+F
Sbjct: 308 LKILDNKGKQIRATPYELELYELMLNTVLREGITNLDRF 346

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,240,117
Number of extensions: 2926136
Number of successful extensions: 9078
Number of sequences better than 10.0: 41
Number of HSP's gapped: 9175
Number of HSP's successfully gapped: 42
Length of query: 755
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 638
Effective length of database: 40,065,477
Effective search space: 25561774326
Effective search space used: 25561774326
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)