Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.2383.189ON23323311211e-157
Skud_4.2423.189ON2322338961e-123
Smik_4.2233.189ON2322338861e-121
YDL010W (GRX6)3.189ON2312338581e-117
KAFR0A012303.189ON2202384946e-62
ZYRO0A04928g3.189ON2512504428e-54
SAKL0C10494g3.189ON2302354418e-54
TBLA0F007503.189ON2341744382e-53
Kwal_56.231143.189ON2102324232e-51
TDEL0D043203.189ON2431614202e-50
KLTH0G16060g3.189ON2132393981e-47
NCAS0E016003.189ON2292393755e-44
NDAI0G018003.189ON2222323712e-43
AER017C3.189ON2161193694e-43
YBR014C (GRX7)3.189ON2032263622e-42
Skud_2.1263.189ON2042243604e-42
Suva_2.1413.189ON2042243535e-41
Smik_2.1333.189ON2041113493e-40
Ecym_53133.189ON2481163384e-38
Kpol_1045.693.189ON2622593376e-38
KLLA0E17733g3.189ON2112313311e-37
KNAG0J012603.189ON1942253057e-34
TPHA0H006303.189ON1911212673e-28
CAGL0I04554g3.189ON2261122651e-27
SAKL0H06468g8.679ON2581422208e-21
NDAI0K013508.679ON2711752121e-19
KAFR0A038708.679ON2671362051e-18
Kpol_1072.148.679ON2501332005e-18
NCAS0C013408.679ON3572592012e-17
NCAS0B016408.679ON2401611943e-17
NDAI0E011508.679ON2361681943e-17
KNAG0G025808.679ON2781771921e-16
Suva_16.1548.679ON2831381823e-15
KLLA0D05973g8.679ON2811251788e-15
YPL156C (PRM4)8.679ON2841321753e-14
CAGL0M02167g8.679ON2331701733e-14
Skud_16.1268.679ON2871321726e-14
TPHA0G015908.679ON2971421728e-14
Smik_6.3538.679ON2861331648e-13
TBLA0B038208.679ON2511681602e-12
Ecym_23948.679ON2811251594e-12
ACR146W8.679ON2131351512e-11
Kwal_26.88148.679ON2751771533e-11
KLTH0D11308g8.679ON2711301392e-09
NDAI0F044301.38ON136831314e-09
TPHA0E037301.38ON106881261e-08
Kpol_2002.361.38ON109881242e-08
Kwal_33.131661.38ON138881253e-08
CAGL0K05813g1.38ON142951253e-08
TBLA0A050801.38ON118841234e-08
TPHA0B03560singletonON106841191e-07
Smik_4.7941.38ON143831211e-07
YDR513W (GRX2)1.38ON143881211e-07
Suva_2.6931.38ON143881201e-07
Kpol_2000.991.38ON141831202e-07
Skud_4.7881.38ON145831192e-07
KLLA0C01298g1.38ON107951172e-07
KNAG0C004501.38ON157901175e-07
NCAS0A003601.38ON138871122e-06
KAFR0D003601.38ON109831084e-06
TDEL0E05740singletonON108811067e-06
KLTH0F01276g1.38ON1381071061e-05
AFR710W1.38ON111901051e-05
ZYRO0F17732g1.38ON139871061e-05
TDEL0C066401.38ON1431101052e-05
Ecym_10441.38ON1581031052e-05
KNAG0F002501.38ON142931033e-05
TPHA0B048201.38ON138811024e-05
SAKL0C01320g1.38ON165901017e-05
NDAI0A003801.38ON10988981e-04
NCAS0B088701.38ON10983962e-04
NDAI0E028908.519ON15598939e-04
NCAS0B022908.519ON13994890.002
NDAI0C053908.519ON14494870.004
NCAS0C022408.519ON16198880.005
KNAG0A020908.519ON14998860.006
Suva_3.1781.38ON31682890.007
KLTH0A04004g7.226ON52270890.007
Smik_3.421.38ON11074830.009
KAFR0A011908.519ON15798850.010
TPHA0B033408.240ON24981860.013
Suva_16.2558.519ON149101830.016
YCL035C (GRX1)1.38ON11074800.024
CAGL0M07271g8.519ON14997810.035
TPHA0L015208.519ON15098810.036
Kpol_513.118.519ON14797800.040
Skud_3.271.38ON11075780.042
Skud_16.2248.519ON14998800.047
Skud_4.3568.240ON26284820.048
YER174C (GRX4)8.240ON24484810.048
AGR111W8.240ON23780810.051
KLLA0B09636g8.519ON14298790.052
Smik_16.1788.519ON14998790.053
ZYRO0F08932g8.519ON14798790.054
YPL059W (GRX5)8.519ON15098790.058
Kwal_27.119488.519ON13698780.069
Smik_4.3398.240ON26584800.072
CAGL0L11990g8.240ON242113800.072
SAKL0H17710g8.240ON24180800.074
ADR053W8.519ON13896780.077
Suva_5.3088.240ON24484790.088
Skud_5.3138.240ON24484790.092
SAKL0H04136g4.211ON11082760.096
KLLA0C17842g8.240ON26480790.10
Smik_5.3468.240ON24484790.10
YDR098C (GRX3)8.240ON28584790.11
TBLA0H035008.519ON14998760.12
TDEL0B011808.519ON14598760.14
TBLA0A082304.211ON10877740.14
SAKL0H10626g8.519ON14398760.15
KLTH0E12034g8.519ON13698750.16
NDAI0J015108.240ON24584770.16
KLTH0G14234g8.240ON24080770.19
Kwal_56.235068.240ON24080760.22
KLLA0B07975g4.211ON11163730.22
Kwal_47.181637.226ON52270770.24
TPHA0A019108.240ON24186760.27
Ecym_11878.519ON13994730.28
Suva_2.2578.240ON25285750.37
KNAG0H030308.240ON23684740.37
NCAS0B039708.240ON23784740.41
KAFR0A023608.240ON23686730.52
SAKL0F08294g7.226ON52370740.63
NCAS0B048908.240ON27487730.65
TPHA0B009504.211ON10847690.68
Kpol_1046.138.240ON24680720.71
CAGL0G08151g8.240ON26084720.79
Ecym_35148.240ON24580710.88
TDEL0H021907.226ON51850711.5
KAFR0B026008.240ON25991701.5
TBLA0F038608.240ON24980701.5
TPHA0C012007.226ON528117701.9
TDEL0E016304.211ON10847652.8
KNAG0A025408.429ON40160673.6
NDAI0B023008.240ON299110664.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.238
         (233 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   436   e-157
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   349   e-123
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   345   e-121
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   335   e-117
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   194   6e-62
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   174   8e-54
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   174   8e-54
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   173   2e-53
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   167   2e-51
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   166   2e-50
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   157   1e-47
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   149   5e-44
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   147   2e-43
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   146   4e-43
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   144   2e-42
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   143   4e-42
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   140   5e-41
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   139   3e-40
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   134   4e-38
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   134   6e-38
KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   132   1e-37
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   122   7e-34
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   107   3e-28
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   106   1e-27
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    89   8e-21
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    86   1e-19
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    84   1e-18
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    82   5e-18
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    82   2e-17
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      79   3e-17
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    79   3e-17
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    79   1e-16
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    75   3e-15
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    73   8e-15
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    72   3e-14
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    71   3e-14
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    71   6e-14
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    71   8e-14
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    68   8e-13
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    66   2e-12
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    66   4e-12
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    63   2e-11
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    64   3e-11
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    58   2e-09
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    55   4e-09
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    53   1e-08
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    52   2e-08
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    53   3e-08
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    53   3e-08
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    52   4e-08
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      50   1e-07
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    51   1e-07
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    51   1e-07
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    51   1e-07
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    51   2e-07
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    50   2e-07
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    50   2e-07
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    50   5e-07
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    48   2e-06
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    46   4e-06
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    45   7e-06
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    45   1e-05
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    45   1e-05
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    45   1e-05
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    45   2e-05
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    45   2e-05
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    44   3e-05
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    44   4e-05
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    44   7e-05
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    42   1e-04
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    42   2e-04
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      40   9e-04
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      39   0.002
NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {...    38   0.004
NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519      39   0.005
KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.51...    38   0.006
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    39   0.007
KLTH0A04004g Chr1 complement(335054..336622) [1569 bp, 522 aa] {...    39   0.007
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    37   0.009
KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON...    37   0.010
TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.24...    38   0.013
Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W...    37   0.016
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    35   0.024
CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} simila...    36   0.035
TPHA0L01520 Chr12 complement(319260..319712) [453 bp, 150 aa] {O...    36   0.036
Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON} ...    35   0.040
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    35   0.042
Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W...    35   0.047
Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 b...    36   0.048
YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}  G...    36   0.048
AGR111W Chr7 (947498..948211) [714 bp, 237 aa] {ON} Syntenic hom...    36   0.051
KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar...    35   0.052
Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W...    35   0.053
ZYRO0F08932g Chr6 complement(723285..723728) [444 bp, 147 aa] {O...    35   0.054
YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}  GRX5Hydrop...    35   0.058
Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa] ...    35   0.069
Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 b...    35   0.072
CAGL0L11990g Chr12 complement(1291224..1291952) [729 bp, 242 aa]...    35   0.072
SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} simil...    35   0.074
ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic hom...    35   0.077
Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}...    35   0.088
Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}...    35   0.092
SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {O...    34   0.096
KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa] ...    35   0.10 
Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}...    35   0.10 
YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}  G...    35   0.11 
TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON...    34   0.12 
TDEL0B01180 Chr2 (214316..214753) [438 bp, 145 aa] {ON} Anc_8.51...    34   0.14 
TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {...    33   0.14 
SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON} uniprot...    34   0.15 
KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa] ...    33   0.16 
NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240     34   0.16 
KLTH0G14234g Chr7 (1233911..1234633) [723 bp, 240 aa] {ON} simil...    34   0.19 
Kwal_56.23506 s56 complement(577407..578129) [723 bp, 240 aa] {O...    34   0.22 
KLLA0B07975g Chr2 complement(705661..705996) [336 bp, 111 aa] {O...    33   0.22 
Kwal_47.18163 s47 complement(714420..715988) [1569 bp, 522 aa] {...    34   0.24 
TPHA0A01910 Chr1 (386720..387445) [726 bp, 241 aa] {ON} Anc_8.24...    34   0.27 
Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to...    33   0.28 
Suva_2.257 Chr2 complement(443608..444366) [759 bp, 252 aa] {ON}...    33   0.37 
KNAG0H03030 Chr8 complement(568120..568830) [711 bp, 236 aa] {ON...    33   0.37 
NCAS0B03970 Chr2 (711785..712498) [714 bp, 237 aa] {ON} Anc_8.240      33   0.41 
KAFR0A02360 Chr1 (488402..489112) [711 bp, 236 aa] {ON} Anc_8.24...    33   0.52 
SAKL0F08294g Chr6 complement(633032..634603) [1572 bp, 523 aa] {...    33   0.63 
NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON}      33   0.65 
TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON...    31   0.68 
Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON...    32   0.71 
CAGL0G08151g Chr7 complement(775053..775835) [783 bp, 260 aa] {O...    32   0.79 
Ecym_3514 Chr3 (962769..963506) [738 bp, 245 aa] {ON} similar to...    32   0.88 
TDEL0H02190 Chr8 (370572..372128) [1557 bp, 518 aa] {ON} Anc_7.2...    32   1.5  
KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON...    32   1.5  
TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON...    32   1.5  
TPHA0C01200 Chr3 (275584..277170) [1587 bp, 528 aa] {ON} Anc_7.2...    32   1.9  
TDEL0E01630 Chr5 complement(319395..319721) [327 bp, 108 aa] {ON...    30   2.8  
KNAG0A02540 Chr1 (260985..262190) [1206 bp, 401 aa] {ON} Anc_8.4...    30   3.6  
NDAI0B02300 Chr2 complement(576792..577691) [900 bp, 299 aa] {ON...    30   4.7  

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  436 bits (1121), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/233 (92%), Positives = 216/233 (92%)

Query: 1   MILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXX 60
           MILSNKRNARILSITM     VFFIAQNANFLAIETKEEEKPPQLLDIDKN         
Sbjct: 1   MILSNKRNARILSITMLLLLLVFFIAQNANFLAIETKEEEKPPQLLDIDKNSISGRSSRR 60

Query: 61  XXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120
              VPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE
Sbjct: 61  IASVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120

Query: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180
           YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT
Sbjct: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180

Query: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN
Sbjct: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  349 bits (896), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/233 (74%), Positives = 191/233 (81%), Gaps = 1/233 (0%)

Query: 1   MILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXX 60
           MI  NKRNARILSITM     VFFI QNANFL IETKEE KP Q+   + +         
Sbjct: 1   MIPPNKRNARILSITMLLLLLVFFIVQNANFLTIETKEE-KPFQVFSTNMDSLSVGSSKK 59

Query: 61  XXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120
               PTS   KG+SEVDEEINEIKQKVGLQQPIASADDSLSA+KSDKG+GTGKGFNVQ+E
Sbjct: 60  LATEPTSAIKKGSSEVDEEINEIKQKVGLQQPIASADDSLSALKSDKGSGTGKGFNVQKE 119

Query: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180
           YSLMLDL+PVIIFSKS C YS+ +KELLE+EYQF+PNYYIIELDKH HGEEL+EYI+  T
Sbjct: 120 YSLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIRLMT 179

Query: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           GRG VPNLLING+SRGG+EEI+ LHSQGKLL SLQ WS GKF+VEQREKPSNN
Sbjct: 180 GRGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSVEQREKPSNN 232

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  345 bits (886), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 195/233 (83%), Gaps = 1/233 (0%)

Query: 1   MILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXX 60
           M+ SNKRNARILSITM     VFF+AQNANFL +ETKE E   +L D + N         
Sbjct: 1   MVHSNKRNARILSITMLLLLLVFFVAQNANFLTLETKERE-SSELFDSEMNNLAAESTRK 59

Query: 61  XXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120
              VPTS TNKG+SEVDEEINEIKQKVGLQ+PI S DDSLSAIKSDK +GTGK FNVQ+E
Sbjct: 60  YVAVPTSATNKGSSEVDEEINEIKQKVGLQRPILSDDDSLSAIKSDKQSGTGKLFNVQKE 119

Query: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180
           YSLMLDL+PVIIFSKS+CSYSKG+KELLE+EYQFVPNYYIIELDKH HGEEL+EYIK  T
Sbjct: 120 YSLMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKLKT 179

Query: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           GRGTVPNLL+NG+SRGG+EEI++LHSQGKLL SLQ WS GKF+VEQ EKPSNN
Sbjct: 180 GRGTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGKFSVEQHEKPSNN 232

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  335 bits (858), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 171/233 (73%), Positives = 192/233 (82%), Gaps = 2/233 (0%)

Query: 1   MILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXX 60
           MI SNKRNARILSIT      VFF+AQNANFL +E KEE       ++D           
Sbjct: 1   MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDN--MAGGSSRE 58

Query: 61  XXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120
              +PTSTTNKG+SEVDEEINEIKQKVGLQQPIAS DDSLSAIK+DKG+   K FNVQ+E
Sbjct: 59  YAAMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKE 118

Query: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180
           YSL+LDL+P+IIFSKSTCSYSKG+KELLE+EYQF+PNYYIIELDKH HGEEL+EYIK  T
Sbjct: 119 YSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVT 178

Query: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           GRGTVPNLL+NGVSRGG+EEIK+LH+QGKLL SLQ WS GKF+VEQREKPSNN
Sbjct: 179 GRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN 231

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  194 bits (494), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 149/238 (62%), Gaps = 26/238 (10%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAI-ETKEEEKPPQLLDIDKNXXXXXXXXX 60
           ++ NKRN RI+S+T      VFF+ ++AN + + ++    +     D+D           
Sbjct: 3   VILNKRNIRIVSVTSILLLLVFFVIRDANSITLSQSISNSETVAKTDLDG---------- 52

Query: 61  XXXVPTSTTNK---GNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGT--GTGKGF 115
                 S +NK    NSE  EEI+ IKQ++G+     + D  + A  +++     T   F
Sbjct: 53  -----ASASNKKKTDNSEATEEIDRIKQEIGI-----TDDSPVPATNANEQNEENTAVTF 102

Query: 116 NVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREY 175
           N  +EY+ +L+L+P+++FSKS C +S  LKEL  +EYQF PN+YI+ELDKH HG+ L+ Y
Sbjct: 103 NAAKEYASILELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAY 162

Query: 176 IKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           IK  TGRGTVPN++INGVSRGGS++++ LH+ GKLL SL+ W  G F V+Q EKPSNN
Sbjct: 163 IKEKTGRGTVPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGNFQVKQIEKPSNN 220

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  174 bits (442), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 143/250 (57%), Gaps = 25/250 (10%)

Query: 5   NKRNARILSITMXXXXXVFFIAQNANFLAI--------ETKEEEKPPQLLDIDKNXXXXX 56
           NKRN R+LSIT      VFF+ QNAN ++I            E++         N     
Sbjct: 6   NKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANANSNEDQTLTSAGTSINKESKE 65

Query: 57  XXXXXXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADD-------------SLSAI 103
                         +G+S VD EI +IKQ+VG    I   DD              +   
Sbjct: 66  EVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVG----IGKTDDLETGSSGSISGGGVVGKG 121

Query: 104 KSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIEL 163
            S         F+  +EY+++LD +P+I+FSKSTC YSK LKELL+ EY F P+Y++IEL
Sbjct: 122 GSASEHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIEL 181

Query: 164 DKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFT 223
           D+H +G EL++Y++  TGR TVPN++ING SRGG++E + LH++GKLLSS ++WS G FT
Sbjct: 182 DRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGTFT 241

Query: 224 VEQREKPSNN 233
           V Q ++PSNN
Sbjct: 242 VLQLDRPSNN 251

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  174 bits (441), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 96/235 (40%), Positives = 140/235 (59%), Gaps = 15/235 (6%)

Query: 6   KRNARILSITMXXXXXVFFIAQNANFLAIETKEEEK----PP--QLLDIDKNXXXXXXXX 59
           KRN R+L+IT      +FFI QNAN +A+  K   +    PP  +L+  D +        
Sbjct: 4   KRNLRVLTITGFLVFLIFFIVQNANTVAVANKNSGRANGVPPSSKLIHSDGDEQEVAVQK 63

Query: 60  XXXXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIK-SDKGTGTGKGFNVQ 118
                      K +S V+ EI +I+Q++   Q    ++   +  K S     +   FN  
Sbjct: 64  QQE--------KEDSAVNAEIAQIQQEIAGNQGGGGSNSGRTGNKVSAAKDSSSVEFNAA 115

Query: 119 QEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +EY+ +L+ +P+++FSKS C +S  LK+LL  EYQF P+Y ++ELDKH HG EL++YI  
Sbjct: 116 KEYASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAELQKYIGD 175

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
            TGR TVPN++IN VSRGGS++++ LH  GKLL SL+EW G + TV + +KPSNN
Sbjct: 176 VTGRSTVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQLTVSKNQKPSNN 230

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  173 bits (438), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 116/174 (66%), Gaps = 16/174 (9%)

Query: 71  KGNSE-VDEEINEIKQKVGLQ----------QPIASADDSLSAIKSDKGTGTGKGFNVQQ 119
           KGN   VD + ++IKQ+VGL             I +A D+  +   + GT     F+  +
Sbjct: 66  KGNDAGVDAQFDKIKQEVGLDTGKTTQGGLPSSIGTATDNKISNNDENGT-----FDAAK 120

Query: 120 EYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKST 179
           EY+++LDL+PVIIFSKS C +S  LK+LL  E+ F PNYY+IELD+H+HG EL+ YI   
Sbjct: 121 EYAMILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQAYIAKK 180

Query: 180 TGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           T R TVPN+++NG+SRGG +EI  L+ +GKLL +L +WS   FTV+Q EKPSNN
Sbjct: 181 TDRSTVPNMIVNGISRGGRDEIVALNDEGKLLEALNDWSDNTFTVKQAEKPSNN 234

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  167 bits (423), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 134/232 (57%), Gaps = 23/232 (9%)

Query: 3   LSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXXX 62
           + +KRN R+ S T      ++FI QNA   +   K   + P+ L  D             
Sbjct: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQTSSDVGKAINRKPETLIGD-----------GV 49

Query: 63  XVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEYS 122
                 T K + +VD+ I  I+++VG+++             S K   T K F+   EY 
Sbjct: 50  VAKAKETTKIDEDVDQAIRNIQEEVGIKEG-----------SSGKSEPTRKAFDPAMEYQ 98

Query: 123 LMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
            +L  +P+I+FSKS C YS  +KELL+ EY+F P+Y ++ELD+H HG+EL++YI   T R
Sbjct: 99  QILSNSPMIVFSKSMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNR 158

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGK-FTVEQREKPSNN 233
            TVPN++I+GVSRGG ++ K L  +GKLL SLQ+WS GK  +V ++EKPSNN
Sbjct: 159 ATVPNVVIHGVSRGGYDDFKALLDKGKLLESLQDWSDGKTLSVSKKEKPSNN 210

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  166 bits (420), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 113/161 (70%), Gaps = 4/161 (2%)

Query: 76  VDEEINEIKQKVGLQQPIASADDSLS---AIKSDKGTGTGKGFNVQQEYSLMLDLAPVII 132
           VD EI++IKQ+V      AS D+S+S      S  GT +   F+  +EYS++L ++PVI+
Sbjct: 84  VDAEIDKIKQEVNSGSG-ASKDNSISQKAGSGSKDGTVSEGEFDPAKEYSMILGISPVIV 142

Query: 133 FSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLLING 192
           FSKS C YS  LKELL  EY   P+Y +IELDKH HG  L+++I+  TGR TVPNL+ING
Sbjct: 143 FSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHKHGVALQKFIEKKTGRATVPNLMING 202

Query: 193 VSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
            SRGG ++IK LHS+G+LL SL +W  G FTV+Q EKPSNN
Sbjct: 203 KSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQLEKPSNN 243

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  157 bits (398), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 129/239 (53%), Gaps = 38/239 (15%)

Query: 5   NKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXXXXV 64
           +KRN R+   T      ++FI QNA+                    N            +
Sbjct: 3   SKRNLRVFVFTGVLLVLIYFIIQNAHTTVTSG--------------NSSLSGQTASGAVI 48

Query: 65  PTSTTNKGNSE----VDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTG------KG 114
            +   +K + E    VD+EI EIK +VG              IK D G  +G      K 
Sbjct: 49  HSKGNHKSSGEVDPSVDKEIQEIKNEVG--------------IKGDDGASSGTDFTQEKE 94

Query: 115 FNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELRE 174
           F+  +EY  +L   P+I+FSKS C +SK LK+LL  E++F P+Y ++ELDKH HG EL++
Sbjct: 95  FDPAKEYQYILANRPMIVFSKSRCPFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQK 154

Query: 175 YIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           +I S TGR TVPN++INGVSRGG ++ ++L  +G+LLSSL+ W     TV ++EKPSNN
Sbjct: 155 HIGSLTGRSTVPNVIINGVSRGGCDDFEKLQEKGELLSSLKTWCDKALTVSKKEKPSNN 213

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  149 bits (375), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 128/239 (53%), Gaps = 34/239 (14%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIET----KEEEKPP--QLL-----DIDK 50
           I+ NKRN R++ IT      VFFI Q+AN  A  T    K+  KP    L+     D++ 
Sbjct: 3   IVLNKRNIRVVGITAALLCLVFFIIQSANNSAFTTESPSKQSNKPALNSLVGAHGDDLNI 62

Query: 51  NXXXXXXXXXXXXVPTSTT---NKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDK 107
                         PT  T   +  N E+DE                SAD   SA + D 
Sbjct: 63  PATHNVLQDNVESAPTVETESESNNNMELDE----------------SAD---SAQEKDA 103

Query: 108 GTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHA 167
            T T   F+V +EY+ +L   P++IFSKSTC YS  LK+LL + +QF P   I+ELDKH 
Sbjct: 104 ST-TAPDFDVAKEYAAILAKGPMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHE 162

Query: 168 HGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQ 226
           HG+ L+ YIK  TGRGTVPNL++ G+SRGGS++I++L  +G LL  L+ W  G   V Q
Sbjct: 163 HGDVLQGYIKEETGRGTVPNLIVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGDLEVTQ 221

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  147 bits (371), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 122/232 (52%), Gaps = 19/232 (8%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXX 61
           ++ NKRN R+L  T        F+ QNAN     + +  K      I             
Sbjct: 3   VVLNKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKST----ITDTNSIVQAHGED 58

Query: 62  XXVPTSTTNKGNSEVDEEI-NEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQE 120
             +P +  N  NS V  EI +E   K+     I  A+  +              F+V +E
Sbjct: 59  ENIP-ALKNVDNSPVSTEITSEEDSKINADSSIVQAEAEVP-------------FDVAKE 104

Query: 121 YSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTT 180
           Y+ +L   P++IFSK+ C YSK LKELL + +Q  P   +IELDKH HGEEL+ YIK  T
Sbjct: 105 YTSILQRGPMVIFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQT 164

Query: 181 GRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSN 232
           GRGTVPNL+ING S+GGS+++K+L  +  LL SL EWS G + V+  E  SN
Sbjct: 165 GRGTVPNLIINGNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQATETASN 216

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  146 bits (369), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 91/119 (76%)

Query: 115 FNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELRE 174
           F+  + Y+ +L L+ +++FSKSTC  S GLK+LL + Y+F+P+Y ++ELDKHA+G EL++
Sbjct: 98  FDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQK 157

Query: 175 YIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
           Y+  TT R TVPNL+INGVSRGG + I  LH  G+LL SL++W+ GK  V Q+++PSN+
Sbjct: 158 YVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKHAVTQKQRPSNS 216

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  144 bits (362), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 120/226 (53%), Gaps = 35/226 (15%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXX 61
           I+ NKRN R+L IT      VFF+ +N+N    E+     P  L+  D            
Sbjct: 3   IVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFD------------ 50

Query: 62  XXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLS--AIKSDKGTGTGKGFNVQQ 119
                   N GN+             G  Q +    ++    A + DK +G  + F+   
Sbjct: 51  --------NSGNAP------------GTHQSVHDTVNTQDKEAEEVDKNSGDAE-FDAAA 89

Query: 120 EYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKST 179
           EY+ +++ +P+I+FSK+ C YSK LK LL + Y F P+YY++ELD+H H +EL++ I+  
Sbjct: 90  EYNKIMEQSPMIVFSKTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKV 149

Query: 180 TGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVE 225
           TGR TVPN++I G SRGG  EI  LH   +LL S ++WS G FTV+
Sbjct: 150 TGRRTVPNVIIGGTSRGGYTEIAELHKNDELLDSFKKWSDGAFTVK 195

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  143 bits (360), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 116/224 (51%), Gaps = 30/224 (13%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXX 61
           I+ NKRN R+L IT      VF + +++N  A E  +   P  L   D++          
Sbjct: 3   IVINKRNVRVLVITNILLILVFLVVRSSNADASEAVKIIHPGSLATFDQS-------GNA 55

Query: 62  XXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEY 121
              P S      ++ D+E+ E  +            DS            G  F+   EY
Sbjct: 56  PGTPESADKAVTNKQDKEVGETNE------------DS-----------KGVTFDAAAEY 92

Query: 122 SLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTG 181
             +L+ +P ++FSK+ C YSK LK LL   Y   P+YY++ELD+H HG+EL++YI   TG
Sbjct: 93  GKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELKDYIGDKTG 152

Query: 182 RGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVE 225
           R TVPN++ING+SRGG  E+  LH    L+ S +EWS  KFTV+
Sbjct: 153 RSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVK 196

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  140 bits (353), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 124/224 (55%), Gaps = 30/224 (13%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXX 61
           I+ NKRN R+L IT      VF + +N++  A E+     P  L+  D++          
Sbjct: 3   IVINKRNVRVLVITNLLLVLVFLVIRNSSTSAGESGVNYHPGSLVTFDESGNAPGTPES- 61

Query: 62  XXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEY 121
             +  S  NK + EVDE +NE  ++V                           F+   EY
Sbjct: 62  --IHGSVANKQDKEVDE-VNENSKEVK--------------------------FDAATEY 92

Query: 122 SLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTG 181
             +L  + +++FSKS C +SK LK LL   Y+F P+Y+++ELD+H H +EL++YI+  TG
Sbjct: 93  ETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQDYIEKVTG 152

Query: 182 RGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVE 225
           R TVPN++INGVS+GG +++  LH + KLL SL+EWS G FTVE
Sbjct: 153 RRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  139 bits (349), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 81/111 (72%)

Query: 115 FNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELRE 174
           F+   EY  +L  +P+I+FSKS C +SK LK LL   Y F P+YY++ELDK  H  EL+E
Sbjct: 86  FDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAESYTFSPSYYVVELDKREHTSELQE 145

Query: 175 YIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVE 225
           +I+ +TGR TVPN++I+G+SRGG +EI  LH   KLL+S +EWS GKFTVE
Sbjct: 146 HIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKLLNSFKEWSSGKFTVE 196

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  134 bits (338), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (68%)

Query: 114 GFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELR 173
           G+N    Y  +LD+APVIIFSK+TC YS  LK LL   YQF P+Y +IELD     +EL+
Sbjct: 131 GYNPADRYQKILDMAPVIIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQ 190

Query: 174 EYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREK 229
            YI   TGR TVPNLL+NG S GG +EI  LHS+G+LL S+++WS  K TV  ++K
Sbjct: 191 FYISQQTGRKTVPNLLVNGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVTPKQK 246

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  134 bits (337), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 132/259 (50%), Gaps = 32/259 (12%)

Query: 5   NKRNARILSITMXXXXXVFFIAQNANFLAIETK-------EEEKPPQLLDIDKNXXXXXX 57
           NKRN RILSIT      +F I+QN N +  +         E      ++D D        
Sbjct: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65

Query: 58  XXXXXXVPTSTTNKGNSEVDEEINEIKQKVGL-----------------------QQPIA 94
                 +   T    + +V+ EI++IK++VGL                            
Sbjct: 66  RYSSDDLVKGTAK--DDKVNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNNVVNEK 123

Query: 95  SADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQF 154
           S   + +A ++ +G      F+  QEY+++ +L+P+I+++K+ C Y K L +LLE  Y F
Sbjct: 124 STVQNNAAQRAVQGGSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYSF 183

Query: 155 VPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSL 214
            P ++ ++LDKH HG+EL++++   TG  TVPN +ING S GG ++I +LH  GKL+ ++
Sbjct: 184 QPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIETI 243

Query: 215 QEWSGGKFTVEQREKPSNN 233
           QE S     V+  EKPSN+
Sbjct: 244 QEMSDYSVVVKAIEKPSNS 262

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 122/231 (52%), Gaps = 38/231 (16%)

Query: 6   KRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXXXXVP 65
           KR+ R++S+T      +FFI  NA                                  V 
Sbjct: 4   KRSLRLVSLTGMVIFVLFFIRHNA---------------------------ESVTRSYVG 36

Query: 66  TSTTNKGN-SEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKG---------F 115
             ++N  N ++V+ +IN I++ +   +  A   D+ +A+K+  G    K          +
Sbjct: 37  KESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETY 96

Query: 116 NVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREY 175
           N + EY  +L  +P+++FSKS C +S  LK LL+ EY+F P Y I+ELDKH +G EL++Y
Sbjct: 97  NAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKY 155

Query: 176 IKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQ 226
           I S TGR TVPN++ING+SRGGS+E   LH    LL SL+ W+G   +V++
Sbjct: 156 IGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  122 bits (305), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 113/225 (50%), Gaps = 34/225 (15%)

Query: 2   ILSNKRNARILSITMXXXXXVFFIAQNANFLAIETKEEEKPPQLLDIDKNXXXXXXXXXX 61
           I  NKRN R LS+T+     V F+ QNA  +++   +     Q+L+              
Sbjct: 3   ITLNKRNIRALSVTLLLLLLVLFVTQNARNVSVTVDDR----QVLE-------------- 44

Query: 62  XXVPTSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEY 121
             VP    N  N E    +  +K K+G               +S +       F+   EY
Sbjct: 45  -GVP--LVNYANVEDPVSVAAVKPKIGTD-------------RSGQAPEPAGVFSPAVEY 88

Query: 122 SLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTG 181
             +L  +PV+IFSKS C YS  LK+LL + ++F P Y ++ELD+H HG EL++YI   TG
Sbjct: 89  DSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQKYIAEKTG 148

Query: 182 RGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQ 226
           R TVPNL++NGVS GG ++I  L   GKLL  L EW G    V Q
Sbjct: 149 RSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSAVNVIQ 193

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  107 bits (267), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 1/121 (0%)

Query: 108 GTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHA 167
           G+ +GK F+  QEY  ++++APV++FSK+ C Y K LK+LL   Y+F P+  IIELDKH 
Sbjct: 64  GSSSGK-FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHP 122

Query: 168 HGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQR 227
           +G+EL  YIK  T   TVPNL++NG S GG + IK+L     +  ++Q+ S     V  +
Sbjct: 123 NGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSK 182

Query: 228 E 228
           +
Sbjct: 183 D 183

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  106 bits (265), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 75/112 (66%)

Query: 115 FNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELRE 174
           ++  +E+  ++  AP++IFSKS C +SK LK+LL+  Y+  P Y  +E+D+H +G++L  
Sbjct: 114 YSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYS 173

Query: 175 YIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQ 226
           YIK  TGR TVPNL+ NG S+GG +++  LH+  +L S L EW  G+  V +
Sbjct: 174 YIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGVGELQVSK 225

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 89.4 bits (220), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 77/142 (54%), Gaps = 15/142 (10%)

Query: 107 KGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKH 166
           K T     F+    +  +L  +PV+IF+KS+   S+ LK LL  EYQ  P   ++ELDKH
Sbjct: 117 KNTDESLAFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAVVELDKH 176

Query: 167 AHGEELREYIK------------STTGRGTVPNLLINGVS---RGGSEEIKRLHSQGKLL 211
           A G+EL++YIK             +     VP L INGVS   +G  ++IK+LH  G LL
Sbjct: 177 AKGKELQDYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLHKDGSLL 236

Query: 212 SSLQEWSGGKFTVEQREKPSNN 233
             L+ ++G K   E+   PSN+
Sbjct: 237 DKLRSFAGEKVMFEKANLPSNS 258

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 86.3 bits (212), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 94/175 (53%), Gaps = 17/175 (9%)

Query: 75  EVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTG-----TGKGFNVQQEYSLMLDLAP 129
           +V +EI++IK+++   + I   +D     K  K +      +   FN +  +  +L+ +P
Sbjct: 96  KVWKEISDIKKELSKDEHILKKNDGNDNSKKLKDSQNVHLLSSTSFNAEDNFKQILNTSP 155

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIK---------STT 180
            ++F KS+   S+ LK LL  EY+  P   I++L+KH++G +L  YIK           +
Sbjct: 156 AVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLLNYIKKNKLLPPSNKAS 215

Query: 181 GRGTVPNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSN 232
               +P L INGVS    G S++IK+LHS G LL+ L+ +S G    E++  PSN
Sbjct: 216 STPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYSDGHIFFEKKNFPSN 270

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 83.6 bits (205), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 3/136 (2%)

Query: 100 LSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYY 159
           LS  K  K       F+V+  ++ +L+ +PV++F K++   S   K LL  EY+  P   
Sbjct: 131 LSPSKLKKLNPESASFDVETNFNEILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVA 190

Query: 160 IIELDKHAHGEELREYI---KSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           +++LDKH++G +L+EYI   K  T    +P L IN V+   ++ +K+ H  G LL + ++
Sbjct: 191 VVDLDKHSNGAKLQEYIRKNKLMTKDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKK 250

Query: 217 WSGGKFTVEQREKPSN 232
              GK   ++ E PSN
Sbjct: 251 LGNGKIMFKKIEAPSN 266

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 81.6 bits (200), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 78/133 (58%), Gaps = 10/133 (7%)

Query: 110 GTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHG 169
           G G  F+ ++ +  +++ +PV+IF KS+   S  LK LL  EY+  P   +++LD+H  G
Sbjct: 117 GLGLNFDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQG 176

Query: 170 EELREYIKS---TTGRG----TVPNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSG 219
           + L++YIK+   T+G       VP L INGVS    G  ++IK+  ++G LL  L+ ++ 
Sbjct: 177 QLLQKYIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFAS 236

Query: 220 GKFTVEQREKPSN 232
               +++++ PSN
Sbjct: 237 DNVMIQKKDMPSN 249

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 122/259 (47%), Gaps = 29/259 (11%)

Query: 3   LSNKRNARILSITMXXXXXVFFI--AQNANFLA-IETKE-EEKPPQLLD--IDKNXXXXX 56
           L+ KRN RI+S T+     V FI    N +F A I+    ++ P +L D  +  +     
Sbjct: 98  LNAKRNTRIVSATLALLGLVAFIMFTWNDSFEASIDMLPFKDVPFKLPDTLVSGSAAEDT 157

Query: 57  XXXXXXXVPTSTTNKGNSEVDEEINEIKQKV-GLQQPIASADDSLSAIKSDKGTGTG--- 112
                  +    TN    +V EEI  I+ ++ G  +   + +D     K     G     
Sbjct: 158 DKTNTPRIDVKETNDNVLKVWEEITNIRNELSGSDKGNFNLNDGAMNTKKKPSQGNAMRT 217

Query: 113 --------KGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELD 164
                   K F+ ++ ++ ++  +P ++F KS+ + S  L++LL+ EY+  P   +++LD
Sbjct: 218 KESSKLNVKPFDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLD 277

Query: 165 KHAHGEELREYIKS--------TTGRGTVPNLLING---VSRGGSEEIKRLHSQGKLLSS 213
           KH++G EL +YIK         T     VP L +NG   ++ G S++I +LH  G LL  
Sbjct: 278 KHSNGVELEQYIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEK 337

Query: 214 LQEWSGGKFTVEQREKPSN 232
           L+  S G     +++ PSN
Sbjct: 338 LRSLSDGHIMFVKKDHPSN 356

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 12/161 (7%)

Query: 80  INEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCS 139
            +EIK +  +         +L A+ S         FNVQQ ++ ++  +PV++F KS+  
Sbjct: 85  FDEIKSRTSIVSHQERPTTTLQALPSHAA-----AFNVQQHFTQIIHTSPVVLFMKSSQD 139

Query: 140 YSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIK--STTGRGT----VPNLLIN-G 192
            S+ +++LL+ EY+  P   +++LDKH HG  L++YI+      RGT    +P L IN  
Sbjct: 140 DSRLMRDLLQKEYEISPEIAVVDLDKHTHGAALQDYIRLNKLDNRGTAYVKLPYLFINEQ 199

Query: 193 VSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
                 + +K LH  G LL + ++ +G      +   PSN+
Sbjct: 200 FVHVDVKNVKSLHKDGALLKTFKDAAGENVFWHKTGVPSNS 240

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 89/168 (52%), Gaps = 19/168 (11%)

Query: 75  EVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFS 134
           +V++EI  IK ++     ++    S S I+S         FN +  +  +L+ +P+++F 
Sbjct: 77  KVNDEILTIKNQIKTTSILSPIPTSSSPIQS---------FNPEVNFFQILETSPMVLFI 127

Query: 135 KSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIK---------STTGRGTV 185
           KS+   SK ++++L  EY+  P   +++LDKH HG+EL E+I+          ++   ++
Sbjct: 128 KSSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEEFIRLNKLNEQAIFSSSLASL 187

Query: 186 PNLLINGVSRG-GSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSN 232
           P L +N VS    +  IK LHS+  L+   +  S GK   E++  PSN
Sbjct: 188 PYLFVNEVSMEIDTATIKDLHSKNFLIKKFELMSNGKVLFERKNPPSN 235

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 96/177 (54%), Gaps = 22/177 (12%)

Query: 75  EVDEEINEIKQKVGLQ-QPIASADDSLSAIKSDKGTGT-----GKGFNVQQEYSLMLDLA 128
           +VD+EI+ +++++  Q QP A  D      K  K   T        ++    ++ +++++
Sbjct: 106 KVDQEISAVRKEIDAQTQPTARGDRR----KKKKVLATELLADDAPWDPLSTFTEVMNMS 161

Query: 129 PVIIFSKST--CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRG--- 183
           PV++F KS+   S +  ++++L +EY+  P   +++LDKH +GEEL+ YI++    G   
Sbjct: 162 PVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEELQNYIETQKLPGGSS 221

Query: 184 -TVPNLLINGVSRGGSEEI------KRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
             +P L +N V   G+ EI      KRLHS G LL   ++ +  K   E+ E PSNN
Sbjct: 222 QQLPYLFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLAERKVLFEKIELPSNN 278

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 12/138 (8%)

Query: 107 KGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKH 166
           K     K F+ +  +  +++ +P ++F KS+   S  LK LL+ E++  P   I++L+KH
Sbjct: 145 KKNNNEKKFDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKH 204

Query: 167 AHGEELREYIK-------STTGRGTV--PNLLINGVS---RGGSEEIKRLHSQGKLLSSL 214
           ++G EL +YIK        +T    +  P L +NGVS    G + +I   HS+G LL  L
Sbjct: 205 SYGYELEKYIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVL 264

Query: 215 QEWSGGKFTVEQREKPSN 232
           +  +GG   VE+R+ PSN
Sbjct: 265 KSKAGGNLLVEKRDIPSN 282

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 73.2 bits (178), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 15/125 (12%)

Query: 124 MLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI------- 176
           +L+ +PVI+F KS+   S  LK +L  EY F P   +++LDKH  G+ ++EYI       
Sbjct: 157 ILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSMQEYIQLNRLAT 216

Query: 177 -KSTTGRGT----VPNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQRE 228
            KS  G  +    VP L INGVS   +   ++I   H+ G LLS L+  +  K ++ + +
Sbjct: 217 YKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHVADSKVSISKVD 276

Query: 229 KPSNN 233
            PSN+
Sbjct: 277 IPSNS 281

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 75/132 (56%), Gaps = 12/132 (9%)

Query: 113 KGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEEL 172
           K F+ + ++  ++  +P ++F KS+ + S  LK LL+ E++  P    ++L+KH+HG EL
Sbjct: 152 KKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYEL 211

Query: 173 REYIK-------STTGRGTV--PNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGG 220
            +YIK       ++    ++  P L +NG+S   RG   +I   HS+G LL  L+  + G
Sbjct: 212 EKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPLLKSEARG 271

Query: 221 KFTVEQREKPSN 232
              VE+++ PSN
Sbjct: 272 NLLVEKKDIPSN 283

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 71.2 bits (173), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 88/170 (51%), Gaps = 20/170 (11%)

Query: 80  INEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCS 139
           +N IK++      +A    S S++  D   GT   ++ ++ +  +++ +P ++F +S+  
Sbjct: 66  VNSIKKESNNLNSVAHTSMSSSSVAKD---GTVIEYDPEKNFKQIINTSPAVLFIRSSEY 122

Query: 140 YSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI-------------KSTTGR-GTV 185
            S  L++LL  +Y+  P   I++LDKH H   L  +I             KST+ +    
Sbjct: 123 ESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHKIKSTKVEVLKSTSVKQAKA 182

Query: 186 PNLLING---VSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSN 232
           P L ING   ++ G +++I + H +G+LL+ L+ ++G      +R+ PSN
Sbjct: 183 PYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENIVFNKRDLPSN 232

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 75/132 (56%), Gaps = 12/132 (9%)

Query: 113 KGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEEL 172
           K F+ +  +  ++  +P ++F KS+   S  LK LL+ E++  P    ++L+KH+HG +L
Sbjct: 155 KEFDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQL 214

Query: 173 REYIKS-------TTGRGTV--PNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGG 220
            +YIK        +T   ++  P L +NGVS    G +++I   HS+G LLS L+  + G
Sbjct: 215 EKYIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSEARG 274

Query: 221 KFTVEQREKPSN 232
              VE+++ PSN
Sbjct: 275 NLLVEKKDIPSN 286

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 104 KSDKGTGTGKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIEL 163
           K D        F+    Y  +++ + V++F KS+ S S  +K+LL + Y+ +P   I++L
Sbjct: 155 KYDINAYKNAAFDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDL 214

Query: 164 DKHAHGEELREYIKS----TTGRGT-------VPNLLINGVS--RGGSEEIKRLHSQGKL 210
           D+H  G  L +YI      T   G        VP L+INGVS     ++   +LH++G L
Sbjct: 215 DRHVQGALLHDYIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLL 274

Query: 211 LSSLQEWSGGKFTVEQREKPSN 232
           L  L+  +G    + +++ PSN
Sbjct: 275 LQKLKNLAGDSVMISKKDSPSN 296

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 73/133 (54%), Gaps = 12/133 (9%)

Query: 113 KGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEEL 172
           K F+ +  +  ++  +P ++F KS+ S S  L+ LL+ E++  P    ++L+KH+ G EL
Sbjct: 154 KNFDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYEL 213

Query: 173 REYIKST-------TGRGTV--PNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGG 220
            +YIK             ++  P L +NGVS    G  ++I   HS+G LLS L+  + G
Sbjct: 214 EKYIKQNKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARG 273

Query: 221 KFTVEQREKPSNN 233
              VE+++ PSN+
Sbjct: 274 NLLVEKKDIPSNS 286

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 87/168 (51%), Gaps = 12/168 (7%)

Query: 75  EVDEEINEIKQKVGLQQPI-ASADDSLSAIKSDKGTGTGKGFNVQQEYSLMLDLAPVIIF 133
           +V+E+I+ I   +    P     DD  S+ +    TG+   +N +  +  +L+ +P+++F
Sbjct: 87  KVEEQISTILNDITNHHPTKLPVDDIPSSTRDPNPTGS---YNPELNFKQILNTSPMVLF 143

Query: 134 SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS-----TTGRGTVPNL 188
            +S+   SK +K+L  +EY+  P + I++LD H +G  L+ YI++           VP L
Sbjct: 144 IRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNILQNYIQTKKIINKDDTLDVPYL 203

Query: 189 LINGVSRGGS---EEIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
            INGVS   S   ++I  LH    LL  L+  +G     +++  PSNN
Sbjct: 204 FINGVSVINSNLNKDIISLHVNDLLLDKLKSLAGDNVMFQKKGVPSNN 251

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 67/125 (53%), Gaps = 15/125 (12%)

Query: 124 MLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI------- 176
           +L+ +PV++F+K     S+ LK LL +EY+  P   I++L KH  G+EL++YI       
Sbjct: 157 ILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKHDQGDELQKYIMLNKLNT 216

Query: 177 -----KSTTGRGTVPNLLINGVS---RGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQRE 228
                 ++     VP L INGVS       ++IK  H+ G L+  L+ ++G K   ++  
Sbjct: 217 YNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTSGLLIEKLRSFAGEKVKFKRLS 276

Query: 229 KPSNN 233
            PSN+
Sbjct: 277 PPSNS 281

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 67/135 (49%), Gaps = 13/135 (9%)

Query: 112 GKGFNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEE 171
           G  F   Q +  ++  +P ++F K T   S+ L+ LL +EY+  P   +++L KH +  +
Sbjct: 79  GGDFRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGD 138

Query: 172 LREYIKSTTGRGT----------VPNLLING---VSRGGSEEIKRLHSQGKLLSSLQEWS 218
           L+ YI+     G           VP L + G   ++    ++I+  H +G+L + LQ  +
Sbjct: 139 LQRYIREHKLHGPLFQLTENTPDVPYLFVKGESVINTSVEKDIREPHERGQLQAELQRHA 198

Query: 219 GGKFTVEQREKPSNN 233
           G    +++R  PSN+
Sbjct: 199 GLDAVIKKRSPPSNS 213

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 18/177 (10%)

Query: 74  SEVDEEINEIKQKVGLQQPIAS-----ADDSLSAIKSDKGT--GTGKGFNVQQEYSLMLD 126
           S++  EI++       Q+ IA+     AD   S +    G    +G  F+    +S +L+
Sbjct: 100 SDIKHEISDSGSGSATQRAIATRVAATADIVRSEVVHGHGNYRASGSDFDAAASFSEILN 159

Query: 127 LAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIK-------ST 179
            +PV+IF  S    S+ L+ LL   Y+  P   +++L+KH+ G +L  +I+       S 
Sbjct: 160 TSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLESFIRLYKTDQTSN 218

Query: 180 TGRGTVPNLLINGVSRGGSE---EIKRLHSQGKLLSSLQEWSGGKFTVEQREKPSNN 233
                 P L +NG S   ++   +I+ LH+Q KLL  L+  + G+    +   PSN+
Sbjct: 219 PSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVAEGQVMFTRNNAPSNS 275

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 12/130 (9%)

Query: 115 FNVQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELRE 174
           F+    +  +L  +PV++F  S    S+ L+ LL+ +Y+  P   +++L+KH+ G +L  
Sbjct: 143 FDPAANFQEILSASPVVLFVDSAQD-SERLRALLQRDYEVSPAPAVVDLEKHSRGAQLET 201

Query: 175 YIK--------STTGRGTVPNLLINGVSRGGSE---EIKRLHSQGKLLSSLQEWSGGKFT 223
           YI+        +T      P L +NG S   S+   +I+ LH+Q +LL+ L+  + G   
Sbjct: 202 YIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEGNVM 261

Query: 224 VEQREKPSNN 233
             +   PSN+
Sbjct: 262 FARNNAPSNS 271

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           VIIF+KS C Y K  K  +  E   VP     +++LD   +G+E+++ + +  G+ TVP+
Sbjct: 48  VIIFAKSYCPYCKAAKHTIFEEIN-VPKSKALVLDLDLMDNGQEIQQALLAINGQKTVPH 106

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + ING   GG+ E+++++  G+L
Sbjct: 107 VYINGEFIGGNSEVQKIYKSGEL 129

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 124 MLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPN-YYIIELDKHAHGEELREYIKSTTGR 182
           M+D  PV I +KS C+ S   K  L  EY  + +   ++ELDK + GE +   +   + +
Sbjct: 12  MIDEKPVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSKISQQ 71

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKL 210
            T+PN+ I G   GG +++K ++  G+L
Sbjct: 72  STLPNIFIKGKHIGGYQDLKEMNESGEL 99

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 124 MLDLAPVIIFSKSTCSYSKGLKELLESEYQFV-PNYYIIELDKHAHGEELREYIKSTTGR 182
           M+   PV + +KS C + +  +E L  EY        ++ELD    G E++E +   T +
Sbjct: 13  MIGEKPVFVAAKSYCPHCRATRETLFEEYNLPREKALVLELDLMTDGAEIQEALAEITHQ 72

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKL 210
            TVPN+ I G   GG+ +++ L   G+L
Sbjct: 73  DTVPNIFIYGQHVGGNSDLQALKKDGQL 100

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 130 VIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNL 188
           + + SK+ C Y +  LK L E +       Y+++LD    G E++E +   +G+ TVPN+
Sbjct: 48  IFVASKTYCPYCQATLKLLFEDKKLTKDQVYVVQLDTIKEGSEIQEALAEISGQKTVPNV 107

Query: 189 LINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            I+G   GG+ +++ L S GKL + L++
Sbjct: 108 YISGEHIGGNSDLQALESSGKLDALLKK 135

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 124 MLDLAPVIIFSKSTCSYSKGLKELLESEYQFVP--NYYIIELDKHAHGEELREYIKSTTG 181
           M+    + + SKS C Y +  K+ L  E + VP     ++ELD+   G ++++ +    G
Sbjct: 46  MIGQKKIFVASKSYCPYCRAAKQTLFEELK-VPMDKAVVLELDEIEEGSDIQQALAEING 104

Query: 182 RGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           + TVPN+ I+G   GG+ ++++L   GKL   LQ+
Sbjct: 105 QNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQK 139

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 129 PVIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVP 186
           P+ +  KS C YSK   E L  +   VP     +I +D+  +G E+++ I   TG+ TVP
Sbjct: 28  PIFVARKSDCPYSKKTLETLFDDLH-VPKDKVLLITVDEIENGAEVKQAIIDYTGQKTVP 86

Query: 187 NLLINGVSRGGSEEIKRLHSQGKL 210
           N  ING   GG++++++L   G+L
Sbjct: 87  NTYINGRHIGGNDDLQKLKQTGEL 110

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 129 PVIIFSKSTCSYSKGLKELLESEYQFVP--NYYIIELDKHAHGEELREYIKSTTGRGTVP 186
           P+ + +KS C Y +  K  L  E   VP     +++LD+   G+ ++  +   T + TVP
Sbjct: 17  PIFVAAKSYCPYCQASKSTLFKELN-VPADKATVLDLDQMQDGQAIQAILAELTQQNTVP 75

Query: 187 NLLINGVSRGGSEEIKRLHSQGKL 210
           N+ ING   GG+ +++ L + G+L
Sbjct: 76  NIFINGKHIGGNSDLQALKNNGEL 99

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 48/83 (57%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +K+ C Y K     L  E   VP     ++ELD+ ++G E+++ ++  +G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + ING   GG+ +++ L   GKL
Sbjct: 112 VYINGKHIGGNSDLETLKKNGKL 134

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 3/88 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +K+ C Y K     L  E   VP     ++ELD+ ++G E+++ ++  +G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 188 LLINGVSRGGSEEIKRLHSQGKLLSSLQ 215
           + ING   GG+ +++ L   GKL   L+
Sbjct: 112 VYINGKHIGGNSDLETLKKNGKLAEILK 139

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 50/88 (56%), Gaps = 3/88 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +K+ C Y K     L  E   VP     ++ELD+ ++G E+++ ++  +G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKAVVLELDEMSNGSEIQDALEEISGQKTVPN 111

Query: 188 LLINGVSRGGSEEIKRLHSQGKLLSSLQ 215
           + ING   GG+ +++ L   GKL   L+
Sbjct: 112 VYINGKHIGGNSDLEALKKNGKLAELLK 139

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 50/83 (60%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +KS C Y +   + L ++Y  VP     +++L++   G++++  +   TG+ TVPN
Sbjct: 51  VFVAAKSYCPYCQASLQTLFTDYH-VPKDKSLVLQLNQMEDGDDIQAALAEITGQRTVPN 109

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + I+G   GG+ ++++L S GKL
Sbjct: 110 IYIDGKHIGGNSDLQQLKSSGKL 132

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 48/83 (57%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +K+ C Y K     L  E   VP     ++ELD+ ++G E+++ ++  +G+ TVPN
Sbjct: 53  VFVAAKTYCPYCKATLSTLFQELN-VPKSKALVLELDEMSNGSEIQDALEEISGQRTVPN 111

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + ING   GG+ +++ L   GKL
Sbjct: 112 VYINGKHIGGNSDLESLKKSGKL 134

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 56/95 (58%), Gaps = 4/95 (4%)

Query: 124 MLDLAPVIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           +++ + + + SK+ C Y +  LK L E +        +++L++   G ++++ +   TG+
Sbjct: 13  LINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALAEITGQ 72

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQG---KLLSSL 214
            TVPN+ ING   GG+ +++ L++ G   KLL+SL
Sbjct: 73  KTVPNIFINGKHIGGNSDLQELNNSGDLDKLLASL 107

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 129 PVIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVP 186
           P+ + SK+ C Y +   + L  E + +P     +++LD+   G E++E +    G+ TVP
Sbjct: 66  PIFVASKTYCPYCRATLKTLFKELE-IPESEAVVLQLDEMPDGPEIQEALFDINGQKTVP 124

Query: 187 NLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           N+ I G   GG+++++ L   GKL   L+E
Sbjct: 125 NIYIKGQHIGGNDDLQTLKKAGKLEGLLKE 154

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (58%), Gaps = 3/87 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           +I+F+KS C YS   +  L ++ + VP     ++ELD    G+E+++ + +  G+ TVP+
Sbjct: 48  IIVFAKSYCPYSIATRRTLFNDCK-VPQSKALVLELDLMQDGQEIQQALLAINGQKTVPH 106

Query: 188 LLINGVSRGGSEEIKRLHSQGKLLSSL 214
           + I G   GG+ E++++   G+L   L
Sbjct: 107 VYIAGEFIGGNHELQQIFQSGELQKKL 133

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + SKS C YSK     L +E   VP     ++++++   G ++++ +   TG+ TVPN
Sbjct: 19  VFVASKSYCPYSKAALNTLFTELN-VPTSKALVLQVNQLPEGSDIQDALLELTGQRTVPN 77

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + I G   GG+++++ L   GKL
Sbjct: 78  IYIKGKHIGGNDDLQILKQSGKL 100

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLL 189
           V+IFSK+ C Y K   +  +     V    +++LDK   G E+++ +    G+ TVP++ 
Sbjct: 19  VVIFSKTFCPYCKATLKTFDEARLPVGLVRVLQLDKLDDGSEIQDALYELNGQKTVPSIY 78

Query: 190 INGVSRGGSEEIKRLHSQGKL 210
           I     GG+ E+++L  +G L
Sbjct: 79  ILKRHIGGNSELQKLKHEGVL 99

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 112 GKGFN-------VQQEYSLMLDLAPVIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIEL 163
           G GF+       VQ   SL+ D   + + +K+ C Y    LK L + +        +++L
Sbjct: 24  GSGFSKMASPQTVQHVRSLIKD-NKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQL 82

Query: 164 DKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKL 210
           D    G E++E +   +G+ TVPN+ I G   GG+ +++ L + GKL
Sbjct: 83  DTMKEGSEIQEALTEISGQRTVPNIYILGEHIGGNSDLQALEASGKL 129

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEE---LREYIKSTTGRGTVP 186
           V I SK+ C Y +  K  L  E + VP   +  L+    GEE   ++  ++  +G+ TVP
Sbjct: 19  VFIASKTYCPYCQAAKRTLLEEKR-VPASAVKLLELDTMGEEGAVIQAALQELSGQRTVP 77

Query: 187 NLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           N+ ING   GG+ +++ L + G+L   L+E
Sbjct: 78  NIYINGRHVGGNSDLEALKASGELDQLLEE 107

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFV-PNYYIIELDKHAHGEELREYIKSTTGRGTVPNL 188
           + + SK+ C Y +   + L ++ QF      +++L+    G+++++ +    G+ TVPN+
Sbjct: 53  LFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTIDDGQDIQDALYEINGQRTVPNI 112

Query: 189 LINGVSRGGSEEIKRLHSQGKLLSSLQ 215
            I+G   GG+ +++ L++ GKL + L+
Sbjct: 113 YIDGKHIGGNSDLQELNASGKLQALLK 139

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 111 TGKGFNVQQEYSLMLDLAP---VIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKH 166
           T K    QQ  + + DL     + + SK+ C Y +  LK L +          +++L+  
Sbjct: 31  TAKKMVSQQTITRVKDLIAKNKIFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTM 90

Query: 167 AHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
             G E++E +    G+ +VPN+ I+G   GG+ +++ L + GKL   L+E
Sbjct: 91  DDGAEIQEALFEINGQKSVPNIYIDGKHIGGNSDLQELKNAGKLDEVLKE 140

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 3/103 (2%)

Query: 116 NVQQEYSLMLDLAPVIIFSKSTCSYSKGLKE-LLESEYQFVPNYYIIELDKHAH-GEELR 173
            VQQ  SL +  + + + SK+ C Y +  K+ L E +   +P   ++ELD     G +++
Sbjct: 54  TVQQVQSL-IKQSKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQEGVDIQ 112

Query: 174 EYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
             +   +G+ TVPN+ I G   GG+ E++ L S G+L   L+E
Sbjct: 113 AALLELSGQRTVPNIYIGGKHIGGNSELQALESSGELDGLLKE 155

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 125 LDLAPVIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRG 183
           +D   V +  K+ C Y K  +  LL+          +++L++  HG E++E +    G+ 
Sbjct: 43  IDDNAVFVAVKTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQK 102

Query: 184 TVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           TVP++ IN +  GG+ +++ L   GKL + L E
Sbjct: 103 TVPHIYINQIFIGGNSDLEELRVSGKLRNLLGE 135

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           V + +KS C Y K     L  E + VP     +++LD  + G EL++ ++   G+ TVP 
Sbjct: 48  VFVAAKSYCPYCKNTLITLFDELK-VPKEKALVLQLDGMSDGLELQDTLQQINGQRTVPQ 106

Query: 188 LLINGVSRGGSEEIKRLHSQG 208
           + I+G   GG+ E+++L   G
Sbjct: 107 IYIDGKHVGGNSELQKLKKSG 127

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 53/90 (58%), Gaps = 5/90 (5%)

Query: 130 VIIFSKSTCSYSKG-LKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVP 186
           + + SK+ C Y +  L+ L + +   VPN    +++L++   G E+++ ++  +G+ TVP
Sbjct: 75  IFVASKTYCPYCQATLRTLFDDKK--VPNDKIKVLQLNQLDDGAEIQDALQEISGQRTVP 132

Query: 187 NLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           N+ I G   GG+ +++ L + G+L   L+E
Sbjct: 133 NIYILGKHIGGNSDLQELAAAGELDRLLEE 162

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 124 MLDLAPVIIFSKSTCSYS-KGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           M++   + I SK+ C Y    +K L E          +++L++   G +++E +    G+
Sbjct: 13  MINEKEIFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEINGQ 72

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKL 210
            TVPN+ ING   GG+ +++ L   G+L
Sbjct: 73  KTVPNIYINGKHIGGNSQLQDLKESGEL 100

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 3/83 (3%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           + + SK+ C Y     + L  E   VP     +++L++   G E+++ +    G+ TVPN
Sbjct: 19  IFVASKTYCPYCHATIKTLFKELN-VPKSKALVLQLNEMDDGAEIQQALFEINGQKTVPN 77

Query: 188 LLINGVSRGGSEEIKRLHSQGKL 210
           + ING   GG+++++ L   G+L
Sbjct: 78  IYINGKHVGGNDKLQDLKESGEL 100

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 40.4 bits (93), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +SK   +LL  +     +F   Y ++E        ELR+ IK 
Sbjct: 43  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELRDAIKE 95

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 96  FTEWPTIPQLFVNKEFVGGCDVITSMSRSGELAEVLEE 133

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+    LL  E      +    +       ELR+ IK  T  
Sbjct: 38  APVVLFMKGTPDAPKCGFSRATVALLGYEGLNPSKFKAFNILDDV---ELRDGIKEYTDW 94

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T+P L +NG   GG + I  +   G L S  +E
Sbjct: 95  PTIPQLFVNGEFIGGCDVIVSMSKNGDLNSVFEE 128

>NDAI0C05390 Chr3 complement(1246280..1246714) [435 bp, 144 aa] {ON}
           Anc_8.519
          Length = 144

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 8/94 (8%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+    +L  E    PN +  +        ELRE IK  T  
Sbjct: 43  APVVLFMKGTPEFPKCGFSRATIGILGYE-GIDPNKF--KAFNVLDDAELREGIKEFTQW 99

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T+P L +N    GG + I  +   G+L S  +E
Sbjct: 100 PTIPQLFVNKEFIGGCDVIVSMSKSGELTSVFEE 133

>NCAS0C02240 Chr3 (417174..417659) [486 bp, 161 aa] {ON} Anc_8.519
          Length = 161

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +SK   +LL  +     +F   Y ++E        ELRE IK 
Sbjct: 46  APVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFA-AYNVLE------DPELREAIKE 98

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T   T+P L +     GG + I  +   G+L   L E
Sbjct: 99  FTEWPTIPQLFVENEFVGGCDVITSMARSGELAELLDE 136

>KNAG0A02090 Chr1 (175247..175696) [450 bp, 149 aa] {ON} Anc_8.519
           YPL059W
          Length = 149

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +SK    LL  +     +F   Y ++E        ELR  IK 
Sbjct: 42  APVVLFMKGTPEFPQCGFSKATINLLGKQGVDPAKFA-AYNVLE------DPELRTAIKE 94

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 95  FSDWPTIPQLYVNNEFVGGCDVITSMAKSGELADVLEE 132

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 130 VIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNL 188
           + + SK+ C Y    L  L +          +++L++   G +++  +    G+ TVPN+
Sbjct: 225 IFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLNGQRTVPNI 284

Query: 189 LINGVSRGGSEEIKRLHSQGKL 210
            ING   GG+++++ L   G+L
Sbjct: 285 YINGKHIGGNDDLQELRETGEL 306

>KLTH0A04004g Chr1 complement(335054..336622) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
           4-P- transferase) cytoplasmic enzyme that catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis expression regulated by Gcn4p and
           the general control of amino acid synthesis
          Length = 522

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 163 LDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS--GG 220
           LD HA GE +   I  T   G VP  L+NGV RG ++    L + G     LQ W    G
Sbjct: 197 LDLHAKGEPVVPVI--TGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVDG 254

Query: 221 KFTVEQREKP 230
            FT + R+ P
Sbjct: 255 IFTADPRKVP 264

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 36.6 bits (83), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 130 VIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNL 188
           + + SK+ C Y    L  L E          +++L++   G E++  +    G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEINGQRTVPNI 78

Query: 189 LINGVSRGGSEEIK 202
            ING   GG+++++
Sbjct: 79  YINGKHIGGNDDLQ 92

>KAFR0A01190 Chr1 complement(230841..231314) [474 bp, 157 aa] {ON}
           Anc_8.519 YPL059W
          Length = 157

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    +L  +     +F   Y ++E        ELR+ IK 
Sbjct: 46  APVVLFMKGTPEFPQCGFSRATIAMLGQQGVNPAKFA-AYNVLE------DPELRDAIKE 98

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  + + G+L   L+E
Sbjct: 99  FSNWPTIPQLYVNKEFVGGCDVITTMATSGELADVLEE 136

>TPHA0B03340 Chr2 (770614..771363) [750 bp, 249 aa] {ON} Anc_8.240
           YDR098C
          Length = 249

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 11/81 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K       C +S+ L  +L  EYQ    ++ I  D     + +R+ +K  +  
Sbjct: 160 APVMLFMKGNPTEPKCGFSRQLVGILR-EYQLRFGFFDILKD-----DSVRQGLKKFSDW 213

Query: 183 GTVPNLLINGVSRGGSEEIKR 203
            T P L ING  +GG + IKR
Sbjct: 214 PTFPQLYINGEFQGGLDIIKR 234

>Suva_16.255 Chr16 (447649..448098) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 16/101 (15%)

Query: 125 LDLAPVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREY 175
           +D APV++F K T     C +S+    LL ++     +F   Y ++E        ELRE 
Sbjct: 42  IDSAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPELREG 94

Query: 176 IKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           IK  +   T+P L +N    GG + I  +   G+L   L E
Sbjct: 95  IKEFSEWPTIPQLYVNKEFVGGCDVITSMARSGELAELLDE 135

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 35.4 bits (80), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 130 VIIFSKSTCSYSKG-LKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNL 188
           + + SK+ C Y    L  L E          +++L+    G +++  +    G+ TVPN+
Sbjct: 19  IFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEINGQRTVPNI 78

Query: 189 LINGVSRGGSEEIK 202
            ING   GG+++++
Sbjct: 79  YINGKHIGGNDDLQ 92

>CAGL0M07271g Chr13 (731627..732076) [450 bp, 149 aa] {ON} similar
           to uniprot|Q02784 Saccharomyces cerevisiae YPL059w GRX5
          Length = 149

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE---YQFVPNYYIIELDKHAHGEELREYIKST 179
           APV++F K T     C +S+    +L  +    +    Y ++E        ELRE IK  
Sbjct: 45  APVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLE------DPELREGIKEF 98

Query: 180 TGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 99  SNWPTIPQLYVNKEFIGGCDVITSMARSGELADVLEE 135

>TPHA0L01520 Chr12 complement(319260..319712) [453 bp, 150 aa] {ON}
           Anc_8.519 YPL059W
          Length = 150

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPN----YYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+   E+L+ +    PN    Y ++E        ELR+ IK 
Sbjct: 45  APVVLFMKGTPEFPQCGFSRATIEILDHQ-GIDPNKFAAYNVLE------DPELRDGIKE 97

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + +  +   G L   L E
Sbjct: 98  FSEWPTIPQLYLNKEFVGGCDILTTMAQNGDLAELLDE 135

>Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON}
           complement(30908..31351) [444 nt, 148 aa]
          Length = 147

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 128 APVIIFSKST-----CSYSKGLKELLES---EYQFVPNYYIIELDKHAHGEELREYIKST 179
           APV++F K T     C +S+    +L     + Q    Y ++E        ELR+ IK  
Sbjct: 47  APVVLFMKGTPEFPQCGFSRATINILGQQGVDPQKFAAYNVLE------DPELRQGIKEY 100

Query: 180 TGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 101 SEWPTIPQLYVNKEFVGGCDIITTMAQDGQLADLLEE 137

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 34.7 bits (78), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 130 VIIFSKSTCSYSKGLKELLESEYQFVPN--YYIIELDKHAHGEELREYIKSTTGRGTVPN 187
           + + SK+ C Y       L  + + VP     +++L++   G +++  +    G+ TVPN
Sbjct: 19  IFVASKTYCPYCHAALNTLFQQLK-VPKSKVLVLQLNEMEDGADIQAALYEINGQRTVPN 77

Query: 188 LLINGVSRGGSEEIK 202
           + ING   GG+++++
Sbjct: 78  VYINGKHIGGNDDLQ 92

>Skud_16.224 Chr16 (408961..409410) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    LL ++     +F   Y ++E        ELRE IK 
Sbjct: 45  APVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPELREGIKE 97

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 98  FSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>Skud_4.356 Chr4 complement(621126..621881,621915..621947) [789 bp,
           262 aa] {ON} YDR098C (REAL)
          Length = 262

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F K +     C +S+ L  +L  E+Q    ++ I  D     + +R+++K 
Sbjct: 169 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQVRFGFFDILRD-----DSVRQHLKK 222

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 223 FSEWPTFPQLYINGEFQGGLDIIK 246

>YER174C Chr5 complement(538434..539168) [735 bp, 244 aa] {ON}
           GRX4Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx3p and
           Grx5p; protects cells from oxidative damage; mutant has
           increased aneuploidy tolerance; transcription is
           regulated by Yap5
          Length = 244

 Score = 35.8 bits (81), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           ++  APV++F K +     C +S+ L  +L  E+Q    ++ I  D     E +R+ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQIRFGFFDILRD-----ENVRQSLKK 205

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>AGR111W Chr7 (947498..948211) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER174C (GRX4) and
           YDR098C (GRX3)
          Length = 237

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  E+Q    ++ I  D     E +R+ +K+ +  
Sbjct: 148 APVMLFMKGTPSEPKCGFSRQMVGILR-EHQVRFGFFDILKD-----ESVRQGLKTFSDW 201

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L ING  +GG + IK
Sbjct: 202 PTFPQLYINGEFQGGLDIIK 221

>KLLA0B09636g Chr2 (836265..836693) [429 bp, 142 aa] {ON} similar to
           uniprot|Q02784 Saccharomyces cerevisiae YPL059W GRX5
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 142

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    +L  +     +F   Y ++E        ELRE IK 
Sbjct: 42  APVVLFMKGTPEFPQCGFSRATINMLGQQGVDPVKFA-AYNVLE------DPELREGIKE 94

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + +  +   G+L   L+E
Sbjct: 95  ISEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLEE 132

>Smik_16.178 Chr16 (319960..320409) [450 bp, 149 aa] {ON} YPL059W
           (REAL)
          Length = 149

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    LL ++     +F   Y ++E        ELRE IK 
Sbjct: 45  APVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPELREGIKE 97

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 98  FSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>ZYRO0F08932g Chr6 complement(723285..723728) [444 bp, 147 aa] {ON}
           similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide-radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 147

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +SK    LL  +     +F   Y ++E        ELRE IK 
Sbjct: 48  APVVLFMKGTPEFPQCGFSKATISLLGQQGVDPMKFA-AYNVLE------DPELREGIKE 100

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + +  +   G L + L++
Sbjct: 101 YSEWPTIPQLYVNKEFVGGCDILTTMAQSGDLCNLLEQ 138

>YPL059W Chr16 (444579..445031) [453 bp, 150 aa] {ON}
           GRX5Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; mitochondrial
           matrix protein involved in the synthesis/assembly of
           iron-sulfur centers; monothiol glutaredoxin subfamily
           member along with Grx3p and Grx4p
          Length = 150

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    LL ++     +F   Y ++E        ELRE IK 
Sbjct: 45  APVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFA-AYNVLE------DPELREGIKE 97

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  +   G+L   L+E
Sbjct: 98  FSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEE 135

>Kwal_27.11948 s27 complement(1014824..1015234) [411 bp, 136 aa]
           {ON} YPL059W (GRX5) - Protein with glutaredoxin activity
           [contig 26] FULL
          Length = 136

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    +L  +     +F   Y ++E        ELRE IK 
Sbjct: 36  APVVLFMKGTPEFPQCGFSRATVGMLGQQGVDPLKFA-AYNVLE------DPELREGIKE 88

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + I  +   G+L   L++
Sbjct: 89  LSDWPTIPQLYVNEEFVGGCDIITSMAQTGELTKLLED 126

>Smik_4.339 Chr4 complement(610713..611480,611484..611513) [798 bp,
           265 aa] {ON} YDR098C (REAL)
          Length = 265

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F K +     C +S+ L  +L  E+Q    ++ I  D     E +R+ +K 
Sbjct: 172 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQVRFGFFDILRD-----ESVRQNLKK 225

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 226 FSEWPTFPQLYINGEFQGGLDIIK 249

>CAGL0L11990g Chr12 complement(1291224..1291952) [729 bp, 242 aa]
           {ON} similar to uniprot|P32642 Saccharomyces cerevisiae
           YER174c member of the subfamily of yeast glutaredoxins
          Length = 242

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 13/113 (11%)

Query: 97  DDSLSAIKSDKGTGTGKGFNVQQEYSL--MLDLAPVIIFSKST-----CSYSKGLKELLE 149
           D+    IKSD      + F  +   SL  +++ APV++F K +     C +S+ +  +L 
Sbjct: 120 DEDSQDIKSDDTLQEPEDFYSEDTESLDKLVNAAPVMVFIKGSPSDPKCGFSRQMVNILR 179

Query: 150 SEYQFVPNYYIIELDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIK 202
           S +Q    ++ I  DK       R+ +K  +   T P L ING   GG + +K
Sbjct: 180 S-HQIRFGFFDILKDKIT-----RQQLKDYSDWPTFPQLYINGEFEGGLDIVK 226

>SAKL0H17710g Chr8 (1565867..1566592) [726 bp, 241 aa] {ON} similar
           to uniprot|Q03835 Saccharomyces cerevisiae YDR098C GRX3
           Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase monothiol
           glutaredoxin subfamily member along with Grx4p and Grx5p
           protects cells from oxidative damage
          Length = 241

 Score = 35.4 bits (80), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  E+Q    ++ I  D     + +R+ +KS +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGILR-EHQVRFGFFDILKD-----DAVRQGLKSFSDW 204

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L +NG  +GG + IK
Sbjct: 205 PTFPQLYVNGEFQGGLDIIK 224

>ADR053W Chr4 (804734..805150) [417 bp, 138 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL059W (GRX5)
          Length = 138

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +SK   E+L  +      +    + + +   ELR  IK  +  
Sbjct: 39  APVVLFMKGTPEFPQCGFSKAAIEILGRQGVDPAKFAAFNVLEDS---ELRSGIKEYSEW 95

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS 218
            T+P L +N    GG + +  +   G+L + L+E S
Sbjct: 96  PTIPQLYVNKEFVGGCDILTNMAQSGELTTMLEEAS 131

>Suva_5.308 Chr5 complement(506262..506996) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           ++  APV++F K +     C +S+ L  +L  E+Q    ++ I  D     + +R+ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQIRFGFFDILRD-----DNVRQSLKK 205

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>Skud_5.313 Chr5 complement(523537..524271) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           ++  APV++F K +     C +S+ L  +L  E+Q    ++ I  D     + +R+ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQIRFGFFDILRD-----DNVRQSLKK 205

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 110

 Score = 33.9 bits (76), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 138 CSYSKGLKELLESEYQFVPNYYIIELDK---HAHGEELREYIKSTTGRGTVPNLLINGVS 194
           C Y+  + +    +Y  +   Y+ ++ K      G   R+     +G   +P + +NG  
Sbjct: 28  CVYANSIWK----KYGVLDKVYLFDIAKLPTREEGNAYRDAFHKISGIRWLPTIFVNGTK 83

Query: 195 RGGSEEIKRLHSQGKLLSSLQE 216
            G   +++RL  +GKL+  L++
Sbjct: 84  WGTEADLRRLDKEGKLVDELKK 105

>KLLA0C17842g Chr3 complement(1588951..1589745) [795 bp, 264 aa]
           {ON} similar to uniprot|Q03835 Saccharomyces cerevisiae
           YDR098C GRX3 Hydroperoxide and superoxide-radical
           responsive glutathione-dependent oxidoreductase
           monothiol glutaredoxin subfamily member along with Grx4p
           and Grx5p protects cells from oxidative damage
          Length = 264

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  E+Q    ++ I  D     E +R+ +K  +  
Sbjct: 175 APVMLFMKGTPSEPKCGFSRQMVGILR-EHQIRFGFFDILKD-----ENVRQGLKKFSDW 228

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L ING  +GG + IK
Sbjct: 229 PTFPQLYINGEFQGGLDIIK 248

>Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           ++  APV++F K +     C +S+ L  +L  E+Q    ++ I  D     + +R+ +K 
Sbjct: 152 LVQAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQIRFGFFDILRD-----DNVRQSLKK 205

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>YDR098C Chr4 complement(644178..645035) [858 bp, 285 aa] {ON}
           GRX3Hydroperoxide and superoxide-radical responsive
           glutathione-dependent oxidoreductase; monothiol
           glutaredoxin subfamily member along with Grx4p and
           Grx5p; protects cells from oxidative damage; evidence
           exists indicating that the translation start site is not
           Met1 as currently annotated, but rather Met36
          Length = 285

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F K +     C +S+ L  +L  E+Q    ++ I  D     E +R+ +K 
Sbjct: 192 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILR-EHQVRFGFFDILRD-----ESVRQNLKK 245

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 246 FSEWPTFPQLYINGEFQGGLDIIK 269

>TBLA0H03500 Chr8 complement(857008..857457) [450 bp, 149 aa] {ON}
           Anc_8.519 YPL059W
          Length = 149

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    LL  +     +F   + ++E        ELR  IK 
Sbjct: 46  APVVLFMKGTPEFPQCGFSRATISLLGQQGVDPAKFA-AFNVLE------DPELRNGIKE 98

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T   T+P L +N    GG + I  +   G+L   L++
Sbjct: 99  YTEWPTIPQLFVNKEFVGGCDIITNMSQSGELAKLLED 136

>TDEL0B01180 Chr2 (214316..214753) [438 bp, 145 aa] {ON} Anc_8.519
           YPL059W
          Length = 145

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+   ++L  +     +F   Y ++E        ELRE IK 
Sbjct: 45  APVVLFMKGTPEFPQCGFSRATIQMLGQQGVDPAKFA-AYNVLE------DPELREGIKE 97

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +     GG + +  +   G L S L+E
Sbjct: 98  YSEWPTIPQLYVKKEFIGGCDILTSMAQSGDLASLLEE 135

>TBLA0A08230 Chr1 complement(2028254..2028580) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 33.1 bits (74), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 138 CSYSKGLKELLESEYQFVPN--YYIIELDKHAHGE--ELREYIKSTTGRGTVPNLLINGV 193
           C YSK + E +      +P    Y  E+  ++  E  E R  +K   G G +P+++I+G 
Sbjct: 27  CKYSKRVYEKMN-----IPQDKIYFFEISGYSKKEQSECRAALKKIIGTGNLPSIMIDGK 81

Query: 194 SRGGSEEIKRLHSQGKL 210
             G  +E+  L  +G+L
Sbjct: 82  LWGTEKELHELEDKGEL 98

>SAKL0H10626g Chr8 (914158..914589) [432 bp, 143 aa] {ON}
           uniprot|Q6YFE4 Saccharomyces kluyveri Glutaredoxin
          Length = 143

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +SK    +L  +     +F   Y ++E        ELRE +K 
Sbjct: 43  APVVLFMKGTPEFPQCGFSKATINMLGQQGVDPMKFA-AYNVLE------DAELREGVKE 95

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + +  +   G+L   L++
Sbjct: 96  FSEWPTIPQLYVNKEFVGGCDIVMNMAQTGELAKLLED 133

>KLTH0E12034g Chr5 complement(1069449..1069859) [411 bp, 136 aa]
           {ON} similar to uniprot|Q02784 Saccharomyces cerevisiae
           YPL059W GRX5 Hydroperoxide and superoxide- radical
           responsive glutathione-dependent oxidoreductase
           mitochondrial matrix protein involved in the
           synthesis/assembly of iron-sulfur centers monothiol
           glutaredoxin subfamily member along with Grx3p and Grx4p
          Length = 136

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 16/98 (16%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESE----YQFVPNYYIIELDKHAHGEELREYIKS 178
           APV++F K T     C +S+    LL  +     +F   Y ++E        ELRE IK 
Sbjct: 36  APVVLFMKGTPEFPQCGFSRATVSLLGQQGVDPLKFA-AYNVLE------DPELREGIKE 88

Query: 179 TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            +   T+P L +N    GG + +  +   G+L   L++
Sbjct: 89  LSEWPTIPQLYVNEEFIGGCDILVSMAQSGELTKLLED 126

>NDAI0J01510 Chr10 (348743..349480) [738 bp, 245 aa] {ON} Anc_8.240
          Length = 245

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIF-----SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F     S+  C +S+ +  +L  E+Q    ++ I  D       +RE +K 
Sbjct: 152 LVNAAPVMLFMKGNPSEPKCGFSRQIVGILR-EHQVRFGFFDILRDT-----SVRESLKK 205

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 206 FSDWPTFPQLYINGEFQGGLDIIK 229

>KLTH0G14234g Chr7 (1233911..1234633) [723 bp, 240 aa] {ON} similar
           to uniprot|Q03835 Saccharomyces cerevisiae YDR098C GRX3
           Hydroperoxide and superoxide- radical responsive
           glutathione-dependent oxidoreductase monothiol
           glutaredoxin subfamily member along with Grx4p and Grx5p
           protects cells from oxidative damage
          Length = 240

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  EYQ    ++ I  D     + +R+ +K  +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGILR-EYQVRFGFFDILKD-----DSIRQGLKKFSDW 204

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L I+G  +GG + IK
Sbjct: 205 PTFPQLYISGEFQGGLDIIK 224

>Kwal_56.23506 s56 complement(577407..578129) [723 bp, 240 aa] {ON}
           YER174C (GRX4) - Protein with glutaredoxin activity
           [contig 176] FULL
          Length = 240

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  EYQ    ++ I  D     + +R+ +K  +  
Sbjct: 151 APVMLFMKGTPSEPKCGFSRQMVGILR-EYQVRFGFFDILKD-----DSIRQGLKKFSDW 204

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L I+G  +GG + IK
Sbjct: 205 PTFPQLYISGEFQGGLDIIK 224

>KLLA0B07975g Chr2 complement(705661..705996) [336 bp, 111 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W
          Length = 111

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 155 VPNYYIIEL-DKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSS 213
           + NY I E+ +  +   E+R+  +  TG   +P L ++G   G   E+ R    G L   
Sbjct: 44  IFNYDIAEVTNSRSEWNEIRDAFQKATGSRNLPTLYVDGKVWGTESELARFERNGTLKEE 103

Query: 214 LQE 216
           LQ+
Sbjct: 104 LQK 106

>Kwal_47.18163 s47 complement(714420..715988) [1569 bp, 522 aa] {ON}
           YER052C (HOM3) - Aspartate kinase (L-aspartate
           4-P-transferase) (EC 2.7.2.4) [contig 197] FULL
          Length = 522

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 163 LDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS--GG 220
           L+ H+ G  +   I  T   G VP  L+NGV RG ++    L + G     LQ W    G
Sbjct: 197 LEAHSQGTPVVPVI--TGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVDG 254

Query: 221 KFTVEQREKP 230
            FT + R+ P
Sbjct: 255 IFTADPRKVP 264

>TPHA0A01910 Chr1 (386720..387445) [726 bp, 241 aa] {ON} Anc_8.240
           YDR098C
          Length = 241

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 13/86 (15%)

Query: 123 LMLDLAPVIIFSKST-----CSYSKGLKELL-ESEYQFVPNYYIIELDKHAHGEELREYI 176
           ++ + APV++F K T     C +S+ +  +L E+  +F   Y+ I  DK      +R+ +
Sbjct: 148 MLTNAAPVMVFLKGTPSDPKCGFSRQIIGILRENNLRF--GYFDILKDKS-----VRDGL 200

Query: 177 KSTTGRGTVPNLLINGVSRGGSEEIK 202
           K+ +   T P L ING  +GG + IK
Sbjct: 201 KAFSDWPTFPQLYINGEFQGGLDIIK 226

>Ecym_1187 Chr1 (384530..384949) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii ADR053W
          Length = 139

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+   ++L  +      +    + +H    ELRE IK  +  
Sbjct: 40  APVVLFMKGTPEFPQCGFSRASIQILGQQGVDPSKFAAYNVLEHP---ELREGIKEYSEW 96

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
            T+P L IN    GG + +  +   G+L   L++
Sbjct: 97  PTIPQLYINKEFIGGCDILTNMAQSGELAELLEK 130

>Suva_2.257 Chr2 complement(443608..444366) [759 bp, 252 aa] {ON}
           YDR098C (REAL)
          Length = 252

 Score = 33.5 bits (75), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 13/85 (15%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELL-ESEYQFVPNYYIIELDKHAHGEELREYIK 177
           +++ APV++F K +     C +S+ L  +L E E +F   ++ I  D     + +R+ +K
Sbjct: 159 LVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHEVRF--GFFDILRD-----DAVRQNLK 211

Query: 178 STTGRGTVPNLLINGVSRGGSEEIK 202
             +   T P L ING  +GG + IK
Sbjct: 212 KFSEWPTFPQLYINGEFQGGLDIIK 236

>KNAG0H03030 Chr8 complement(568120..568830) [711 bp, 236 aa] {ON}
           Anc_8.240 YDR098C
          Length = 236

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           ++  APV++F K +     C +S+ +  +L  E+Q    ++ I  D       +RE +K+
Sbjct: 141 LVSAAPVMLFMKGSPSEPKCGFSRQIVGILR-EHQVRFGFFDILRDS-----TVRENLKN 194

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 195 FSDWPTFPQLYINGEFQGGLDIIK 218

>NCAS0B03970 Chr2 (711785..712498) [714 bp, 237 aa] {ON} Anc_8.240
          Length = 237

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIF-----SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F     S+  C +S+ +  +L  E+Q    ++ I  D       +RE +K 
Sbjct: 144 LVNAAPVMLFMKGNPSEPKCGFSRQIVGILR-EHQVRFGFFDILRDN-----SIREQLKK 197

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L +NG  +GG + IK
Sbjct: 198 FSDWPTFPQLYMNGEFQGGLDIIK 221

>KAFR0A02360 Chr1 (488402..489112) [711 bp, 236 aa] {ON} Anc_8.240
           YDR098C
          Length = 236

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 122 SLMLDLAPVIIF-----SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI 176
           S ++  APV++F     S+  C +S+ +  +L  E+Q    ++ I  D     + +R+ +
Sbjct: 141 SKLVKAAPVMLFMKGNPSEPKCGFSRQIVGILR-EHQVRFGFFDILKD-----DAIRQSM 194

Query: 177 KSTTGRGTVPNLLINGVSRGGSEEIK 202
           K  +   T P L ING  +GG + IK
Sbjct: 195 KKFSDWPTFPQLYINGEFQGGLDIIK 220

>SAKL0F08294g Chr6 complement(633032..634603) [1572 bp, 523 aa] {ON}
           highly similar to uniprot|P10869 Saccharomyces
           cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
           4-P- transferase) cytoplasmic enzyme that catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis expression regulated by Gcn4p and
           the general control of amino acid synthesis
          Length = 523

 Score = 33.1 bits (74), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 163 LDKHAHGEELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS--GG 220
           L  H+ G+ +   I  T   G VP  L+NGV RG ++    L + G     LQ W    G
Sbjct: 197 LKSHSIGKPVVPVI--TGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVDG 254

Query: 221 KFTVEQREKP 230
            FT + R+ P
Sbjct: 255 IFTADPRKVP 264

>NCAS0B04890 Chr2 complement(897400..898224) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 13/87 (14%)

Query: 122 SLMLDLAPVIIFSKST-----CSYSKGLKELL-ESEYQFVPNYYIIELDKHAHGEELREY 175
           S ++  APV++F K +     C YS+ + ++L E++ +F   ++ I  D     + +R+ 
Sbjct: 170 SKLVQAAPVMVFLKGSPSEPKCGYSRQMVKILRENKIRF--GFFDILRD-----DNVRKN 222

Query: 176 IKSTTGRGTVPNLLINGVSRGGSEEIK 202
           +K  +   T P L ING  +GG + +K
Sbjct: 223 MKRFSDWPTFPQLYINGEFQGGLDIVK 249

>TPHA0B00950 Chr2 complement(217773..218099) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 31.2 bits (69), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 24/47 (51%)

Query: 170 EELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           E+ R+  +  TG   +P + +NGV  G   E+ +  + G +   L++
Sbjct: 58  EQWRQAFQRVTGSRNLPTIFVNGVIWGTESELHKFENNGSIQQELEK 104

>Kpol_1046.13 s1046 complement(27947..28687) [741 bp, 246 aa] {ON}
           complement(27947..28687) [741 nt, 247 aa]
          Length = 246

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K +     C +S+ +  +L  E+Q    ++ I  D     + +R+ +K  +  
Sbjct: 157 APVMLFMKGSPSEPKCGFSRQIVGILR-EHQVRFGFFDILKD-----DSVRQGLKKFSDW 210

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L ING  +GG + IK
Sbjct: 211 PTFPQLYINGEFQGGLDIIK 230

>CAGL0G08151g Chr7 complement(775053..775835) [783 bp, 260 aa] {ON}
           highly similar to uniprot|Q03835 Saccharomyces
           cerevisiae YDR098c GRX3 glutaredoxin protection against
           oxidative and osmotic stress
          Length = 260

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 11/84 (13%)

Query: 124 MLDLAPVIIF-----SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKS 178
           +++ APV++F     S+  C +S+ +  +L  E+Q    ++ I  D     + +R  +K 
Sbjct: 165 LVNAAPVMLFMKGNPSEPKCGFSRQIVGILR-EHQIRFGFFDILRD-----DTVRTNLKK 218

Query: 179 TTGRGTVPNLLINGVSRGGSEEIK 202
            +   T P L ING  +GG + IK
Sbjct: 219 FSDWPTFPQLYINGEFQGGLDIIK 242

>Ecym_3514 Chr3 (962769..963506) [738 bp, 245 aa] {ON} similar to
           Ashbya gossypii AGR111W
          Length = 245

 Score = 32.0 bits (71), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F K T     C +S+ +  +L  E+Q    ++ I  D     + +R+ +K+ +  
Sbjct: 156 APVMLFMKGTPSEPKCGFSRQMVGILR-EHQVRFGFFDILKD-----DSVRQGLKTFSDW 209

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L  NG  +GG + IK
Sbjct: 210 PTFPQLYANGDFQGGLDIIK 229

>TDEL0H02190 Chr8 (370572..372128) [1557 bp, 518 aa] {ON} Anc_7.226
           YER052C
          Length = 518

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 183 GTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS--GGKFTVEQREKP 230
           G VPN L+NGV RG ++    L +       L  W    G FT + R+ P
Sbjct: 210 GLVPNGLLNGVGRGYTDLCAALIAVALNADELHVWKEVDGIFTADPRKVP 259

>KAFR0B02600 Chr2 complement(522861..523640) [780 bp, 259 aa] {ON}
           Anc_8.240 YDR098C
          Length = 259

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query: 117 VQQEYSLMLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEE 171
           + Q+ S ++  AP ++F K T     C YS+ + +LL         + +++ D       
Sbjct: 160 LTQKLSNLVQAAPAMLFLKGTPSEPYCGYSRQIVKLLRDHNVRFGYFNVLKNDV------ 213

Query: 172 LREYIKSTTGRGTVPNLLINGVSRGGSEEIK 202
           +R+ +K+ +   T P L +NG  +GG + IK
Sbjct: 214 VRKAMKNYSDWPTFPQLYLNGEFQGGLDIIK 244

>TBLA0F03860 Chr6 complement(955792..956541) [750 bp, 249 aa] {ON}
           Anc_8.240 YDR098C
          Length = 249

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 128 APVIIF-----SKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYIKSTTGR 182
           APV++F     S+  C +S+ +  +L  E+Q    ++ I  D     + +R+ +K  +  
Sbjct: 158 APVMLFMKGNPSEPKCGFSRQMVGILR-EHQVRFGFFDILKD-----DSIRQGLKKYSDW 211

Query: 183 GTVPNLLINGVSRGGSEEIK 202
            T P L +NG  +GG + IK
Sbjct: 212 PTFPQLYLNGEFQGGLDIIK 231

>TPHA0C01200 Chr3 (275584..277170) [1587 bp, 528 aa] {ON} Anc_7.226
           YER052C
          Length = 528

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 19/117 (16%)

Query: 132 IFSKSTCSYSKG------LKELLESEYQF--VPNYYIIELDKHAHGEELREYIKS----- 178
           +F  S C+  K       L  ++ S+YQ   + N +   L K +  E+L+ +I S     
Sbjct: 154 LFIASLCNDRKCKAKYVDLSNVIPSDYQTTNLDNTFYTFLVK-SLKEKLQPFIDSKERIV 212

Query: 179 ---TTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWS--GGKFTVEQREKP 230
              T   G +P  L+NGV RG ++    L S       LQ W    G FT + R+ P
Sbjct: 213 PVLTGFFGLIPMGLLNGVGRGYTDLCAALVSVALNADELQVWKEVDGIFTADPRKVP 269

>TDEL0E01630 Chr5 complement(319395..319721) [327 bp, 108 aa] {ON}
           Anc_4.211 YLR364W
          Length = 108

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%)

Query: 170 EELREYIKSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQE 216
           E+ R+  +  TG   +P +++NG       E+ R  ++G L   LQ+
Sbjct: 58  EQYRKAFQEVTGSRNLPTVVVNGKFWATESELHRFEAKGTLKEELQK 104

>KNAG0A02540 Chr1 (260985..262190) [1206 bp, 401 aa] {ON} Anc_8.429
           YLR226W
          Length = 401

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/60 (21%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 117 VQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI 176
           + Q  SL+ D    +I S   C      K++++ ++++  N+++   D H   E+ + Y 
Sbjct: 232 ITQPVSLLFDGPTFVILSLIYCGLQ--YKQMVDKDFRYPKNFFLDRFDVHVKAEDFQNYF 289

>NDAI0B02300 Chr2 complement(576792..577691) [900 bp, 299 aa] {ON}
           Anc_8.240
          Length = 299

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 122 SLMLDLAPVIIFSKST-----CSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI 176
           S ++  APV++F K T     C YS+ + ++L +       + ++          +R  +
Sbjct: 188 SKLVQAAPVMLFLKGTPSEPKCGYSRQMVKILRANKIRFGFFNVLS------DNNVRINM 241

Query: 177 KSTTGRGTVPNLLINGVSRGGSEEIKR--LHSQGKLLSSLQEWSGGKFTV 224
           K  +   T P L ING  +GG + IK   L        +LQ    G  T+
Sbjct: 242 KKFSDWPTFPQLYINGEFQGGLDIIKETLLDDPDYFFHTLQSSPTGGGTI 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,220,043
Number of extensions: 1043150
Number of successful extensions: 2409
Number of sequences better than 10.0: 147
Number of HSP's gapped: 2396
Number of HSP's successfully gapped: 149
Length of query: 233
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 127
Effective length of database: 41,326,803
Effective search space: 5248503981
Effective search space used: 5248503981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)