Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.807.348ON20618810031e-140
YDL166C (FAP7)7.348ON1971879351e-130
Skud_4.917.348ON1941859291e-129
Smik_4.727.348ON1971879231e-128
NCAS0A141407.348ON2241837561e-102
NDAI0A019107.348ON2141837521e-101
KAFR0B008607.348ON2281847501e-101
Ecym_47257.348ON2341847491e-101
Kpol_530.337.348ON1951887411e-100
SAKL0F11330g7.348ON2081847411e-100
TDEL0C020007.348ON2131827312e-98
Kwal_56.246357.348ON2261867141e-95
TPHA0F029507.348ON2161807103e-95
KLLA0D12386g7.348ON2111867077e-95
KLTH0H01298g7.348ON2141827061e-94
KNAG0C037707.348ON2231877026e-94
TBLA0E005207.348ON2091827007e-94
ACL150W7.348ON2191846871e-91
CAGL0I03366g7.348ON2121876808e-91
ZYRO0F11660g7.348ON1981826641e-88
Smik_15.623.103ON32329770.19
Suva_15.713.103ON32329730.54
YOL094C (RFC4)3.103ON32329730.55
Skud_15.593.103ON32329720.61
TDEL0D052103.103ON32229720.69
KLTH0C09900g3.103ON32229720.73
KNAG0K007403.103ON31928710.84
Kwal_56.226333.103ON32229710.85
KAFR0C013803.103ON32129710.88
KAFR0C037902.667ON202145701.0
NDAI0C001402.667ON212139701.1
Kpol_1066.383.69ON33632701.1
NDAI0E025908.590ON685101711.2
TDEL0E007803.69ON33689701.3
AEL196W3.69ON33332701.4
Kpol_1053.343.103ON32129701.4
KLLA0E13201g3.69ON32932701.4
Suva_14.493.69ON34089701.4
Skud_14.473.69ON34089691.5
NCAS0A098903.69ON33689691.5
YNL290W (RFC3)3.69ON34089691.5
SAKL0C09812g3.103ON31929691.6
TBLA0E035203.103ON32429691.6
NDAI0G051503.103ON32129691.6
TPHA0A007103.103ON32529691.6
NDAI0A060603.69ON33889691.7
KLLA0C03718g3.103ON32029691.8
ZYRO0B06248g3.103ON32129691.8
Smik_14.413.69ON34089691.9
CAGL0I07645g3.103ON32229682.0
TBLA0B084503.69ON33332682.0
SAKL0C12144g3.69ON32932682.1
TPHA0P012003.69ON33589682.1
NCAS0C018708.590ON60092692.1
ADR111W3.103ON32129682.4
KAFR0A082903.69ON33232682.4
Kpol_1033.248.295ON491523692.5
KLLA0E08053g2.667ON302139672.8
TBLA0C004808.101ON36072673.1
CAGL0M03575g3.69ON33189673.4
Ecym_7160na 1ON271162663.6
KAFR0A039308.690ON44535673.6
Ecym_27923.103ON31929663.8
TPHA0N018902.667ON303138647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.80
         (206 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   390   e-140
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   364   e-130
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   362   e-129
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   360   e-128
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   295   e-102
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   294   e-101
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   293   e-101
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   293   e-101
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   290   e-100
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   290   e-100
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   286   2e-98
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   279   1e-95
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   278   3e-95
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   276   7e-95
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   276   1e-94
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   275   6e-94
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   274   7e-94
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   269   1e-91
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   266   8e-91
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   260   1e-88
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    34   0.19 
Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON...    33   0.54 
YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}  ...    33   0.55 
Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON...    32   0.61 
TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.10...    32   0.69 
KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa] {O...    32   0.73 
KNAG0K00740 Chr11 complement(134107..135066) [960 bp, 319 aa] {O...    32   0.84 
Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C...    32   0.85 
KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.10...    32   0.88 
KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON...    32   1.0  
NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON} ...    32   1.1  
Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa] {O...    32   1.1  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    32   1.2  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    32   1.3  
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    32   1.4  
Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp...    32   1.4  
KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highl...    32   1.4  
Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W (...    32   1.4  
Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W (...    31   1.5  
NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa] ...    31   1.5  
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    31   1.5  
SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa] {O...    31   1.6  
TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.10...    31   1.6  
NDAI0G05150 Chr7 (1249652..1250617) [966 bp, 321 aa] {ON} Anc_3....    31   1.6  
TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON...    31   1.6  
NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa] ...    31   1.7  
KLLA0C03718g Chr3 complement(339645..340607) [963 bp, 320 aa] {O...    31   1.8  
ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly ...    31   1.8  
Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W (...    31   1.9  
CAGL0I07645g Chr9 complement(736131..737099) [969 bp, 322 aa] {O...    31   2.0  
TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa] ...    31   2.0  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    31   2.1  
TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa] {...    31   2.1  
NCAS0C01870 Chr3 complement(344877..346679) [1803 bp, 600 aa] {O...    31   2.1  
ADR111W Chr4 (902185..903150) [966 bp, 321 aa] {ON} Syntenic hom...    31   2.4  
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    31   2.4  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    31   2.5  
KLLA0E08053g Chr5 complement(724562..725470) [909 bp, 302 aa] {O...    30   2.8  
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    30   3.1  
CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {...    30   3.4  
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...    30   3.6  
KAFR0A03930 Chr1 complement(799308..800645) [1338 bp, 445 aa] {O...    30   3.6  
Ecym_2792 Chr2 complement(1538111..1539070) [960 bp, 319 aa] {ON...    30   3.8  
TPHA0N01890 Chr14 (401294..401591,401593..402206) [912 bp, 303 a...    29   7.8  

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  390 bits (1003), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NEYQGGRS 188
           NEYQGGRS
Sbjct: 181 NEYQGGRS 188

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  364 bits (935), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 182/187 (97%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           ME+RRYGPNIIVTGTPGCGKSSTCE LK++LK YKYYNISDFAKDNDCFEGYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+RQGNSI+DWHVNDVFPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQSDTK+D+VSNV+RI+AWEKMWLEQHP+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NEYQGGR 187
           NEYQG R
Sbjct: 181 NEYQGPR 187

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  362 bits (929), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 172/185 (92%), Positives = 178/185 (96%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           ME RR+GPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFE YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+RQGNSIIDWHVNDVFPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAVDSYEPHIVVELQ DTK+D+VSNVARI+AWEKMWLEQH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NEYQG 185
           NEYQG
Sbjct: 181 NEYQG 185

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/187 (90%), Positives = 180/187 (96%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           MESRRYGPNIIVTGTPGCGKSS CELLK++LK YKYYNISDFAKD+DCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+RQGNSI+DWHVND+FPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQSDTK+D+ SNV+RII WEKMWLEQHPEGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NEYQGGR 187
           NEYQG R
Sbjct: 181 NEYQGSR 187

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  295 bits (756), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/183 (74%), Positives = 160/183 (87%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61
           +SRRY PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC++GYD+GRKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121
           DEDKLLD LEPL+RQG SIIDWHVNDVFPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181
           EEN+DAEIMGVV QDA++SY   IVVELQSDT + + +NV RI+ W+KMWLEQH +GVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 EYQ 184
           E +
Sbjct: 183 ELE 185

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 158/183 (86%)

Query: 3   SRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62
           SRRY PN+++TGTPG GKS+TCELL+  L  Y YYNISDFAK+NDC+EGYD+GRKSHIVD
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  EDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKIE 122
           EDKLLD LEPL+R+G SI+DWHVND+FPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTNE 182
           ENLDAEIMGVV QDAV+SY+  IVVELQSD  + + +NV RI+ W KMW++QH  GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 YQG 185
            QG
Sbjct: 186 LQG 188

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  293 bits (750), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (86%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61
           ESRRY PN++VTGTPGCGKS+TCELL   L  Y Y+NIS+FA+ + C++GYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121
           D+DKLLD LEPL+R+G SIIDWHVNDVFPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181
           +ENLDAEIMGVV QDA+DSYE  IVVELQS++ +++ +NV RI+AW++MWL QH  GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 EYQG 185
           EYQG
Sbjct: 187 EYQG 190

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  293 bits (749), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (84%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M+S R  PNIIVTGTPGCGK++TCELL+  L   +YYNISDFAK++DC+EGYDEGRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R+G +IIDWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA+DSY   IVVELQS+T   +  NV RI+AWE  W+ QHP GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEYQ 184
           NE Q
Sbjct: 195 NELQ 198

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  290 bits (741), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/188 (72%), Positives = 160/188 (85%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M SRR  PN+++TGTPGCGKS++CELL+  L  YKYYNISDFAK++DC+EGYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           I+ENLDAEIMGVV QDA +SY   IVVELQSDT + + +NV RI+ W ++WL+QH +GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NEYQGGRS 188
           NE + G S
Sbjct: 181 NELEEGVS 188

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  290 bits (741), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 156/184 (84%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           ME++R  PNI+VTGTPGCGKS+TCELL   L  Y YYNISDFA+++ C++GYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVV QDA +SY   IVVELQSDT + + +NV RI+ W++MWL QHP GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEYQ 184
           NE +
Sbjct: 181 NELE 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  286 bits (731), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 131/182 (71%), Positives = 158/182 (86%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           ME RR+ PN+++TGTPGCGKS+TCELL+  L  YKYYNISDFAK++DC +GYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R+G +I+DWHVNDVFPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           I+ENLDAEIMGVV QDA DSYE  IVVELQSD+ + + +NV RI++WEK+WL+QH +G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  279 bits (714), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M S R  PNI+VTGTPGCGK+STCELL+  L+G KYYNISDFAK+  C++GYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R G +I+DWHVNDVFPERLIDLVVVLR DNS L+ RL  RGYH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV  DA DSY   IVVELQSDT + +  NV RI+ W   W EQHPEGVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEYQGG 186
           NE  G 
Sbjct: 181 NELNGA 186

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  278 bits (710), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 154/180 (85%)

Query: 3   SRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIVD 62
           SRRY PN+++TGTPGCGKS+TCELL+  L  Y YYNISDFAK+++C++G+DEGRKSHIVD
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  EDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKIE 122
           EDKLLD LEPL+R+G  I+DWHVNDVFPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTNE 182
           EN+DAEIMGVV QDA +SY   IVVELQSDT + +  NV +I+ W ++W++QH  GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  276 bits (707), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 156/186 (83%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           ME  R+ PNIIV+GTPGCGKS+TCELL   L  Y YYNISDFAK++DC++GYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VD+DKLLD LEPL+R+G  IIDWHVNDVFPERL+DLVVVLRCDN  LY RL+ RGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA DSY   IVVELQSDT +++  NV RIIAW+++WL+QH +GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NEYQGG 186
           NE   G
Sbjct: 181 NELDDG 186

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  276 bits (706), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (83%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M S R+ PNI+VTGTPGCGK+STCELL+  LK   YYNISDFA+ ++C++GYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDED+LLD LEPLMR+G +I+DWHVND+FPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV QDA DSYE  IVVELQSDT   +  NV RI +W   WLEQ+P+GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  275 bits (702), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 129/187 (68%), Positives = 148/187 (79%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61
           ESRR  PNI+VTGTPG GKS+TCELL   L  Y YYNISDFA  N C++GYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121
           DEDKLLD LEPL+  G +IIDWHVNDVFPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181
           +EN+DAEIMGVV QDA+DSYE  IVVELQSD  + + +NV R++ W  MW EQHPEGVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 EYQGGRS 188
           E    ++
Sbjct: 183 ELSAHQA 189

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  274 bits (700), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 158/182 (86%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M+SRRY PN++++GTPG GKSSTCELLK EL+ YKY NISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEP++R+G++I+DWHVNDVFPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           ++ENLDAEIMGVV QDA+DSY   IV+ELQS+  +++ SNV RI++W ++W +QH +GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  269 bits (687), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 123/184 (66%), Positives = 152/184 (82%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M+  R  PNI+V+GTPGCGKS+TCELL+  L  Y+Y+NISDFA++++C++GYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDED+LLD LEPL+R+G +I+DWHVND+FPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA+DSY   IVVELQSD  + +  NV RI AWE  W+ +HP+GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEYQ 184
           N  Q
Sbjct: 181 NALQ 184

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  266 bits (680), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 136/187 (72%), Positives = 160/187 (85%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           M SRR+ PNIIVTGTPGCGKS+TCELL+  L GYKYYNIS+FA+++ C++GYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+ +G SIIDWHVNDVFPERLIDLVVVLR +N KLY RL ARGYHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           IEENLDAEIMGVV QDA +SYEP IVVELQS+T +D+ +NV RI  W   W+E+H +GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NEYQGGR 187
           +E + G+
Sbjct: 181 SELKDGK 187

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  260 bits (664), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 156/182 (85%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60
           MESRRY PN+++TGTPG GKS+T ELL+  L  ++YYNISDFA++NDCF+GYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+R+G +IIDWHVNDVFPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV QDA+DSYE  IVVEL SD+ + + +NV RI++W ++W +QH  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G+ Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY 71

>Suva_15.71 Chr15 complement(114865..115836) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGSSY 71

>YOL094C Chr15 complement(141584..142555) [972 bp, 323 aa] {ON}
          RFC4Subunit of heteropentameric Replication factor C
          (RF-C), which is a DNA binding protein and ATPase that
          acts as a clamp loader of the proliferating cell
          nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 323

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGRSY 71

>Skud_15.59 Chr15 complement(100958..101929) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGNSY 71

>TDEL0D05210 Chr4 (945843..946811) [969 bp, 322 aa] {ON} Anc_3.103
          YOL094C
          Length = 322

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 45 PHMIISGLPGIGKTTSVHCLAHELLGKSY 73

>KLTH0C09900g Chr3 complement(818369..819337) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 322

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHLIISGLPGIGKTTSVSCLAHELLGNAY 72

>KNAG0K00740 Chr11 complement(134107..135066) [960 bp, 319 aa]
          {ON} Anc_3.103 YOL094C
          Length = 319

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYK 35
          P++I++G PG GK+++ + L +E+ G K
Sbjct: 41 PHMIISGLPGIGKTTSIQCLANEMLGEK 68

>Kwal_56.22633 s56 (212413..213381) [969 bp, 322 aa] {ON} YOL094C
          (RFC4) - Subunit 4 of Replication Factor C; homologous
          to human RFC 40 kDa subunit [contig 184] FULL
          Length = 322

 Score = 32.0 bits (71), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHLIISGLPGIGKTTSISCLAHELLGNAY 72

>KAFR0C01380 Chr3 (284264..285229) [966 bp, 321 aa] {ON} Anc_3.103
          YOL094C
          Length = 321

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHMIISGLPGIGKTTSVHCLAHELLGSHY 72

>KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON}
           Anc_2.667 YKL024C possible ribosomal frameshifting
          Length = 202

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 35/145 (24%)

Query: 10  IIVTGTPGCGKSSTC-ELLKDELKGYKYYNISDFAKDNDCFEGYDEG-------RKSHIV 61
           I V G PG GK + C +L+KD   G+ + +  D  +     EG + G       ++  IV
Sbjct: 15  IFVLGGPGAGKGTQCAKLVKD--YGFVHLSAGDLLRAEQDREGSEFGSLIKNYIKEGLIV 72

Query: 62  DEDKLLDTLEPLMRQGNSIID-------WHVNDVFPERL------------IDLVVVLRC 102
            ++  +  L+      N+I++        ++ D FP ++               V+   C
Sbjct: 73  PQEITIQLLK------NAILENYEKGSTKYLVDGFPRKMDQAITFEQVIVKAKFVLFFDC 126

Query: 103 DNSKLYSRLHARGYHDSKIEENLDA 127
             + +  RL  RG    +I++N+++
Sbjct: 127 SETVMLERLLERGKSSGRIDDNIES 151

>NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON}
           Anc_2.667 YKL024C
          Length = 212

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 55/139 (39%), Gaps = 22/139 (15%)

Query: 10  IIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRK-SHIVDEDKLLD 68
           I V G PG GK + C  L ++  G+ + +  D  +     EG + G    H + E  ++ 
Sbjct: 23  IFVLGGPGAGKGTQCAKLVEDY-GFVHLSAGDLLRAEQAREGSEYGTLIKHYIKEGLIVP 81

Query: 69  TLEPLMRQGNSIIDWHVN--------DVFPERL------------IDLVVVLRCDNSKLY 108
               L    N+I + + N        D FP ++                +   C  + + 
Sbjct: 82  QEITLALLKNAIQEHYNNKGAKNFLIDGFPRKMDQAISFEEQIAPSKFTLFFDCPENVML 141

Query: 109 SRLHARGYHDSKIEENLDA 127
            RL  RG    ++++N+++
Sbjct: 142 ERLLERGKTSGRVDDNIES 160

>Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa]
          {ON} complement(64176..65186) [1011 nt, 337 aa]
          Length = 336

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y+N+
Sbjct: 46 PHLLFYGPPGTGKTSTIIALAKEIYGKNYHNM 77

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 77  GNSIIDWHVNDV-FPE--RLIDLVVVLRCDNSKLYSRLHARGYHDSKIEENLDAEIMGVV 133
           G  I  W +  V  PE    + + VVLRCD S L+    A   HD K++E +       +
Sbjct: 456 GADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQEVVP------L 509

Query: 134 KQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQ 174
             DA +  EP    E+    K+D ++ VA   A +   L +
Sbjct: 510 PADAPEDAEPEF-REVTKTVKKDSLTVVAHTFALDDKTLNE 549

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
           YNL290W
          Length = 336

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 45  PHLLFYGPPGTGKTSTVVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 104

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 105 F---SKGFKLIILDEADAMTNAAQNALRR 130

>AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL290W (RFC3)
          Length = 333

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y N+
Sbjct: 45 PHLLFYGPPGTGKTSTICALAKEIYGKNYRNM 76

>Kpol_1053.34 s1053 complement(54419..55063,55065..55385) [966 bp,
          321 aa] {ON} complement(54419..55063,55065..55385) [966
          nt, 322 aa]
          Length = 321

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHMIISGMPGIGKTTSIHCLAHELLGDSY 72

>KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highly
          similar to uniprot|P38629 YNL290W Saccharomyces
          cerevisiae RFC3 Subunit of heteropentameric Replication
          factor C (RF-C)
          Length = 329

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGSNYRNM 73

>Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 47  PHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 106

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 107 F---SKGFKLIILDEADAMTNAAQNALRR 132

>Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 47  PHLLFYGPPGTGKTSTIVALAREIYGRNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 106

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 107 F---SKGFKLIILDEADAMTNAAQNALRR 132

>NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa]
           {ON} Anc_3.69
          Length = 336

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 47  PHLLFYGPPGTGKTSTIVALAREIYGRNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 106

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 107 F---SKGFKLIILDEADAMTNAAQNALRR 132

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit of
           heteropentameric Replication factor C (RF-C), which is a
           DNA binding protein and ATPase that acts as a clamp
           loader of the proliferating cell nuclear antigen (PCNA)
           processivity factor for DNA polymerases delta and
           epsilon
          Length = 340

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 47  PHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 106

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 107 F---SKGFKLIILDEADAMTNAAQNALRR 132

>SAKL0C09812g Chr3 complement(887754..888713) [960 bp, 319 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 319

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 43 PHMIISGLPGIGKTTSIHCLAHELLGDSY 71

>TBLA0E03520 Chr5 (873305..874279) [975 bp, 324 aa] {ON} Anc_3.103
          YOL094C
          Length = 324

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 46 PHMIISGMPGIGKTTSIHCLAHELLGDSY 74

>NDAI0G05150 Chr7 (1249652..1250617) [966 bp, 321 aa] {ON}
          Anc_3.103
          Length = 321

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHMIISGLPGIGKTTSIHCLAHELLGDAY 72

>TPHA0A00710 Chr1 complement(129039..130016) [978 bp, 325 aa] {ON}
          Anc_3.103 YOL094C
          Length = 325

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHMIISGLPGIGKTTSIHCLAHELLGDSY 72

>NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa]
           {ON} Anc_3.69
          Length = 338

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 48  PHLLFYGPPGTGKTSTIVALAREIFGKNYSNMVLELNASDDRGIEVVRNQIKDFASTRQI 107

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 108 FS---KGFKLIILDEADAMTNAAQNALRR 133

>KLLA0C03718g Chr3 complement(339645..340607) [963 bp, 320 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094C RFC4 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 320

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 43 PHMIISGLPGIGKTTSIHCLAHELLGDAY 71

>ZYRO0B06248g Chr2 (502255..503220) [966 bp, 321 aa] {ON} highly
          similar to uniprot|P40339 Saccharomyces cerevisiae
          YOL094C RFC4 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 321

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHLIISGLPGIGKTTSIHCLAHELLGDSY 72

>Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W
           (REAL)
          Length = 340

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 47  PHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 106

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 107 F---SKGFKLIILDEADAMTNAAQNALRR 132

>CAGL0I07645g Chr9 complement(736131..737099) [969 bp, 322 aa]
          {ON} highly similar to uniprot|P40339 Saccharomyces
          cerevisiae YOL094c RFC4 DNA replication factor C
          Length = 322

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  E+ G  Y
Sbjct: 44 PHMIISGLPGIGKTTSIHCLAHEMLGESY 72

>TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa]
          {ON} Anc_3.69 YNL290W
          Length = 333

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y N+
Sbjct: 45 PHLLFYGPPGTGKTSTIVALAREIYGNNYSNM 76

>SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290W RFC3 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 329

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGKNYKNM 73

>TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa] {ON}
           Anc_3.69 YNL290W
          Length = 335

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  E+ G  Y N                   I DFA     
Sbjct: 45  PHLLFYGPPGTGKTSTIIALAKEIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 104

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 105 F---SKGFKLIILDEADAMTNAAQNALRR 130

>NCAS0C01870 Chr3 complement(344877..346679) [1803 bp, 600 aa] {ON}
           Anc_8.590
          Length = 600

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 80  IIDWHVNDV-FPE--RLIDLVVVLRCDNSKLYSRLHARGYHDSKIEENLDAEIMGVVKQD 136
           I  W +  +  PE    + + VVLRCD S L++   A    D K++E +       + +D
Sbjct: 459 IAKWEITGLQVPEGAESVPVKVVLRCDPSGLHTIEEAYTVEDIKVQEVVP------LPED 512

Query: 137 AVDSYEPHIVVELQSDTKQDIVSNVARIIAWE 168
           A +  EP    E+    K+D ++ VA   A E
Sbjct: 513 APEDAEPEF-REVTKTVKKDALTIVAHTFALE 543

>ADR111W Chr4 (902185..903150) [966 bp, 321 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YOL094C (RFC4)
          Length = 321

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   L  EL G  Y
Sbjct: 44 PHMIISGLPGIGKTTSIHCLAHELLGDAY 72

>KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa]
          {ON} Anc_3.69 YNL290W
          Length = 332

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKYYNI 39
          P+++  G PG GK+ST   L  E+ G  Y N+
Sbjct: 44 PHLLFYGPPGTGKTSTIIALAREIYGKNYSNM 75

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 17/23 (73%)

Query: 10   IIVTGTPGCGKSSTCELLKDELK 32
            I++ G  GCGK++ C++L + LK
Sbjct: 1362 ILLVGETGCGKTTVCQILAEHLK 1384

>KLLA0E08053g Chr5 complement(724562..725470) [909 bp, 302 aa] {ON}
           highly similar to uniprot|P15700 Saccharomyces
           cerevisiae YKL024C URA6
          Length = 302

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 56/139 (40%), Gaps = 23/139 (16%)

Query: 10  IIVTGTPGCGKSSTC-ELLKDELKGYKYYNISDFAKDNDCFEGYDEG-------RKSHIV 61
           + V G PG GK + C +L+KD   G+ + +  D  +     EG   G       +   IV
Sbjct: 115 VFVLGGPGAGKGTQCAKLVKDF--GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIV 172

Query: 62  DEDKLLDTLE-PLMRQGNSIIDWHVNDVFPERL------------IDLVVVLRCDNSKLY 108
            ++  +  L+  +    NS     + D FP ++              + +   C    + 
Sbjct: 173 PQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIML 232

Query: 109 SRLHARGYHDSKIEENLDA 127
            RL  RG    +I++N+++
Sbjct: 233 ERLLQRGKTSGRIDDNIES 251

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 15/72 (20%)

Query: 6  YGPNIIVTGTPGCGKSSTCELLKDEL-KGYKYY-------------NISDFAKDNDCFEG 51
          Y  NII+ G PG GKS+  E L   L K +K +             N+ D  + N+  EG
Sbjct: 23 YTINIIIVGPPGSGKSTIAEKLSANLNKKFKEFIQNKVIASIGLDTNV-DINRSNELIEG 81

Query: 52 YDEGRKSHIVDE 63
          Y       I DE
Sbjct: 82 YYTSGIPDISDE 93

>CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {ON}
           highly similar to uniprot|P38629 Saccharomyces
           cerevisiae YNL290w RFC3
          Length = 331

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 23/89 (25%)

Query: 8   PNIIVTGTPGCGKSSTCELLKDELKGYKYYN-------------------ISDFAKDNDC 48
           P+++  G PG GK+ST   L  ++ G  Y N                   I DFA     
Sbjct: 43  PHLLFYGPPGTGKTSTIVALAKDIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI 102

Query: 49  FEGYDEGRKSHIVDE-DKLLDTLEPLMRQ 76
           F    +G K  I+DE D + +  +  +R+
Sbjct: 103 F---SKGFKLIILDEADAMTNAAQNALRR 128

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 74/162 (45%), Gaps = 25/162 (15%)

Query: 20  KSSTCELLKDELK-GYKYYNISDF-AKDNDCFEGY--------DEGRKSHIVDEDKLLDT 69
           K++T +++   LK GY++++ + F   + +  EG            R+  +    KL ++
Sbjct: 26  KNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWLAEDPSSNRRQDVFYVTKLWNS 85

Query: 70  LEPLMRQGNSIIDWHVNDVFPERLIDLVVV--LRCDNSKLYSRLHARGYHDSKIEENLDA 127
            +    +  + I   +  V P   IDL+++    C ++K  +   A       ++E++DA
Sbjct: 86  -QNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKRLATYEA-------MQESVDA 137

Query: 128 EIMGVVKQDAVDSYEPHIVVELQS--DTKQDIVSNVARIIAW 167
              G+VK   V +YE H + EL +  + K + V N   +  W
Sbjct: 138 ---GIVKSIGVSNYERHHLQELYAMPNLKHNPVVNQIEVTPW 176

>KAFR0A03930 Chr1 complement(799308..800645) [1338 bp, 445 aa] {ON}
           Anc_8.690 YOR250C
          Length = 445

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 3   SRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYY 37
           S  YGP +++ G    GK+S C +L      +K Y
Sbjct: 117 SSFYGPKVLIIGERNSGKTSLCRILSSYTIKFKSY 151

>Ecym_2792 Chr2 complement(1538111..1539070) [960 bp, 319 aa] {ON}
          similar to Ashbya gossypii ADR111W
          Length = 319

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 8  PNIIVTGTPGCGKSSTCELLKDELKGYKY 36
          P++I++G PG GK+++   +  EL G  Y
Sbjct: 43 PHMIISGLPGIGKTTSIHCIAHELLGDSY 71

>TPHA0N01890 Chr14 (401294..401591,401593..402206) [912 bp, 303 aa]
           {ON} Anc_2.667 YKL024C ribosomal frameshifting
          Length = 303

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 21/138 (15%)

Query: 10  IIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEG-------RKSHIVD 62
           I V G PG GK + C  L D   G+ + +  D  +     +G + G        +  IV 
Sbjct: 115 IFVLGGPGVGKGTQCAKLVDRY-GFVHLSAGDLLRAEQNRDGSEFGPLIKQCITEGLIVP 173

Query: 63  EDKLLDTLEPLMR------QGNSIIDWHVNDV-----FPERLI--DLVVVLRCDNSKLYS 109
           ++  +  L+  ++      + N ++D     +     F E L+     +   C  + +  
Sbjct: 174 QEVTVALLKNAIQANLDNGKSNFLVDGFPRKMDQAITFEESLVPSKFTLFFTCSEAVMLE 233

Query: 110 RLHARGYHDSKIEENLDA 127
           RL  RG    +I++N+++
Sbjct: 234 RLLERGKTSGRIDDNIES 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,529,262
Number of extensions: 1041079
Number of successful extensions: 3793
Number of sequences better than 10.0: 80
Number of HSP's gapped: 3838
Number of HSP's successfully gapped: 80
Length of query: 206
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 102
Effective length of database: 41,556,135
Effective search space: 4238725770
Effective search space used: 4238725770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)