Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.797.349ON70849023340.0
Skud_4.907.349ON70749119610.0
YDL167C (NRP1)7.349ON71948618800.0
Smik_4.717.349ON75948618560.0
TDEL0C019907.349ON60639113471e-178
ZYRO0F11682g7.349ON59739013381e-177
Kwal_56.246387.349ON52739012551e-165
SAKL0F11352g7.349ON58338712491e-164
KLTH0H01276g7.349ON55743012081e-158
NCAS0A141507.349ON57039111851e-154
KAFR0B008707.349ON54239911401e-148
ACL149W7.349ON62838511361e-146
Kpol_530.327.349ON68441210871e-138
TBLA0E020607.349ON56438310721e-137
KLLA0D12364g7.349ON63140210691e-136
KNAG0C037807.349ON53839310181e-130
TPHA0F029607.349ON65441610091e-127
NDAI0A019007.349ON5653849051e-112
CAGL0I03344g7.349ON6034076637e-77
KLLA0B08976g3.379ON30536840.14
Kwal_56.234868.229ON587147820.33
NCAS0G042801.408ON435126810.40
CAGL0D05236g7.188ON44335771.1
TDEL0A009402.52ON68231761.6
TBLA0F037808.229ON577149752.3
SAKL0H17952g8.229ON58950742.7
TBLA0B006002.52ON73431742.9
Kwal_23.45972.52ON66431743.2
KLTH0B07546g2.52ON63931733.4
Smik_4.162.52ON65036734.1
Ecym_13021.408ON28828706.8
KNAG0L015807.250ON30568706.9
TBLA0G006504.17ON423124699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.79
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   903   0.0  
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   759   0.0  
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   728   0.0  
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   719   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   523   e-178
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   520   e-177
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   488   e-165
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   485   e-164
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   469   e-158
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   461   e-154
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   443   e-148
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   442   e-146
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   423   e-138
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   417   e-137
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   416   e-136
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   396   e-130
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   393   e-127
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   353   e-112
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   259   7e-77
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    37   0.14 
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    36   0.33 
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     36   0.40 
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    34   1.1  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    34   1.6  
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    33   2.3  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    33   2.7  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    33   2.9  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    33   3.2  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    33   3.4  
Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON} Y...    33   4.1  
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    32   6.8  
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    32   6.9  
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    31   9.4  

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/490 (91%), Positives = 449/490 (91%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180
           RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN
Sbjct: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180

Query: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240
           HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ
Sbjct: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240

Query: 241 SELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 300
           SELESWFTQYGARPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEA
Sbjct: 241 SELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360
           TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 361 NCPSCGFSNFQRRTACFRCSFPAPSNSQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 420
           NCPSCGFSNFQRRTACFRCSFPAPSNSQMH                             I
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPSNSQMHNAITNNNANSNKSSLNNRANSGALNNNNNI 420

Query: 421 TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFAT 480
           TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFAT
Sbjct: 421 TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFAT 480

Query: 481 SNNAVPNYRY 490
           SNNAVPNYRY
Sbjct: 481 SNNAVPNYRY 490

 Score =  223 bits (569), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 111/148 (75%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAXXXXXXXXXXX 620
           PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIA           
Sbjct: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAPGPHNHNNNSN 620

Query: 621 XXXXXXXXXXXXXXXXXXXXXXXXXXVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY 680
                                     VHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY
Sbjct: 621 NNSTVTNTNNNGGNNGNNGVDGKDNKVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY 680

Query: 681 KSDKANVNFSNGNDSTAFGNGFNGSARW 708
           KSDKANVNFSNGNDSTAFGNGFNGSARW
Sbjct: 681 KSDKANVNFSNGNDSTAFGNGFNGSARW 708

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQM 389
           R GDW C +C + NF +   C RC  P   N+ +
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           R GDW C +C + NF +   C RC  P   N+ +
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQM 389

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/491 (75%), Positives = 400/491 (81%), Gaps = 1/491 (0%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLELQVA+LPDSPKDQCRI ++AYQIVDAETL  HY+  S P I+VDGE KSLESA
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           M QLDKDI  +IGND+FVLVSLCSTWHIRVTL RQARDDGFILTSYLQHPRLFDLWKEF+
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSS-SIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           RWC+NHPE++  RK   NNNSNTK+  S G L KNTKD NEM+RILE+    E  DF  +
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239
             SLL+RT D+LLQLHKKCSS EDMKSVLTQPYDS+TDIR+FLQERSKVLYMNNLPPDTT
Sbjct: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240

Query: 240 QSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 299
           QSELESWFTQYG RPVGFWTVKNIVEDT            PYVE+QDSISGFVVFQTHEE
Sbjct: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEE 300

Query: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360

Query: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 419
           WNCPSCGFSNFQRRTACFRCSFPAPSN QMH                             
Sbjct: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHNVISNNNANSNSNILNNRMSSGSSNNNNS 420

Query: 420 ITVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFA 479
             V+HPY   E NMMG+ TPTALAYNR+QFSA+TPLSRQNSLNLTPSSSGSP+   + FA
Sbjct: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480

Query: 480 TSNNAVPNYRY 490
            +NN VPNYRY
Sbjct: 481 GTNNIVPNYRY 491

 Score =  166 bits (419), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 95/148 (64%), Gaps = 21/148 (14%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAXXXXXXXXXXX 620
           PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNAD +ETNHYI+  T+            
Sbjct: 581 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNGS 640

Query: 621 XXXXXXXXXXXXXXXXXXXXXXXXXXVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY 680
                                       DISLME+VS PLS+    +KEGDGN +SFNE+
Sbjct: 641 NRTDGKDNKG-----------------RDISLMEYVSPPLSI----VKEGDGNGSSFNEF 679

Query: 681 KSDKANVNFSNGNDSTAFGNGFNGSARW 708
           K DK N+++SNGNDS++F NGFNGS RW
Sbjct: 680 KGDKVNIDYSNGNDSSSFTNGFNGSVRW 707

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNS 387
           R GDW C +C + NF +   C RC  P   N+
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 614

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 593
           R GDW C +C + NF +   C RC  P   N
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/486 (72%), Positives = 391/486 (80%), Gaps = 1/486 (0%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLELQVAHLPD+PKDQCRI N+A+QIV+AETL  HY   S PSI+V+G  KSLESA
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           M QLDKDI  +IGNDDFVLVSL STWHIRVTLPRQARDDGFILTSYLQHP++FDLWKEF+
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180
           RWC+NHPEI+G +K I NNN NTKS SI    KNTKDL+E++RILE+    EE     + 
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAA-KNTKDLDEIVRILEVSIPTEEAGSVPEI 179

Query: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240
           +SLL+RT D+L+QLHKKC+S EDM+SVLT+PYDSHTDIR+FLQE+SK+LYMNNLPPDTTQ
Sbjct: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239

Query: 241 SELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 300
           SELESWFTQYG RPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEA
Sbjct: 240 SELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 299

Query: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360
           TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW
Sbjct: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359

Query: 361 NCPSCGFSNFQRRTACFRCSFPAPSNSQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 420
           NCPSCGFSNFQRRTACFRCSFPAPSNSQ+H                              
Sbjct: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIHTANSNNNVNSSRNNLNNRVNSGSSSNISNT 419

Query: 421 TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFAT 480
             +HPYG PE NM+ + TP AL YNR+ F A+TPLSRQNSLN+ PS+SGSP+   + F+ 
Sbjct: 420 AANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFSG 479

Query: 481 SNNAVP 486
           +NN  P
Sbjct: 480 NNNIAP 485

 Score =  179 bits (454), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 98/148 (66%), Gaps = 7/148 (4%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAXXXXXXXXXXX 620
           PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS++ D SETNHYID+ST             
Sbjct: 579 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNNI 638

Query: 621 XXXXXXXXXXXXXXXXXXXXXXXXXXVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY 680
                                       DISLMEF+S PLSMA KS+KEGDGN +SFNE+
Sbjct: 639 SVNTNGGSNAGRTDGNDNKG-------RDISLMEFMSPPLSMATKSMKEGDGNGSSFNEF 691

Query: 681 KSDKANVNFSNGNDSTAFGNGFNGSARW 708
           KSDKANVNFSN  D++AFGNGFN S RW
Sbjct: 692 KSDKANVNFSNVGDNSAFGNGFNSSIRW 719

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           R GDW C +C + NF +   C RC  P   N+ +
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQI 388

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/486 (72%), Positives = 390/486 (80%), Gaps = 1/486 (0%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLELQVAHLP+SPKDQCRIVN+AYQ VDAETLA HYEN S P+I+VD E +SLE+A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           M QLDK IQ I+GND+FVLVSL STWHIRVTLPRQARDDGFILTSYLQHP+LFDLWKEF+
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180
           RWC+NHPEI+   K   NNN++    + G L KN KDL+EM+RILEI ++ EE     + 
Sbjct: 121 RWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPEE 180

Query: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240
           +SLL+RT D+L+ LH+KC S+EDMK VLTQPYDSHTDIR+FLQERSKVLYMNNLPPDTTQ
Sbjct: 181 YSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTTQ 240

Query: 241 SELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 300
           SELESWFTQYG RPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEA
Sbjct: 241 SELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360
           TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 361 NCPSCGFSNFQRRTACFRCSFPAPSNSQMHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 420
           NCPSCGFSNFQRRTACFRCSFPAPSN Q H                              
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPSNIQTHVTSSNNVNNSWNNLNNRMNSGSSNNNNNA- 419

Query: 421 TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFAT 480
           +V+HPYGT E NM+ + TP+A  YNR+ +SA+TPLSRQNSLN+ PS+SGSP+   + F  
Sbjct: 420 SVNHPYGTSEYNMVANATPSAFTYNRAHYSAITPLSRQNSLNMVPSNSGSPIIIADHFGG 479

Query: 481 SNNAVP 486
           +NN VP
Sbjct: 480 NNNKVP 485

 Score =  170 bits (431), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 94/148 (63%), Gaps = 7/148 (4%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAXXXXXXXXXXX 620
           PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV+ D +ETNHYI+ ST+            
Sbjct: 619 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHYIEASTVV-------SASH 671

Query: 621 XXXXXXXXXXXXXXXXXXXXXXXXXXVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNEY 680
                                      HDISLMEFVS+PLSMA KS  EGDGN  SFNE+
Sbjct: 672 TPSNKNTVVNNNGGNNIDHTDGKDNKYHDISLMEFVSSPLSMAAKSTMEGDGNLTSFNEF 731

Query: 681 KSDKANVNFSNGNDSTAFGNGFNGSARW 708
           KS   NV+ SNG+DS AFGNGF+ S RW
Sbjct: 732 KSGNVNVSLSNGDDSNAFGNGFSRSVRW 759

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C +C + NF +   C RC  P
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 593
           R GDW C +C + NF +   C RC  P   N
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  523 bits (1347), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 305/391 (78%), Gaps = 19/391 (4%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKK-SLES 59
           MHYVVLE++  H  ++PKD  R+  ++YQ +DAE++ ++Y +   P I +D +   S + 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           ++ + D+D+  I+G D+FVL SL STWHIRVT+PRQARD+GF+L SYLQHPR+FDLWKE+
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           +RWC NHPE++ LRK            S  T IK  KD  E++++LE+  + EE    + 
Sbjct: 121 DRWCANHPEVLTLRK------------SCRTGIKRVKDQTEILKVLEM--STEE----IT 162

Query: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239
              +L  T+D+LLQL ++C++ ED+  VL++PYDSH DIR+FLQE+SKVLY+NNLPPDTT
Sbjct: 163 EKPVLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTT 222

Query: 240 QSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 299
           QSELESWFTQ+GARPVGFWTVKNIVE+T            PYVE+QDSISGFVVFQTHEE
Sbjct: 223 QSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEE 282

Query: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359
           ATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 283 ATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGD 342

Query: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQMH 390
           WNCPSCGFSNFQRRTACFRCSFPA S  Q++
Sbjct: 343 WNCPSCGFSNFQRRTACFRCSFPAASAVQVN 373

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 5/49 (10%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIA 609
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K     +S++N+  D +++A
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK---VSISDSNN--DDNSVA 519

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRC 379
           R GDW CP+C + NF +   C RC
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           R GDW C +C + NF +   C RC  P +    V
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQV 372

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  520 bits (1338), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/390 (63%), Positives = 302/390 (77%), Gaps = 21/390 (5%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSP-SIDVDGEKKSLES 59
           M+YVVLE++ AHL + PKDQCRI  ++YQ V+AETL  HY+   +P  I  + +  +L  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           A+  L+++I  I G++ FVL SL STWH+RVTL RQARD  F L SYLQHP++FDLWKE+
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           ERWC+NHPE+M LRKN             G   +  KD+ E+ R+L+I N +  +D + D
Sbjct: 121 ERWCVNHPEVMPLRKN-------------GG--RRMKDVAELARVLDI-NGLNFNDSSFD 164

Query: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239
               L R++++LL+LH++CS+ EDM  VLT PYDSH D+R+FLQE SKVLY+NNLPPDTT
Sbjct: 165 ----LSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTT 220

Query: 240 QSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 299
           QSELESWFTQ+GARPVGFWTVKNIVE+T            PYVE+QDSISGFVVFQTHEE
Sbjct: 221 QSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEE 280

Query: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359
           ATEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 281 ATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGD 340

Query: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQM 389
           WNCPSCGFSNFQRRTACFRCSFPA +  Q+
Sbjct: 341 WNCPSCGFSNFQRRTACFRCSFPATTAVQV 370

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 30/36 (83%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           PFRAGDWKC +C YHNFAKNVVCLRCGGPK    D+
Sbjct: 486 PFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDL 521

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW CPSC + NF +   C RC  P
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGP 514

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYI 603
           R GDW C +C + NF +   C RC  P +    V+ T  YI
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVN-TKQYI 376

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 238/390 (61%), Positives = 291/390 (74%), Gaps = 19/390 (4%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLE+ +AH  DSPKD  +I    YQ +D E L S ++      ++      SL+ A
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLE---NGCSLQEA 57

Query: 61  MGQLDKDI-QHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           + QL+KDI +H+   DDFVL SL STWH RVT+PRQARD+ FIL  +LQHPR+FDLWKE+
Sbjct: 58  VSQLEKDIGEHL--KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEY 115

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           +RWC+NHPE + LR+          S+S+G   K  KD+ E+  +LE+ +  ++      
Sbjct: 116 DRWCVNHPETLALRR----------SNSMG---KKVKDVAELRSVLELDSATQDSTPGAA 162

Query: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239
               L++TI ++ QLHKKC +AED   VLT PYDS+ D+R+FLQERSKVLYMNNLPPDTT
Sbjct: 163 EPDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTT 222

Query: 240 QSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 299
           QSELESWFTQ+GARPVGFWTVKNIVE+T             YVE QDSISGFVVFQ+HEE
Sbjct: 223 QSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEE 282

Query: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359
           ATE L+LNGRSILSN+ANTKQPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGD
Sbjct: 283 ATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGD 342

Query: 360 WNCPSCGFSNFQRRTACFRCSFPAPSNSQM 389
           WNCPSCGFSNFQRRT+CFRCSFP+  ++ M
Sbjct: 343 WNCPSCGFSNFQRRTSCFRCSFPSTGSAPM 372

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/31 (96%), Positives = 31/31 (100%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS
Sbjct: 453 PFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 483

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDT 605
           R GDW C +C + NF +   C RC  P + +A ++ T +  +T
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGYVKNT 381

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 388
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 487

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  485 bits (1249), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 242/387 (62%), Positives = 285/387 (73%), Gaps = 29/387 (7%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           M+YVVLE +  H  + PKD  R+  + YQ + ++TL S +E      I V+     L   
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ----PIIVEVGPGQLREQ 56

Query: 61  MGQLDKDIQHIIGND--DFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKE 118
           + QLD+ +   I +D  +F LVSL STWHIRVT+PRQARD+GFIL  YLQHP++FDLWKE
Sbjct: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116

Query: 119 FERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFAL 178
           ++RWC+NHPE + LRKN          S++G   K ++DL E+ R+LE P       F L
Sbjct: 117 YDRWCVNHPETLPLRKN----------SNLG---KKSRDLPELSRVLEAP----LQTFPL 159

Query: 179 DNHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDT 238
           D      +TI +L QLHKKC   ED   VLT PYDS+ D+R+FLQERSKVLYMNNLPPDT
Sbjct: 160 D------QTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDT 213

Query: 239 TQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHE 298
           TQSELESWFTQ+GARPVGFWTVKN+VE+T             YVE+QDSISGFVVFQTHE
Sbjct: 214 TQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHE 273

Query: 299 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 358
           EATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRPG
Sbjct: 274 EATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPG 333

Query: 359 DWNCPSCGFSNFQRRTACFRCSFPAPS 385
           DWNCPSCGFSNFQRRTACFRCSFPA S
Sbjct: 334 DWNCPSCGFSNFQRRTACFRCSFPATS 360

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 594
           PFRAGDWKC +CTYHNFAKNVVCLRCGGPK+V  
Sbjct: 498 PFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGG 531

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP--KSVNADVSETNHYIDTST 607
           R GDW C +C + NF +   C RC  P   +VN + S    +I  +T
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKSTPASFIKQAT 377

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 286/430 (66%), Gaps = 60/430 (13%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLE+++AH  DSPKD  +I    YQ +D ETL   +E      +   G   +L+ A
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVEL---GNGCTLQDA 57

Query: 61  MGQLDKDI-QHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           + QL+KDI +H    DDFVL SL STWH RVT+PRQARD+ FIL  +LQHP++FDLWKE+
Sbjct: 58  VAQLEKDISEH--AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVE------- 172
           +RWC+NHPE   +R+N L               K TKDL EM  +L +  T E       
Sbjct: 116 DRWCMNHPETSAMRQNPLG--------------KRTKDLAEMRSVLGLDGTEEGAHPDAN 161

Query: 173 ---------------------------------EDDFALDNHSLLQRTIDVLLQLHKKCS 199
                                             +    +    + + + ++ QLHKKC 
Sbjct: 162 QNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCV 221

Query: 200 SAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWT 259
           +A+D   VLT PYDS+ D+R+FLQERSKVLYMNNLPPDTTQSELESWFTQ+GARPVGFWT
Sbjct: 222 TADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT 281

Query: 260 VKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTK 319
           VKNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTK
Sbjct: 282 VKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTK 341

Query: 320 QPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRC 379
           QPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRC
Sbjct: 342 QPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRC 401

Query: 380 SFPAPSNSQM 389
           SFPA S + M
Sbjct: 402 SFPAASGAGM 411

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 3/52 (5%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV---NADVSETNHYIDTSTIA 609
           PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      ++   N Y D   I 
Sbjct: 489 PFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG 540

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 388
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           R GDW C +C + NF +   C RC  P +  A +
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGM 411

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  461 bits (1185), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 222/391 (56%), Positives = 290/391 (74%), Gaps = 15/391 (3%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           M YVVLEL+ +H  ++PKD  RI   +YQ +++ETL + +E   S  ID+     + +  
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKS--IDIPDMANAFKDT 58

Query: 61  MGQLDKDIQ-HIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           + QL+ DI+  I+   DFVL SL S W IRVTLPRQA D GFIL SYL+HPR+F+LWKEF
Sbjct: 59  ISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEF 118

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           ++WC NHPE++ +RK+    N   KS       K   D+++++ ILEI  +++      +
Sbjct: 119 DKWCGNHPEVIPMRKS----NLRVKSP------KTAGDISDIVNILEIDTSLQVPLSTSN 168

Query: 180 NHSLL--QRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPD 237
             +LL  Q + ++L +L KKC++ +D++ VLT+PYDS+ DI++FLQERS+VLYMNNLP D
Sbjct: 169 PQTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSD 228

Query: 238 TTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTH 297
           TTQSELESWFTQ+GARP+GFWT KN +E+T            P V++QD ++GFVVFQ+H
Sbjct: 229 TTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSH 288

Query: 298 EEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRP 357
           EEATE L LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD  Q+ILS FPQSKNKPRP
Sbjct: 289 EEATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRP 348

Query: 358 GDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 388
           GDW+CPSCGFSNFQRRTACFRCSFPAP+N++
Sbjct: 349 GDWSCPSCGFSNFQRRTACFRCSFPAPNNNK 379

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 26/30 (86%), Positives = 27/30 (90%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 590
           PFRAGDWKC +CTYHNFAKNVVCLRC  PK
Sbjct: 474 PFRAGDWKCPSCTYHNFAKNVVCLRCRIPK 503

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW CPSC + NF +   C RC  P
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIP 502

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP 589
           R GDW C +C + NF +   C RC  P
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFP 373

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  443 bits (1140), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 222/399 (55%), Positives = 283/399 (70%), Gaps = 19/399 (4%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPS----IDVDGEKKS 56
           M YV+LEL   H  ++PKD  RI  + +Q+V+A  L      G  P+    I +D + +S
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL------GEVPTKVDQIVIDEQAES 54

Query: 57  LESAMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLW 116
            ++A  +L++ I  I  +  F+L SL STW IRVTL RQARD G  +  +LQ+P++FDL 
Sbjct: 55  FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLM 114

Query: 117 KEFERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDF 176
           KE++RWC+NHPE+M  +  +     + K+ ++        +L  ++ + ++ N  EE+D 
Sbjct: 115 KEYQRWCLNHPEVMSWKPKL----ESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDG 170

Query: 177 ALD-----NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYM 231
           A+D     N   +  +  VLLQL  +C++++D K+VLT PYDS TD+RSFLQERS+VLYM
Sbjct: 171 AIDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYM 230

Query: 232 NNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGF 291
           NNLP DTTQSELESWFTQ+G RPVGFWT KN+V DT            PYVE+ DSI GF
Sbjct: 231 NNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGF 290

Query: 292 VVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQS 351
           VVFQTHEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQS
Sbjct: 291 VVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQS 350

Query: 352 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQMH 390
           KNKPRPGDW+CPSCGFSNFQRRTACFRCSFPAPSN  ++
Sbjct: 351 KNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/31 (83%), Positives = 30/31 (96%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDW C++CTYHNFAKNV+CLRCGGPK+
Sbjct: 456 PFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596
           R GDW C +C + NF +   C RC  P   N  +
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHI 388

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  442 bits (1136), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 219/385 (56%), Positives = 269/385 (69%), Gaps = 29/385 (7%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           M+YV+ E  VAH  D+PKD  R+  + YQ++    L   Y +     I+V G    ++ A
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADARE--IEVGG--GGVQMA 56

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
            GQL+  +Q    ++ FVL SL STWH+RVTLPRQA D+G +L  +L H ++FDLWKE +
Sbjct: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180
           RWC NH               + ++ + G       D+ E+ R+L++       D  L +
Sbjct: 117 RWCANH--------------VSERACNAGA----KGDVAELFRVLDL-------DEQLVS 151

Query: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240
           H+ +Q+   VLLQLH KC++AED   VLT PYDS+ D+ SF+QERS+VLYMNNLPPDTTQ
Sbjct: 152 HAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQ 211

Query: 241 SELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 300
           SELESWFTQ+GARPVGFWTVKN+VEDT             YVE+ DSISGFVVFQ+HE A
Sbjct: 212 SELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAA 271

Query: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360
           +E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGDW
Sbjct: 272 SEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDW 331

Query: 361 NCPSCGFSNFQRRTACFRCSFPAPS 385
           NCPSCGFSNFQRR ACFRCSFPA S
Sbjct: 332 NCPSCGFSNFQRRIACFRCSFPATS 356

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/40 (67%), Positives = 33/40 (82%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETN 600
           PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ N D ++ +
Sbjct: 502 PFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQAS 541

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSE 598
           R GDW C +C + NF + + C RC  P +    VS+
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVSK 362

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 351 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386
           S N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  423 bits (1087), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 205/412 (49%), Positives = 273/412 (66%), Gaps = 26/412 (6%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKK-SLES 59
           M+Y+V+E    H  ++PKD  RI  ++YQ VDAE+L  +Y       I +D E   S + 
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
            + QLD+DI+ ++G+D+FV  SL S W +RVT+PRQARD+   L  YLQ  ++FDLWKEF
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 120 ERWCINHPEIMGLRKNI-LNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFAL 178
            RW  NH + + ++K+  L +          T  K T +  E+    +  + V  +  A 
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 179 DNHSL------------------------LQRTIDVLLQLHKKCSSAEDMKSVLTQPYDS 214
           ++ +                         + R  ++L  +HKKC++ ED+  VLT+PYDS
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240

Query: 215 HTDIRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXX 274
           ++D ++F +E SK+LYMNNLPPDTTQSELESWF Q+G++PV FWTVKNIVE+T       
Sbjct: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNNW 300

Query: 275 XXXXXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSS 334
                PYVE+QDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+QPSS
Sbjct: 301 SMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360

Query: 335 TGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386
             VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (93%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 541 PFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVN 593
           R GDW C +C + NF +   C RC  P + N
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C +C + NF +   C RC  P
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  417 bits (1072), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 269/383 (70%), Gaps = 28/383 (7%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           M+Y ++ELQ AH  ++PKD  +I+N++YQ ++  TL + + +   P+ID       L  +
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDC--TTLPLSES 58

Query: 61  MGQLDKDIQHIIGN-DDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
           +  L KD++  + N +DFVL SL STW +RVT+ RQA+D+ + L ++ ++PR+FDLWKEF
Sbjct: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           +RWC+NH E++  R                   +  KDL ++  +L IP +VE     L 
Sbjct: 119 DRWCVNHKELVQTRDP-----------------RKLKDLKQLATLLHIP-SVE----TLS 156

Query: 180 NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTT 239
           + SL  +   VL+QLH+KC++ +D + VLT PYDS  D   F++  S VLYMNNLPPDTT
Sbjct: 157 SISLASK---VLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTT 213

Query: 240 QSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 299
           QSELE+WFTQ+G RP+GFWTVKNI+EDT            PYVE+ DSISGF+VF TH+E
Sbjct: 214 QSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKE 273

Query: 300 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 359
           A +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGD
Sbjct: 274 AIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGD 333

Query: 360 WNCPSCGFSNFQRRTACFRCSFP 382
           WNCPSCGFSNFQRRTACFRCSFP
Sbjct: 334 WNCPSCGFSNFQRRTACFRCSFP 356

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 478 PFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C +CG+ NF +   C RCS P
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPK 590
           R GDW C +C + NF +   C RC  P+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  416 bits (1069), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 210/402 (52%), Positives = 275/402 (68%), Gaps = 17/402 (4%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           M YV+ E +  +  ++PKD   I ++AYQI+  ETL   +E     SID      SL++ 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           +  ++  +   +  ++FVL SL STW +RVTL RQARD+ ++L S+LQHP++FDLW+E +
Sbjct: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117

Query: 121 RWCINHPEIM--GLRK---NILNNNSNTKSSSIGTLIKNTKDLNEMMRI-LEIPNTVEE- 173
           RW  NHPE    G  +   N+ N N+ T+ +    L+K+   L   + I L+  +T ++ 
Sbjct: 118 RWYRNHPEQYEKGTDRGGGNVANTNTTTQRNK-HKLVKSIDALLVFLNIDLDNKSTTDQR 176

Query: 174 -DDFALDNHSL-----LQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSK 227
            +   +D +S      +Q+   VL +LH+ C+S  D   VLT P+DS+ DI++FL E+S 
Sbjct: 177 MEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKST 236

Query: 228 VLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDS 287
           VLYMNNLPPDTTQSELESWF Q+G+RPVGFWTVKN+VEDT             YV++QDS
Sbjct: 237 VLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDS 296

Query: 288 ISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSP 347
           ISGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+AQEIL+ 
Sbjct: 297 ISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTA 356

Query: 348 FPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQM 389
           FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S  QM
Sbjct: 357 FPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 31/47 (65%), Positives = 36/47 (76%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTST 607
           PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK+ N   +  N  +  +T
Sbjct: 506 PFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNAT 552

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHY 602
           R GDW C +C++ NF +   C RC  P S    +S  N+Y
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNY 404

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 347 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386
           P     N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTAN 538

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  396 bits (1018), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 196/393 (49%), Positives = 262/393 (66%), Gaps = 25/393 (6%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSS-PSIDVDGEKKSLES 59
           M YV++ELQ     DS KDQ ++  + YQI+DA++L     NG+    + V+G   +L+ 
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEG--SNLQD 58

Query: 60  AMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119
            +   +K+I  +I  ++FVL S+ STW +RV LPR+A D+   L + L++P + DLWKEF
Sbjct: 59  TVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEF 118

Query: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD 179
           +RWC NHP+ +                S+    +  K+L  + ++L +   + E   +++
Sbjct: 119 DRWCTNHPDAL---------------QSVKGYNRKCKNLPMVHQVLGVEQRLNE---SVN 160

Query: 180 NHSLLQRTI----DVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLP 235
            +   ++ +    D+LLQLHKKCSS +D  +VLTQPY+S  D  +F +E+S VLY+NNLP
Sbjct: 161 ANGYTRKEVGITSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLP 220

Query: 236 PDTTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQ 295
           PDTTQ ELE+WF Q+G+RPV FWT KNIVEDT             YVE+QDS+SGF  FQ
Sbjct: 221 PDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQ 280

Query: 296 THEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKP 355
           T EEA   L L+GRSILSN+ANTKQPR+VEHV+E+ PSS  +L  ++EILS FPQSKNKP
Sbjct: 281 TFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKP 340

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 388
           RPGDWNCPSCGFSNFQRRTACFRCSFP PS  Q
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFPVPSAVQ 373

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDWKC+ C YHNFAKN++CLRC GPK+
Sbjct: 443 PFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385
           R GDW C +C + NF +   C RCS P  S
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP 589
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  393 bits (1009), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/416 (47%), Positives = 267/416 (64%), Gaps = 57/416 (13%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSI---DV------- 50
           M+Y+ +E +  H  ++PKD  +IV+++YQ+++ E     Y+   S  +   DV       
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVE-----YKEDLSYDVKKNDVVILSLGD 55

Query: 51  ---DGEKKSLESAMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYL 107
              +G+  + +  + Q  ++++  IGN++ VL SL STW +RVT+PRQ+ D+G IL S+L
Sbjct: 56  SMANGDIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFL 115

Query: 108 QHPRLFDLWKEFERWCINHPEIMGLRKNILNNNSNTKSSSIGTL-IKNTKDLNEMMRILE 166
           + P +FDLWKE++RWC                  N   S I T+  K  KD +E+ +ILE
Sbjct: 116 KLPIIFDLWKEYQRWC------------------NLHFSEINTMKTKKYKDSSELYKILE 157

Query: 167 IPNTVEEDDFALDNHSLLQR-----------------TIDVLLQLHKKCSSAEDMKSVLT 209
           I    +  D   +N  L  R                 T+DV + +  KCS+ ED +SVLT
Sbjct: 158 IN---QNSDAKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLT 214

Query: 210 QPYDSHTDIRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTXX 269
            PY+S+ D ++F+QE SK++YMNNLPPDTTQSELESWF Q+G +P   WTV+NI+E T  
Sbjct: 215 HPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSY 274

Query: 270 XXXXXXXXXXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLE 329
                     PYVE+ DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++E
Sbjct: 275 TNSNGNSNNSPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVE 334

Query: 330 LQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385
           LQPSS  +L++ QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA +
Sbjct: 335 LQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 30/31 (96%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591
           PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 548 PFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW C +C + NF +   C RC  P
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSV 592
           R GDW C +C + NF +   C RC  P + 
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  353 bits (905), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/384 (46%), Positives = 250/384 (65%), Gaps = 30/384 (7%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVLE++  H   + KDQ RI+N++YQIV+ +      +     SI +  + ++ + A
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120
           + QLD DI+  IG ++FV+ +L S  ++RVTL RQA D G  L  YL++P+LFDLW EF+
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180
           ++C NHPE+                  +   +  +KD+  +  IL + +   E+ + +D 
Sbjct: 121 KFCANHPEL-----------------DLNEEMVTSKDVAILTDILGLQSNNTEN-YTID- 161

Query: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240
                 + DVLL L+KKCSS+ED+K VLTQPYD   DI++F +E ++V++++NLPPD TQ
Sbjct: 162 -----ISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQ 216

Query: 241 SELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 300
           +ELE+WF  + ++P+ +WT K   E +             YV +Q SI GF++FQTHEEA
Sbjct: 217 NELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEA 270

Query: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360
            + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR GDW
Sbjct: 271 KQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDW 330

Query: 361 NCPSCGFSNFQRRTACFRCSFPAP 384
           NCPSCGFSNFQRRTACFRCSFPAP
Sbjct: 331 NCPSCGFSNFQRRTACFRCSFPAP 354

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK 590
           PFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 447 PFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385
           R GDW CPSC + NF +  AC RC  P  S
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP 589
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  259 bits (663), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 150/407 (36%), Positives = 229/407 (56%), Gaps = 51/407 (12%)

Query: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60
           MHYVVL++Q+    DS   +  ++ + YQ++D  +L +  E      +DVDGE  S++  
Sbjct: 1   MHYVVLDVQI----DSSAVKPVLLRLGYQVIDPVSLEARNE---PYVVDVDGE--SIKEF 51

Query: 61  MGQLDKDIQ-HII-------------GND---DFVLVSLCSTWHIRVTLPRQARDDGFIL 103
           + +LD+D++ H               G+D   +FV  +L  +W ++V L   A D G  L
Sbjct: 52  IAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVEL 111

Query: 104 TSYLQHPRLFDLWKEFERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKN-TKDLNEMM 162
             YL++P  FD+WKE+  W  NH +          ++ + ++ + G  I +    + E++
Sbjct: 112 PEYLRYPVFFDIWKEYSIWKKNHSD----------SSESPQTQANGESIDSFAGKIEELV 161

Query: 163 RILEIPNTVEE-----DDFALDNHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTD 217
           R L++    +E     DD   D    ++    VL  LHKKC +  D  +VLT PYD   D
Sbjct: 162 RTLDVSTEYDELKQKNDDPTFD----VRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMD 217

Query: 218 IRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTXXXXXXXXXX 277
            ++F++E+SK+LY++N+P +  Q++LE WF Q G   VGFWT+KNI +D           
Sbjct: 218 YKNFIEEQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGK 277

Query: 278 XXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGV 337
               +   DS+ GF +FQ+H +A   L L+G   +  +   K  + +E +L++QPSS  +
Sbjct: 278 M---LSIPDSMFGFAIFQSHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRL 332

Query: 338 LDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAP 384
           L+K Q+ L   PQ+KNKPRPGDWNCPSCGFSNFQRRTACFRC+FP P
Sbjct: 333 LEKVQDNLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVP 379

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%)

Query: 561 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDT 605
           PFRAGDWKC  C YHNFAKN+VCLRCGGPK+      + N   DT
Sbjct: 533 PFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKNNQDGDT 577

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP 589
           R GDW C +C + NF +   C RC  P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 228 VLYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNI 263
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 56/147 (38%), Gaps = 29/147 (19%)

Query: 207 VLTQPYDSHTDIRSFLQE-RSKV--LYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNI 263
           V   P+ S  D +S L E +S    +Y+ N+ P+T Q E E  F+QYGA         N 
Sbjct: 198 VYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN- 256

Query: 264 VEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATEVLA------LNGRSILSNLAN 317
                              E +    GFV F+ H  A + +        NG+ +    A 
Sbjct: 257 -------------------EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQ 297

Query: 318 TKQPRVVEHVLELQPSSTGVLDKAQEI 344
            K  R+ E   + + S    L K Q +
Sbjct: 298 KKYERLQELKKQYESSRMEKLAKYQGV 324

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 21/126 (16%)

Query: 144 KSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALD---NHSLLQRTIDVLLQLHKKCSS 200
           +S   GT+I  T+D  +M R ++  N  E D   LD    HS   R  D+ +Q   + + 
Sbjct: 259 RSRGFGTVIFRTRD--DMERAIDRYNRFEVDGRTLDVREGHSN-NRNDDMNIQHQTQNAM 315

Query: 201 AEDM--------KSVLTQPYDSHTDIRSFLQE-------RSKVLYMNNLPPDTTQSELES 245
             D         +S+ TQP +  ++  S   E       R+ ++Y +NLPP T +S+L  
Sbjct: 316 TNDATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYD 375

Query: 246 WFTQYG 251
            F   G
Sbjct: 376 LFESIG 381

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 229 LYMNNLPPDTTQSELESWFTQYGARPVGFWTVKNI 263
           +Y   LP +TT ++L ++FT YG+R +  +  KN+
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 228 VLYMNNLPPDTTQSELESWFT-QYGARPVGF 257
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 29/149 (19%)

Query: 205 KSVLTQPYDSHTDIRSFLQE-RSKV--LYMNNLPPDTTQSELESWFTQYGARPVGFWTVK 261
           + V   P+ S  D +S L E R+    +Y+ NL  + T+ + E+ F  YG       T+ 
Sbjct: 199 QEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFKPYG-------TIT 251

Query: 262 NIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATE-VLALN-----GRSILSNL 315
           ++  +                E +    GFV F+ HE+A + V ALN     G+++    
Sbjct: 252 SVALEKD-------------AEGKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGR 298

Query: 316 ANTKQPRVVEHVLELQPSSTGVLDKAQEI 344
           A  K  R+ E   + Q S    L K Q I
Sbjct: 299 AQKKYERLQELKKQYQASKLEKLAKYQGI 327

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 205 KSVLTQPYDSHTDIRSFLQERSKV---LYMNNLPPDTTQSELESWFTQYG 251
           + V   P+ S  D +S L+E       +Y+ N+  +TTQ E E+ FTQ+G
Sbjct: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 228 VLYMNNLPPDTTQSELESWF-TQYGARPVGF 257
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 609 TLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 228 VLYMNNLPPDTTQSELESWF-TQYGARPVGF 257
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 228 VLYMNNLPPDTTQSELESWF-TQYGARPVGF 257
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON}
           YDL224C (REAL)
          Length = 650

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 228 VLYMNNLPPDTTQSELESWFT-QYGARPVGFWTVKN 262
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 535 TLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 570

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 224 ERSKVLYMNNLPPDTTQSELESWFTQYG 251
           ERS+++Y  N+PP T +S+L   F   G
Sbjct: 207 ERSRIIYCENMPPATVESDLYDLFETIG 234

>KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.250
           YIL061C
          Length = 305

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 14/68 (20%)

Query: 185 QRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQSELE 244
           ++ +D L  L ++   AED     T PY              K +++  LP DTT+ +L+
Sbjct: 74  EKEMDKLQLLCEEWKPAEDPNIAGTDPY--------------KTIFVGRLPYDTTELDLQ 119

Query: 245 SWFTQYGA 252
             F +YGA
Sbjct: 120 EIFGKYGA 127

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 18/124 (14%)

Query: 117 KEFERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDF 176
           K   R CI+  + + L   ++NN S          I   + L E+M+  E+ +T+ ++ F
Sbjct: 66  KSSHRNCIHIIKTLTLIAYLMNNGS----LEFIRWINENQLLFEVMKNFEVSDTIHDEKF 121

Query: 177 ALDNHSLLQRTIDVLLQ---LHKKCSSAEDMKSVLTQPYDSHTD-----------IRSFL 222
           A+    L +R ++++     L +K +  ++ +S ++ P    TD           IR  L
Sbjct: 122 AIQIRDLSERILELINNRELLEQKRNEVDEFRSSISSPGRKSTDNSHIRKSTDSLIRKSL 181

Query: 223 QERS 226
            ERS
Sbjct: 182 GERS 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,067,067
Number of extensions: 2642499
Number of successful extensions: 13027
Number of sequences better than 10.0: 63
Number of HSP's gapped: 13385
Number of HSP's successfully gapped: 126
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)