Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.2363.186ON63063028190.0
Skud_4.2403.186ON61962723500.0
Smik_4.2213.186ON61963023200.0
YDL013W (SLX5)3.186ON61963021690.0
ZYRO0A04994g3.186ON60862012571e-166
KAFR0A012203.186ON64765811221e-145
NDAI0A065103.186ON71264711261e-144
SAKL0C07964g3.186ON62363010291e-131
AER213C3.186ON5576129911e-126
NCAS0I019103.186ON6133579651e-122
Kwal_27.98243.186ON5854829411e-118
KLTH0E15884g3.186ON5864808901e-111
TBLA0F007203.186ON6496447892e-95
KLLA0C04411g3.186ON6076487756e-94
TDEL0D043503.186ON5565727586e-92
Kpol_1036.523.186ON5913526542e-76
KNAG0J012703.186ON5473536502e-76
CAGL0K01881g3.186ON5062455276e-59
TPHA0A043703.186ON6642405093e-55
TPHA0I010201.286ON54167771.1
KAFR0B035008.777ON1317112742.4
KLLA0D14113g7.131ON33342732.6
CAGL0J10912g5.337ON49340707.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.236
         (630 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...  1090   0.0  
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   909   0.0  
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   898   0.0  
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   840   0.0  
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   488   e-166
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   436   e-145
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   438   e-144
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   400   e-131
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   386   e-126
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   376   e-122
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   367   e-118
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   347   e-111
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   308   2e-95
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   303   6e-94
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   296   6e-92
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   256   2e-76
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   254   2e-76
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   207   6e-59
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   200   3e-55
TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.2...    34   1.1  
KAFR0B03500 Chr2 (725799..729752) [3954 bp, 1317 aa] {ON} Anc_8....    33   2.4  
KLLA0D14113g Chr4 (1209913..1210914) [1002 bp, 333 aa] {ON} simi...    33   2.6  
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...    32   7.3  

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/630 (86%), Positives = 542/630 (86%)

Query: 1   MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ 120
           RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ
Sbjct: 61  RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ 120

Query: 121 EPGSETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGG 180
           EPGSETVETPRIIQV                           IVEERTARPRITLNLPGG
Sbjct: 121 EPGSETVETPRIIQVNNTNGYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGG 180

Query: 181 ERLEVNATPRDIPIRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXX 240
           ERLEVNATPRDIPIRRSFEFQED                 NLFVERS             
Sbjct: 181 ERLEVNATPRDIPIRRSFEFQEDLAASRRQLLRRSAARARNLFVERSDEDDENDEEWTEN 240

Query: 241 XXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV 300
              LPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV
Sbjct: 241 TNDLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV 300

Query: 301 PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQX 360
           PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQ 
Sbjct: 301 PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQE 360

Query: 361 XXXXXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420
                      GQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH
Sbjct: 361 EALRLHREALEGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420

Query: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480
           TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM
Sbjct: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480

Query: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540
           KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK
Sbjct: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540

Query: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSA 600
           FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDN                GSA
Sbjct: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELKGSA 600

Query: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           HPDNYGPKLCPADSCKKLIRSRGRLKEVYF
Sbjct: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/627 (72%), Positives = 493/627 (78%), Gaps = 10/627 (1%)

Query: 4   AGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFI 63
            GD RTKSDHTPSV+HPD+SVILI+SDKEEDASIREANLPVRLYPDRRVGRRRDALNRF+
Sbjct: 3   GGDGRTKSDHTPSVNHPDDSVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALNRFV 62

Query: 64  RSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPG 123
           RSD+    PQRI TT R +  D QND DDVTI+REVGRFFGDDGPIDPSA +VDLD EP 
Sbjct: 63  RSDSVGINPQRIHTTARPNRSDPQNDNDDVTIVREVGRFFGDDGPIDPSAHFVDLDHEPD 122

Query: 124 SETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERL 183
           SET+ETP  +QV                           IVEERT RPR+TLNLPGGERL
Sbjct: 123 SETLETPTTLQVDNINGYLNDNFNDNDNNDDGLT-----IVEERTTRPRVTLNLPGGERL 177

Query: 184 EVNATPRDIPIRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXX 243
           EVNAT  D+PIRRSFEFQ+D                  LFV+RS                
Sbjct: 178 EVNATTTDMPIRRSFEFQDDLAVSRRQLLRRSAARARTLFVDRSDENDEEWTEDTDN--- 234

Query: 244 LPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDI 303
           +PE IQRARRESHMRMSRR+AERQ  +RAQQ RM SNENM T+IR QSIRERIQAY PDI
Sbjct: 235 VPEAIQRARRESHMRMSRRIAERQ--LRAQQHRMASNENMNTSIRFQSIRERIQAYAPDI 292

Query: 304 RSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQXXXX 363
           RSAF+HAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQ+WAIDRVRNTQ    
Sbjct: 293 RSAFYHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQDWAIDRVRNTQEEAL 352

Query: 364 XXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERHTQN 423
                    QER  G   H GP+RESI++YLNF+GE+GFLTRLWG PVLN+ADEERHTQN
Sbjct: 353 RLHREALERQERATGRVFHRGPFRESITNYLNFSGENGFLTRLWGSPVLNDADEERHTQN 412

Query: 424 IIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNG 483
           IIDMIQEREERERDVVMKNLM+KTKAQQ+EFE+RAA LPEGYSASFDTTPKMKLDIMKN 
Sbjct: 413 IIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTTPKMKLDIMKND 472

Query: 484 KEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHC 543
           KEETITV DDDLA+TLE + VCCLCGVELGVGIPDDF+GM+QKDRGISFEGLVS+YKFHC
Sbjct: 473 KEETITVTDDDLARTLEVIPVCCLCGVELGVGIPDDFIGMNQKDRGISFEGLVSKYKFHC 532

Query: 544 PYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSAHPD 603
           PYQTLARPS+LDRDLS+RTF+A+CGH YCGRC+ARIDN                GSAHPD
Sbjct: 533 PYQTLARPSMLDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKKKLASLRGSAHPD 592

Query: 604 NYGPKLCPADSCKKLIRSRGRLKEVYF 630
           NYGPK CPA+SCKK IRSRGRLKEVYF
Sbjct: 593 NYGPKFCPAESCKKPIRSRGRLKEVYF 619

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/630 (71%), Positives = 489/630 (77%), Gaps = 11/630 (1%)

Query: 1   MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           M    + RTKSDH+PS S PD +VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MHGDTNGRTKSDHSPSASSPDEAVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ 120
           RF+RSD+ +   QRI TT  S+  +TQ + DDVTIIREVGRFFGD+GPIDPSA YVDLD+
Sbjct: 61  RFVRSDSRNRNAQRIHTTTTSEYSNTQGNNDDVTIIREVGRFFGDEGPIDPSAHYVDLDE 120

Query: 121 EPGSETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGG 180
           EPGSET+E PR I+V                           IVEERT RPRITLNLPGG
Sbjct: 121 EPGSETLEAPRTIRVDNANGYLNDSHDDNENDDGLT------IVEERTTRPRITLNLPGG 174

Query: 181 ERLEVNATPRDIPIRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXX 240
           ERLEVNAT  DIPIRRSFEFQED                 +LFV+RS             
Sbjct: 175 ERLEVNATTTDIPIRRSFEFQEDLAASRRQLLRRSATRARSLFVDRSDENDEDWTEHTHS 234

Query: 241 XXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV 300
              LPETIQRARRESHMRM+RR+AERQ  + AQQQR+  +EN  T+ RLQSIRERIQ+Y 
Sbjct: 235 ---LPETIQRARRESHMRMNRRIAERQ--LMAQQQRISRDENTSTSFRLQSIRERIQSYT 289

Query: 301 PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQX 360
           PD+RSAFHHAESLHEFRSILQNVAPVTLQECE ELMALFTEFRNQLLQNWAI+RVRNTQ 
Sbjct: 290 PDVRSAFHHAESLHEFRSILQNVAPVTLQECEEELMALFTEFRNQLLQNWAIERVRNTQE 349

Query: 361 XXXXXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420
                       Q R  G   H G +RESI++YLNFNG+DGFL+RLW G VLN+ADEERH
Sbjct: 350 EALRLHREALERQGRTTGRNFHRGVFRESIANYLNFNGDDGFLSRLWSGSVLNDADEERH 409

Query: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480
           TQNIIDMIQEREERERDVVMKNLMNKTKAQQ+EFE RAA+LPEGYSASFDTTPKMKLDIM
Sbjct: 410 TQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTTPKMKLDIM 469

Query: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540
           KNGKEETI V DDDLAKTL+D+ VCCLCG ELGVGIPDDF GMSQ+DRGISFEGLVS+YK
Sbjct: 470 KNGKEETIIVTDDDLAKTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGISFEGLVSKYK 529

Query: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSA 600
           FHCPYQTLARPSVLDRDLSKRTF+ASCGH YCGRC+ARIDN                GSA
Sbjct: 530 FHCPYQTLARPSVLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPKKKLAQLKGSA 589

Query: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           HPDNYGPKLCPA+SCKKLIRSRG+LKEVYF
Sbjct: 590 HPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/630 (71%), Positives = 487/630 (77%), Gaps = 11/630 (1%)

Query: 1   MQSAGDDRTKSDHTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60
           M S  + RTKS+++PS ++P+ +VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN
Sbjct: 1   MHSDTNGRTKSNNSPSDNNPNETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALN 60

Query: 61  RFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQ 120
           RF+RSD+     QR   T  S+ PD Q + DD+TIIREVGRFFGDDGPIDPSA YVDLDQ
Sbjct: 61  RFVRSDSRSRNSQRTHITASSERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQ 120

Query: 121 EPGSETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGG 180
           EPGSET+ETPR IQV                           IVEERT RPR+TLNLPGG
Sbjct: 121 EPGSETLETPRTIQVDNTNGYLNDNGNNNESDDGLT------IVEERTTRPRVTLNLPGG 174

Query: 181 ERLEVNATPRDIPIRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXX 240
           ERLEV AT  DIPIRRSFEFQED                 NLFV+RS             
Sbjct: 175 ERLEVTATTTDIPIRRSFEFQEDLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHN 234

Query: 241 XXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYV 300
              LPE IQRARRES MRMSRR+AERQ R   QQQR+ S+EN+ T+IRLQSIRERIQ+Y 
Sbjct: 235 ---LPEAIQRARRESRMRMSRRIAERQRR--VQQQRVSSDENISTSIRLQSIRERIQSYT 289

Query: 301 PDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQX 360
           PDIRSAFH AESLHEFRSILQNVAP+TLQECE ELMALFTEFRNQLLQNWAIDRVRNTQ 
Sbjct: 290 PDIRSAFHRAESLHEFRSILQNVAPITLQECEEELMALFTEFRNQLLQNWAIDRVRNTQE 349

Query: 361 XXXXXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420
                       QER AG   H G  RESI++YLNFNGEDGFL+RLW GP L++ADEERH
Sbjct: 350 EALRLHREALERQERTAGRVFHRGTLRESITNYLNFNGEDGFLSRLWSGPALSDADEERH 409

Query: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480
           TQNIIDMIQEREERERDVVMKNLMNKT+AQQ+EFE RAA+LPEGYSASFDTTPKMKLDI 
Sbjct: 410 TQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTPKMKLDIT 469

Query: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540
           KNGKEETI V DDDLAKTLED+ VCCLCG ELGVGIPDDF G+SQKDRG+SFEGLVS+YK
Sbjct: 470 KNGKEETIIVTDDDLAKTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYK 529

Query: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSA 600
           FHCPYQTLARPS+LDRDLSKRTF+ASCGH +CGRC+ARIDN                GSA
Sbjct: 530 FHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKLAQLKGSA 589

Query: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           HPDNYGPKLCPADSCKKLIRSRGRLKEVYF
Sbjct: 590 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  488 bits (1257), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/620 (44%), Positives = 365/620 (58%), Gaps = 42/620 (6%)

Query: 21  DNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLR 80
           D   I+I+SD+EED  IR+   P+RL+PD R+ R RD LNRF+ S+ T+        T R
Sbjct: 21  DEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVA------TTR 74

Query: 81  SDGPDTQNDIDDVTIIREVGRFFGDD-GPIDPSALYVDLDQEPGSETVETPRIIQVXXXX 139
           S   D     D+V I+ E+    G++ GPI   A YVDLD + G      P++I+V    
Sbjct: 75  SQ--DNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNG------PQVIEVNDNN 126

Query: 140 XXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFE 199
                                  IV+ERT  PR+TLNLPGGE L+++A+P D P RRSFE
Sbjct: 127 RNNNENSDDDGLV----------IVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176

Query: 200 FQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARRESHMRM 259
           +Q+                   LF   S                LP ++ + RR+   R 
Sbjct: 177 WQQQDRTRRQAMERSARRASRLLF-HTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEER- 234

Query: 260 SRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSI 319
                 R   I  ++ +M S+   G  + L  +RERI ++ PD+RSAF HA+SL+EFRSI
Sbjct: 235 -----SRLRNITRRRDQMRSDAMQGNPV-LMRLRERIDSFPPDVRSAFVHAQSLYEFRSI 288

Query: 320 LQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQXXXXXXXXXXXXGQERVAGG 379
           LQ+VAP+TLQEC+ EL+ LFTE+R++++QNWA +RV++ Q             Q R+   
Sbjct: 289 LQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHN 348

Query: 380 ALHH-------GPYRESISSY--LNFNGEDGFLTRLWGGPVLNEADEERHTQNIIDMIQE 430
             H        G + ES+++Y  +N NG             + + DEE  TQ+I+ MIQE
Sbjct: 349 RRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQE 408

Query: 431 REERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITV 490
           REERE D   K  M KT+ QQ  + +RA  LP+GYSASFDT PK+KLDI+++GKEET+ V
Sbjct: 409 REEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVV 468

Query: 491 LDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLAR 550
            DD ++   ++V VC LCGVELGVGIPD+F G+++ DRG+SFE LV +Y+FHCPYQTLAR
Sbjct: 469 KDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLAR 528

Query: 551 PSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLC 610
           PS LDRDLS+RTFVA CGHTYCGRC+ARIDN                GSAHPDNYGPK+C
Sbjct: 529 PSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKIC 588

Query: 611 PADSCKKLIRSRGRLKEVYF 630
           PA  CK  IR+RG+++E +F
Sbjct: 589 PAKGCKSPIRTRGKMREAFF 608

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  436 bits (1122), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 273/658 (41%), Positives = 361/658 (54%), Gaps = 80/658 (12%)

Query: 22  NSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLRS 81
           +SVILI++D+EED  IR+ N   RL PDRR+GR RD LNRF+   T D       TT  S
Sbjct: 21  DSVILIETDEEEDERIRDENRYRRLVPDRRIGRPRDILNRFV--STRDPGDDNETTTHVS 78

Query: 82  DGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQE----PGSETVETPRIIQVXX 137
              D  +D DDV I+  +      +GPIDP A Y+DLD E     G     TPRI+ +  
Sbjct: 79  QEGDNNDDDDDVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVING 138

Query: 138 XXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDIPIRRS 197
                                    I+EERT RP +TLNLPGGE L++NA+  D P  RS
Sbjct: 139 DSNNGNNEDDGLE------------IIEERTTRPTVTLNLPGGESLQINASDSDRPAHRS 186

Query: 198 FEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARRESHM 257
           FE+Q+                  +LF+  S                LP  I+R R+E   
Sbjct: 187 FEWQDALPEPRRRLLRRSAGRIRSLFLNNSDDENNDTAAGRQNNRYLPSNIRRLRQEEQA 246

Query: 258 RMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFR 317
           +M R++A+R+ R+  Q+  M+S        R   IR RI AY PDIRSAF HA+++HEF+
Sbjct: 247 QM-RQLAQRRRRMNEQRPEMISGN-----PRFDEIRNRINAYSPDIRSAFDHAQTIHEFK 300

Query: 318 SILQNVAPVTLQECEGELMALFTEFRNQL--------LQNWA------------------ 351
           SIL+N+APVTLQ+C  EL++L+TE+R+ L        +QN A                  
Sbjct: 301 SILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSAAPATAGRARTDGRDRRRR 360

Query: 352 -----IDRVRNTQXXXXXXXXXXXXGQERVAGGALHH------------GPYRESISSYL 394
                + R+R                +  +A     +            G Y   ++ Y 
Sbjct: 361 TRNQRLARLRFDMESNEGGLTANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYD 420

Query: 395 NFNGEDGFLTRLWGGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEF 454
           ++ GE G           NE +E + TQNII+MIQEREERE D   K  M  TK+Q++  
Sbjct: 421 DYMGEHG----------ENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREAN 470

Query: 455 EERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLA--KTLEDVSVCCLCGVEL 512
            ++A NLP+GYSA+FD+TPK  +  MKNGKEE I ++DDD+A    L +V +C LCG EL
Sbjct: 471 HKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEI-IVDDDVAVRNNLMEVPICTLCGAEL 529

Query: 513 GVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYC 572
           G+GIPDDF G+ ++DRG+SF+ LVS+YK +CPYQ+LA+PS +DR LSKRTFVA CGH YC
Sbjct: 530 GIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYC 589

Query: 573 GRCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           GRC ARI N                GS+HP+NYGPK CPAD+CK L+RSRG+L EVYF
Sbjct: 590 GRCVARISNAKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  438 bits (1126), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 266/647 (41%), Positives = 342/647 (52%), Gaps = 50/647 (7%)

Query: 23  SVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTT--------DATPQR 74
           S ILI+SD EEDA IRE +  + L PDRR+GR RDAL+RFI ++          DA  + 
Sbjct: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISTNPNNTNTTSRRDAQEEN 136

Query: 75  IGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRIIQ 134
                  D     ++I D T          + GPIDP+A YVDLD EP   T   PR I 
Sbjct: 137 EENDENDDDFAIMDEIIDPT---HNNNNINEIGPIDPTAEYVDLDAEPEYITNSRPRTII 193

Query: 135 VXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDIPI 194
           +                           I+EERT+ P +TLNLPGGERL +NA P + P 
Sbjct: 194 INNNSSNNNIENSNGDANDDDDDEVM--ILEERTSTPTVTLNLPGGERLRINADPNERPT 251

Query: 195 RRSFEFQEDX---XXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXXLPETI--- 248
           R SFE   +                    +LF   S                LP +I   
Sbjct: 252 RSSFESLNENIVPLSRRQLLRRATRRATNSLFFHGSDENESDNDTDEVS---LPASILGM 308

Query: 249 -QRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAF 307
            QRAR  +     R+   +     A      S +N  T   L ++RERI  Y PD+R AF
Sbjct: 309 RQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAF 368

Query: 308 HHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQXXXXXXXX 367
            HA+SL EF SI+Q+VAP T  EC  +L++LFT++R Q++ +W + R+R +Q        
Sbjct: 369 DHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLR 428

Query: 368 XXXXG-QERVAGGALHHGPYRESISSYLNFNG-----------------------EDGFL 403
                 +  +     H G    +++S+   N                        ED   
Sbjct: 429 ERHARVRSTIRANNRHFG---SNLASFFLMNQLGLGYGDVGAADDEDDGDYGIGEEDNDT 485

Query: 404 TRLWGGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPE 463
            R  G       D++ HTQNII+MIQ RE+ ERD   K  M+KTK QQD F++RA  LPE
Sbjct: 486 GRAAGAYGYEYEDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRALALPE 545

Query: 464 GYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGM 523
           GYS+SF T PK+K+ + KNGK+ET+ + D DLAK   DV  C LCGVELGVGIP DFVG 
Sbjct: 546 GYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKDFVGT 605

Query: 524 SQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXX 583
           S KD G+SFE LVS+Y FHCPYQ+L++PS LDRDLS++ +VASCGHT+CGRCY RIDN  
Sbjct: 606 SDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRIDNAK 665

Query: 584 XXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
                         GS+HPDNYGPK CP  SCK L+RSRGR++E+YF
Sbjct: 666 SKSKLPKKKLAELKGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  400 bits (1029), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 252/630 (40%), Positives = 336/630 (53%), Gaps = 37/630 (5%)

Query: 13  HTPSVSHPDNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATP 72
           H P  S P   VI I+SD EED  IR+     RL  DRR+ R RD+LNRF+ S   +   
Sbjct: 19  HAPP-SAPTQDVIEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLNSQGENRN- 76

Query: 73  QRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRI 132
                T  +  PD   D DD+ ++ E        GPI   A +VDL    G +T      
Sbjct: 77  -----TRAALEPDDDEDDDDLQVVGET--MLDRHGPIGEDADFVDLSSFGGGDTGSG-GS 128

Query: 133 IQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDI 192
                                         I+EERT  P   LNLPGGE L ++ T  D 
Sbjct: 129 GDNRNGVPTRTAIIRHSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQ 188

Query: 193 PIRRSFEFQEDXXXXXXXXX--------XXXXXXXXNLFVERSXXXXXXXXXXXXXXXXL 244
           P+RRSF+ Q+                          NLF   S                +
Sbjct: 189 PVRRSFQNQQPSRTRAVSAAAAARRRLLNRTARSATNLFFS-SGQGPQDGYSEENDPDYI 247

Query: 245 PETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIR 304
           P  +++ R+++ MR  R+ +  Q R   +QQR+ +  + G    L ++R RI  Y  DI+
Sbjct: 248 PAGVRQLRQQNAMR-DRQASLEQRR---EQQRL-NGMDPGANAELTALRSRINGYPLDIQ 302

Query: 305 SAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQXXXXX 364
           SAF HA+SL+EF  I+Q+V P   +  + EL  L++ +R  ++ +WA +R R  +     
Sbjct: 303 SAFDHAQSLYEFEGIIQSVEPRMNENRKQELRELYSRYRGHVMHSWAQNRRRTYREQAAR 362

Query: 365 XXXXXXXGQER----VAGGALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERH 420
                   QE+    +     H+   R S++ +L       F    WGG    +ADEE  
Sbjct: 363 AQQTRAREQEQRQRELENQVFHN---RHSLTEFLIARAFGPFH---WGG---QQADEEIE 413

Query: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIM 480
           TQNII+MIQ REERE+D   K  M  TK QQ  F  RA  +PEGYSASFDT PKMK+ + 
Sbjct: 414 TQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMT 473

Query: 481 KNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYK 540
           +NG+EE +TV DD  AK  EDV  CCLCG+ELGVGIPD+F G++++DRG+SFE LV++Y 
Sbjct: 474 RNGREEEVTVTDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYG 533

Query: 541 FHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSA 600
           FHCPYQ+LARPSV DRDLSKRT+VASCGHT+CGRC+AR+DN                G++
Sbjct: 534 FHCPYQSLARPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGAS 593

Query: 601 HPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           HPDNYGPK CPA+ C   +RS+GR+KEV+F
Sbjct: 594 HPDNYGPKTCPAEGCSMQLRSKGRMKEVFF 623

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  386 bits (991), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/612 (37%), Positives = 317/612 (51%), Gaps = 66/612 (10%)

Query: 22  NSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLRS 81
           N+VI I+SD EED  I       RL PDRR+ R RDA NRF+      A     G     
Sbjct: 9   NAVIEIESDPEEDQRIINQYRQTRLVPDRRLNRPRDAANRFVSVSGRVAAAAGEGD---- 64

Query: 82  DGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRIIQVXXXXXX 141
                    D+V I+ EV  +  D+GPID +A +VDLD++ G  +               
Sbjct: 65  ---------DEVEIVNEV--YLDDEGPIDSTADFVDLDEQQGPSS--------------- 98

Query: 142 XXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQ 201
                                I+EERT  P   LNLP G+ L ++ +  D P+RRSFE Q
Sbjct: 99  ------SMVINHDGGGDDDVAIIEERTTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQ 152

Query: 202 EDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARRESHMRMSR 261
                               LF+  +                LP+++ R R+++ M    
Sbjct: 153 R---TARANMLRRAARSAQRLFMNENDGEPSEREASDREY--LPQSVLRQRQQALM---- 203

Query: 262 RVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQ 321
                Q R++ Q++    +E++           ++ A  P++RS F+HAE+LHE R++L 
Sbjct: 204 -----QERLQRQREHARQHEHIADP--------QVDALAPELRSIFYHAETLHEVRTMLN 250

Query: 322 NVAPVTLQECEGELMALFTEFRNQLLQNWAIDRV---RNTQXXXXXXXXXXXXGQERVAG 378
                T      +L+ L+ +FR++ + NWA  R    R+               + R+  
Sbjct: 251 ASGLGTSAAAMQDLLQLYMQFRSRQINNWARQRAQEFRHGSAREADHAQDDSASRARLRN 310

Query: 379 GALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERHTQNIIDMIQEREERERDV 438
            AL+    R S +SY+      GF   +W      + DE   TQNIID+IQ REER+ D 
Sbjct: 311 PALN-AQRRNSFTSYVLARSLGGF--GVWPNDFFGDDDEV--TQNIIDIIQAREERDLDS 365

Query: 439 VMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKT 498
             +  M  TK+QQ  F  RA  LPEGY ASFD TPKMK+ + KNGK E + V DD  AK+
Sbjct: 366 RKRKYMEDTKSQQQAFVARAQRLPEGYYASFDPTPKMKMTLEKNGKTEEVVVADDLAAKS 425

Query: 499 LEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDL 558
             +V VCCLCGVELG+GIPDDF G+S  DRG+SFE LVS+Y FHCPYQ LA PS+ DRDL
Sbjct: 426 YVEVPVCCLCGVELGLGIPDDFAGISAVDRGVSFESLVSKYDFHCPYQALAHPSIADRDL 485

Query: 559 SKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKL 618
           S++TFVA CGHT+CGRC+ARI+N                G +HPDNYGP++CPA+ C+  
Sbjct: 486 SRKTFVAHCGHTFCGRCFARINNAKRFSKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQ 545

Query: 619 IRSRGRLKEVYF 630
           +R+RG+++EV+F
Sbjct: 546 LRTRGKMREVFF 557

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  376 bits (965), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 236/357 (66%), Gaps = 20/357 (5%)

Query: 292 IRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWA 351
           +R RI  Y PDI+SAF+HA SLHEF SILQNVAP+TLQEC  EL++LFT++R+QL+ NWA
Sbjct: 259 LRTRINTYSPDIQSAFNHAHSLHEFTSILQNVAPLTLQECGDELLSLFTQYRSQLMVNWA 318

Query: 352 IDRVRNTQXXXXXXXXXXXXGQERVAGGALHHGPYRESISSYL------------NFNGE 399
             RVR++Q             +     GAL   P     +  L            N N E
Sbjct: 319 TRRVRSSQQNTSSSNHRQRNLRNLRRNGALRVTPNANGFNVNLARLFLMNQLGINNGNDE 378

Query: 400 DGFLTRLWGGPVLNEAD------EERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDE 453
           D + T  +     ++AD      ++  TQNII+MIQ REE+E D   K+ M +TK QQD 
Sbjct: 379 DQYFTGAYNSE--DDADHNGDDEDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDA 436

Query: 454 FEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELG 513
           F++RA  LPE YSA+F+T P MKLDI KNGKEETI V D+D AK   +V  C LCGVELG
Sbjct: 437 FKKRANELPENYSANFNTEPTMKLDIKKNGKEETIIVEDNDAAKNYIEVPACTLCGVELG 496

Query: 514 VGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCG 573
           VGIP DF G++  DRG SFE LVS+YKFHCPYQ+LA+PS LD+DLS+R F+ASCGHT+CG
Sbjct: 497 VGIPKDFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMASCGHTFCG 556

Query: 574 RCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           RCYARIDN                GS+HPDNYGP++CPADSC+ L+R + +++EV+F
Sbjct: 557 RCYARIDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPADSCRSLLRVKTKMREVFF 613

 Score =  102 bits (253), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 110/204 (53%), Gaps = 28/204 (13%)

Query: 9   TKSDHTPSVSHPDNSVILIDSDKEEDASIR-EANLPVRLYPDRRVGRRRDALNRFIRSDT 67
           T +DH     H  + +I I+SD E+DA IR +    +RLYPD R  R RD++NRF+ +  
Sbjct: 3   TTTDH-----HQQDPIITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNRFVDAQG 57

Query: 68  TD----ATPQRIGTTLRSDGPDTQNDIDDVTIIREV--GRFFGDDGPIDPSALYVDLDQE 121
           ++    +TP    + L  D    Q+D DD+TI+RE+       DD PI+P A ++DLDQE
Sbjct: 58  SNRAIRSTPDL--SHLNDDQDQDQDDDDDITIVREIVNPNVARDDAPINPDAEFIDLDQE 115

Query: 122 P--GSETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPG 179
               + T+  PR IQ+                           I +ERT RP +TLNLPG
Sbjct: 116 VPYANATIPRPRTIQIITPSPPQQQQDDDLV------------ITQERTMRPTVTLNLPG 163

Query: 180 GERLEVNATPRDIPIRRSFEFQED 203
           G+ L+V+ATP D   R SFE+QE+
Sbjct: 164 GQTLQVDATPTDQLARSSFEWQEN 187

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  367 bits (941), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/482 (41%), Positives = 279/482 (57%), Gaps = 31/482 (6%)

Query: 163 IVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQE----DXXXXXXXXXXXXXXX 218
           I+EERT+ P   LNLPGGE L +N +P D P+RRSF+ Q     D               
Sbjct: 121 ILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGARRRLARRTART 180

Query: 219 XXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMV 278
             NLF++ S                LP T+   R+ + + M RR        +  +++ V
Sbjct: 181 ASNLFMQPSDDEQEESVEGNTYQ--LPSTVMARRQRNALLMQRRP-------QPSRRQPV 231

Query: 279 SNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMAL 338
               M  +  L ++  +I    P++RSAF HA+S+HEFRSILQ++      + + +L +L
Sbjct: 232 RGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSL 291

Query: 339 FTEFRNQLLQNWAIDRVRNTQXXXXXXXXXXXXGQERVAGG--ALHHGPYRESISSYL-- 394
           F+E+R  LL++ +  R+R                  R+AG   +  + PY  S+   +  
Sbjct: 292 FSEYRANLLRSRSNQRIRRPGERSRLDS--------RMAGQDPSAQNLPYSPSLVGIMAQ 343

Query: 395 NFNG-----EDGFLTRLWGGPV-LNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTK 448
            FN        G+  R  GG +   E DEE+ TQNII MIQEREE+E +   +  M  TK
Sbjct: 344 TFNPVLGRMHMGYDARTHGGIMGYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTK 403

Query: 449 AQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLC 508
           ++Q  + E+A  LPEGYS+SFDTTPKM + I KNGKEE +TV DD  A    D+  C LC
Sbjct: 404 SKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVTDDQAAAFYMDLPSCSLC 463

Query: 509 GVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCG 568
           GVELGVGIPD+F G+S +DRG+SFE L ++Y+FHCPYQ L++PS++DRDLS+RT+VA+CG
Sbjct: 464 GVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACG 523

Query: 569 HTYCGRCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEV 628
           H++CGRC+ARIDN                G++HPDNYGPK CPA  C   +R+RG+++EV
Sbjct: 524 HSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREV 583

Query: 629 YF 630
           YF
Sbjct: 584 YF 585

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  347 bits (890), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/480 (40%), Positives = 274/480 (57%), Gaps = 27/480 (5%)

Query: 163 IVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQ----EDXXXXXXXXXXXXXXX 218
           I+EER   P   LNLPGGE L+++ +P D P+RRSF+ Q     +               
Sbjct: 122 ILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRRLLRRTARR 181

Query: 219 XXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMV 278
             +LF+  S                LP  + R RR+ +  M RR    + ++      + 
Sbjct: 182 ASSLFLHPSDEEDEGFAYENTDL--LPTGV-RLRRQRNSMMQRRPNPPRRQLLGTGDDVD 238

Query: 279 SNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMAL 338
             E       L S+  +I ++  ++RSAF HA+S+HEFRSILQ+V   + ++ + EL  L
Sbjct: 239 DPE-------LLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTHL 291

Query: 339 FTEFRNQLLQNWAIDRVRNTQXXXXXXXXXXXXGQERVAGGALHHGPYRESISSYL--NF 396
           FT +R  ++++WA DR+R  +               +      H+  Y  +++  +   F
Sbjct: 292 FTVYRGHVMRSWANDRLRRARDAASGMNTRTTDRTSQA-----HNLRYSPTLAGIIARTF 346

Query: 397 NGEDGFLTRLW------GGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQ 450
           N   G +   +      G    N+ADEER TQNII MIQEREERE +   +  M  TK +
Sbjct: 347 NPILGHMHMAYEPGLGTGMAAYNDADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPK 406

Query: 451 QDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGV 510
           Q  + ++AA LP+GYSASFDTTP+M + IMKNG+ E +TV+DD       D+  CCLCGV
Sbjct: 407 QSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHADALYMDIPACCLCGV 466

Query: 511 ELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHT 570
           ELGVGIPD F G+ ++DRG+SFE L ++Y FHCPYQTL++PSV DRDLS+RT+VA CGH+
Sbjct: 467 ELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHS 526

Query: 571 YCGRCYARIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           +CGRC+ARIDN                G+++PDNYGPK CPA  C   +RSRG+++EVYF
Sbjct: 527 FCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  308 bits (789), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 215/644 (33%), Positives = 302/644 (46%), Gaps = 69/644 (10%)

Query: 22  NSVILIDSDKEEDASIREANLPVRLYPD--RRVGRRRDALNRFIRSDTTDATPQRIGTTL 79
           N VI+I+SD EEDA  +  N+P     D   R  R  D +N      +  AT  R  T  
Sbjct: 40  NDVIVIESDAEEDAIDKNRNVPWSQPRDEFHRFARIYDNINERNNHSSLSATLDRGNTPT 99

Query: 80  RSDGPDTQNDIDDVTIIREVGRF-------------------------FGDDGPIDPSAL 114
            S    T       T   EVG                               GP++PS  
Sbjct: 100 TSIPRGTL-----PTQTFEVGHHNNAPDNNADDDDDDDIIITNEIIAPVDPSGPLNPSTE 154

Query: 115 YVDLDQEP---GSETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARP 171
           YVDLD E     +      R + V                           IV+ERT+ P
Sbjct: 155 YVDLDNEAEYSSNNNYGHSRTLIVDGDNDNADVIDDGNGADDLV-------IVQERTSAP 207

Query: 172 RITLNLPGGERLEVNATPRDIPIRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXX 231
            +TL LPG   +++NA P D P+R SF +Q                    LF        
Sbjct: 208 TVTLTLPGNRSIQINAAPTDRPVRSSFGWQGGVPDSRRGMLARRYNSVRQLFFNSDEDAS 267

Query: 232 -XXXXXXXXXXXXLPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQ 290
                         P  +QR +      + +R+ +++ + +  +Q    NE+   A    
Sbjct: 268 RNGSDSDSYDDDYTPARLQRIQNRERNAVRQRMMQQRRQQQILRQEQSRNESPIMA---- 323

Query: 291 SIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNW 350
            +R RI AY PD+RS F HA +L+EF +++Q+ AP+TL++   +L+ +FT +R  L QNW
Sbjct: 324 ELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRGNLTQNW 383

Query: 351 AIDRVR----NTQXXXXXXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLTRL 406
            I+R+     N+                R   G LH         S +   G+       
Sbjct: 384 MINRMNSSRDNSARTASSTPMRNMPAHTRFVQGFLH---------SIMGLGGD-----FP 429

Query: 407 WGGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYS 466
           +GG    E+DEE  TQNII MI+ERE  ERD  +K LM KTK QQ++FE +A  LP+G+S
Sbjct: 430 YGG---TESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKAKYLPKGFS 486

Query: 467 ASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQK 526
           ASF   PK  + I  +  +  I V D+ LA+  E++ VCCLCGVELGVGIPD F G++ +
Sbjct: 487 ASFSLVPKKIISIDGDDSKREI-VTDEFLAEEYEELPVCCLCGVELGVGIPDSFRGITPE 545

Query: 527 DRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXX 586
           +  +SF+ LV +Y   CPY  L+ P  +DRDLS+RT+VASCGH++CGRC  RI++     
Sbjct: 546 ESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVRRINHAKESG 605

Query: 587 XXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
                      G  +PD YGPK CPA  C   +R +G+++EVYF
Sbjct: 606 KISKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  303 bits (775), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 223/648 (34%), Positives = 311/648 (47%), Gaps = 88/648 (13%)

Query: 24  VILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLRSDG 83
           VI IDSD E DA IRE   P RL PDRR  R RD L+RF+    ++A  + +     +  
Sbjct: 7   VIEIDSDPELDAQIREEYAPRRLIPDRRRNRPRDHLSRFV----SNAEDRNVAPIAPATD 62

Query: 84  PDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRIIQVXXXXXXXX 143
                D +D+ I  EV      DGPI+  A Y++LD    S                   
Sbjct: 63  LPVSTDGEDLEITAEVS--LRPDGPINDDAEYINLDNYRASNN----------------- 103

Query: 144 XXXXXXXXXXXXXXXXXXXIVEER---TARPRITLNLPGGERLEVNATPRDIPIRRSFEF 200
                              +VEER   + RP + L LP G+ L+V+A+  ++P+ RSF+ 
Sbjct: 104 ----GTVVVDHREGDDDLMLVEERIQESGRP-VLLQLPAGQTLQVDASWNELPVGRSFQN 158

Query: 201 QEDXXXXXXXXXXXXXXXXXNLFVE-RSXXXXXXXXXXXXXXXXLPETIQRARRESHMRM 259
           Q                    +F+   +                +P  I   R +  M  
Sbjct: 159 QVYRNPNQLRRLRRHIDHATAMFMGGYNQSGTGDSDFSDNDADYIPPDIVNERNQYTM-- 216

Query: 260 SRRVAERQHRIRAQQQRMVSNENMGTAIRLQ-SIRERIQAYVPDIRSAFHHAESLHEFRS 318
                  Q R+R Q++R    +      RLQ +  E I +  PD+RS F  ++SL +FR 
Sbjct: 217 -------QTRMREQRERQNQMQ------RLQRAADETIDSLDPDLRSLFFESQSLSQFRE 263

Query: 319 ILQ--NVAPVTLQECEGELMALFTEFRNQLLQNWAIDR--------VRNTQXXXXXXXXX 368
            L   N  P  L++    L+  + +FR + +Q+WA  R         RN+          
Sbjct: 264 GLARFNFPPARLEQ----LLGQYRDFRARAMQSWAEGRRTRSMSYQNRNSLRPQRTRSGT 319

Query: 369 XXXGQERVAGGALHHGPYRESISSYL---------NFNGEDGFLTRLWG----------- 408
                    G +  +  Y++ +             NF G    L R+             
Sbjct: 320 QQNHSRGSNGDSRDNALYQQMLFGMPDDDENMDGNNFTGTTQSLQRIISNTMNRRFGNLP 379

Query: 409 ---GP---VLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLP 462
              GP      + D+  +T+ II MIQEREER+     K L   TK+QQ ++ ++A +LP
Sbjct: 380 FGVGPEFGFYEDGDDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLP 439

Query: 463 EGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVG 522
           EGYSASF+T P M + +   G+EET+ V DD  AKT  DV VC LCGVELGVGIPDD+ G
Sbjct: 440 EGYSASFNTAPLMSMTMENEGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKG 499

Query: 523 MSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNX 582
           +S++D+G+SFE L S YKFHCPYQTLARP+++DRDLS+RT+V+SCGHT+CGRC  RI N 
Sbjct: 500 VSEEDKGVSFEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNA 559

Query: 583 XXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
                          G +HPDNYGPK CPA+ C   +R +G ++EVYF
Sbjct: 560 RDISAKEKNKLKNSQGPSHPDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  296 bits (758), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 195/572 (34%), Positives = 280/572 (48%), Gaps = 69/572 (12%)

Query: 74  RIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQEPGSETVETPRII 133
           R  TT  +  P++        + RE  R      P+  +A Y+DL+ EP     +   I+
Sbjct: 39  RSSTTRDTMSPNSNGSNQSEVVSRESSRNADSVSPMGSTAEYIDLEMEPAGNEEQDDMIV 98

Query: 134 QVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARPRITLNLPGGERLEVNATPRDIP 193
                                         V+E+T    I LNLPG   + + AT  D P
Sbjct: 99  ------------YDERLSTPRDAEDDELIFVQEQTRPSTIQLNLPGRNPMRITATEYDRP 146

Query: 194 IRRSFEFQEDXXXXXXXXXXXXXXXXXNLFVERSXXXXXXXXXXXXXXXXLPETIQRARR 253
            RRSFE Q                                          L    + ARR
Sbjct: 147 ARRSFEQQ-------------------------------------ASNRQLRHQTRVARR 169

Query: 254 ESHMRMSRRVAERQHRIRAQQQRMVSNEN-MGTAIRLQSIRERIQAYVPDIRSAFHHAES 312
           +   R +RR     +   +    + SN N +       +I+ R+ +Y  DIRSAF HA++
Sbjct: 170 QPMRRAARRANHSMNGYESDDGGLTSNRNQINYDPEFAAIQRRLDSYPLDIRSAFLHAQN 229

Query: 313 LHEFRSILQNVAPVTLQECEGELMALFTEFRN-------QLLQNWAIDRV--RNTQXXXX 363
           ++EF SI++NV P+T Q+C  +L  LF ++R        Q+ QN    R     TQ    
Sbjct: 230 MNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMARRAAQIGQNMPGYRSPPNRTQGNAD 289

Query: 364 XXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDGFLT-RLWGGP--VLNEADEERH 420
                   G     G  +      ES++ Y+   G  G+ + R+ G P    +  +EE  
Sbjct: 290 LLRRLGPLGVRIGIGTGMG-----ESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEAR 344

Query: 421 TQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPK-MKLDI 479
           TQ+I++ IQEREE+ERD   K+ M KT++Q++ F E+  NLPEGYSASFDTTP  ++L+ 
Sbjct: 345 TQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEP 404

Query: 480 MKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRY 539
           + +G ++ I V D+      E+++VCCLCGVELGVG+PDDF G+S  DR +SF+ LV++Y
Sbjct: 405 LNDGNKQAIVVEDESAIAEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKY 464

Query: 540 KFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNXXXXXXXXXXXXXXXXGS 599
             HCPYQ+L   +  +R LS +TFVASCGHT+CGRC  RI+N                G 
Sbjct: 465 CSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHSKSSKKELSKFKGP 524

Query: 600 AHPDNYGPKLCPADSCKKLIR-SRGRLKEVYF 630
            HPDNYGP+LCPA  CK+ IR  R +++E +F
Sbjct: 525 LHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  256 bits (654), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 142/352 (40%), Positives = 191/352 (54%), Gaps = 21/352 (5%)

Query: 289 LQSIRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQ 348
           +  I   I  Y  +IRSAF HA S +EF +I++    + + +   +L     + RN+  Q
Sbjct: 251 IDEIAREISLYHTNIRSAFIHANSFNEFMAIIEVAPRLGITDDLVDLYLRLEDLRNRTHQ 310

Query: 349 NWA-----IDRVRNTQXXXXXXXXXXXXGQ---ERVAGGALHHGPYRESISSYLNFNGED 400
             +     ID + +                    R    + H    R    +Y   + +D
Sbjct: 311 ANSLFVPDIDNISSNSETTRYDEGWNPVTHPVTNRFIEDSFHSPMIRRIFGNYGGRHHQD 370

Query: 401 GFLTRLWGGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAAN 460
                       ++ DEE  TQ+II MIQEREE E+D+  K     TK +QDEFE RA  
Sbjct: 371 -----------YDDDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATE 419

Query: 461 LPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIPDDF 520
           LP+GYS+SF+T PK K+D+ KNG   +++V+DD +A+  E++ +CCLCGV L  GIPD+F
Sbjct: 420 LPDGYSSSFNTEPKAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEGIPDEF 479

Query: 521 VGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARID 580
            GMS +DR + FE L  +Y   CPYQ L RPS  DRD SKR +VA+CGHTYCGRCY RI 
Sbjct: 480 QGMSNEDRFLPFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQ 539

Query: 581 NXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIR-SRG-RLKEVYF 630
           N                G+ HPDNYGPK CP  SC +L+R SRG   +E YF
Sbjct: 540 NSKEKSKLPKSQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 62/151 (41%), Gaps = 16/151 (10%)

Query: 57  DALNRFIRSDTTDATPQRIGTTLRSDGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYV 116
           D  NR  R D    T  +I  +    G D+ N+ DD+TI+RE+ R    +   +    YV
Sbjct: 70  DISNRNERYDEHTETAVQISNS----GNDSANN-DDITIVREINRSPRRERRNESVTEYV 124

Query: 117 DLDQEPGS-ETVETPRIIQVXXXXXXXXXXXXXXXXXXXXXXXXXXXIVEERTARP---R 172
           DLD EP   E + T  +                              I+ E+  +P    
Sbjct: 125 DLDHEPEDVEPIGTSNL-------DGRSSGSNVNDRDRNNSNIDDLIIISEQHPQPSANS 177

Query: 173 ITLNLPGGERLEVNATPRDIPIRRSFEFQED 203
           I L +PG + +E+     DIP R SFE+Q D
Sbjct: 178 IFLTIPGRQLMELQVASTDIPTRSSFEYQND 208

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 194/353 (54%), Gaps = 32/353 (9%)

Query: 292 IRERIQAYVPDIRSAFHHAESLHEFRSILQNVAPVTLQECEGELMALFTEFRNQLLQNWA 351
           IR RI +Y P+I+S FH+A+SL EF  I+QN  P+T  EC  +L  LF+++  Q +Q+  
Sbjct: 213 IRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDDLTNLFSQY--QSMQH-- 268

Query: 352 IDRVRNTQXXXXXXXXXXXXGQERVAGGALHHGPYRESISSYLNFNGEDG---------- 401
            DR+RN              G       A+ H   R     +  +  ++           
Sbjct: 269 DDRMRNV-GQQGSRQSEPRHGTNYSQRSAVSHSNNRYFYPEFNQYESDEARAQSLLPRIH 327

Query: 402 -FL-TRLWGGPVLNEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAA 459
            FL  RL G P     DEE  TQNII MIQERE+ ERD  +KN  +K+K       + A 
Sbjct: 328 DFLQMRLMGYP---NDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEAK 384

Query: 460 NLPEGYSASFD--TTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCCLCGVELGVGIP 517
           +LP  YSASF   ++P  K  I      ET            E+VS C LCG ELGVGIP
Sbjct: 385 SLPSNYSASFHYPSSPS-KPQIPGGSTSETAES---------EEVSCCVLCGSELGVGIP 434

Query: 518 DDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYA 577
           D F+G S +DR + F  L+S+Y F CPYQ+L RP+ LDRDLSKRTF++ CGH YCGRC+A
Sbjct: 435 DSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGRCFA 494

Query: 578 RIDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
           RIDN                G ++P+ YGP++C AD C  +IR++ RL+E+YF
Sbjct: 495 RIDNAKAKSKISKKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  207 bits (527), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 155/245 (63%), Gaps = 20/245 (8%)

Query: 388 ESISSYLNFNGEDGFLTRLWGGPVL-NEADEERHTQNIIDMIQEREERERDVVMKNLMNK 446
           +S++SY++          ++G P+  +E DEE  TQ+IID+IQ+REE ERD  +K    K
Sbjct: 280 QSMASYMH--------NHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRK 331

Query: 447 TKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITVLDDDLAKTLEDVSVCC 506
           +++Q+ +F E A  LP GYSASF T   ++ +  ++                 ED+ VC 
Sbjct: 332 SESQKKKFYEEAKQLPPGYSASFATPEVIRENDDEDNSN----------NDDDEDMIVCN 381

Query: 507 LCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVAS 566
           LCGVELG+GIP++F G+S++D  +SF  L+ +Y   CPYQ+L +PS LDRDLSKRT+V++
Sbjct: 382 LCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSN 441

Query: 567 CGHTYCGRCYARIDNX-XXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRL 625
           CGH +CGRC+ R  N                 G++HPDN+ PK+CPAD+CK  IRS+G++
Sbjct: 442 CGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKM 501

Query: 626 KEVYF 630
           +EVYF
Sbjct: 502 REVYF 506

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%)

Query: 163 IVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFE 199
           ++EER A   + LNLPGG R+ VNA   + P+R SFE
Sbjct: 120 LLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  200 bits (509), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 141/240 (58%), Gaps = 27/240 (11%)

Query: 418 ERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKL 477
           E+ TQ++I MIQEREERE D+  +    K +  Q    E+A  +PEGYS+SF T   +KL
Sbjct: 425 EQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSFSTEVPVKL 484

Query: 478 --DIMKNGK-----EETITVLDDDLA----KTLEDVSVCCLCGVELGVGIPDDFVGMSQK 526
                KNG      EE    +DD+      +++ +V VCCLCGVELG+GIP+ F G+S +
Sbjct: 485 IDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPETFAGISAE 544

Query: 527 DRGIS-FEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYAR------- 578
           D+ +  F+ + ++Y F CPYQT+ RP+ LDRDLS+RTF+++CGH +CGRCY R       
Sbjct: 545 DKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYNRIHLAKAE 604

Query: 579 --------IDNXXXXXXXXXXXXXXXXGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630
                   I N                GS +PDNYGPK+CP   CK  IR+R +++E YF
Sbjct: 605 TKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRARTKMREAYF 664

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 165 EERTARPRITLNLPGGERLEVNATPRDIPIRRSFEFQED 203
           E+    P I LNLPGG   E++ T  D+P R SFE  ++
Sbjct: 120 EQVIENPHILLNLPGGRTFELSTTTNDLPFRSSFEMLQN 158

>TPHA0I01020 Chr9 (234445..236070) [1626 bp, 541 aa] {ON} Anc_1.286
           YKR017C
          Length = 541

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 13/67 (19%)

Query: 510 VELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGH 569
           +E G+ I ++   + +  RGIS     +R  F CP        +   D  K T+   CGH
Sbjct: 141 IEAGIHINNEQKELPKSQRGIS-----NRDFFTCP--------ICCEDQIKETYSLECGH 187

Query: 570 TYCGRCY 576
            YC  CY
Sbjct: 188 EYCISCY 194

>KAFR0B03500 Chr2 (725799..729752) [3954 bp, 1317 aa] {ON} Anc_8.777
          Length = 1317

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 380 ALHHGPYRESISSYLNFNGEDGFLTRLWGGPVLNEADEERHTQNIIDMIQEREERERDVV 439
           +L +G  R++   Y  +  E+ FL+  +GG VLN+ D E  T   I++     +     +
Sbjct: 54  SLKNGHLRKAFKLYTMWKDEEEFLSHKYGGNVLNQKDREGLTP--IELYNAVLQVRLRRL 111

Query: 440 MKNLMNKTKAQQD---EFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETI 488
            K L  KT   QD   E+ E         +ASF+     K+ + KNG+E  I
Sbjct: 112 PKGLSYKTSNSQDLTVEWNETKD------TASFNIKSAFKV-LPKNGEETKI 156

>KLLA0D14113g Chr4 (1209913..1210914) [1002 bp, 333 aa] {ON} similar
           to uniprot|P03069 Saccharomyces cerevisiae YEL009C GCN4
           Transcriptional activator of amino acid biosynthetic
           genes in response to amino acid starvation expression is
           tightly regulated at both the transcriptional and
           translational levels
          Length = 333

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 466 SASFDTTPKMKLDIMKNGKEETITVL-DDDLAKTLEDVSVCC 506
           ++S D+TP  +LD    G  ET T L D+D+  TLEDVS C 
Sbjct: 124 ASSTDSTPIFELDNQDLGGVETWTSLFDNDIPVTLEDVSDCA 165

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%)

Query: 244 LPETIQRARRESHMRMSRRVAERQHRIRAQQQRMVSNENM 283
           L +++ +A  E  M M+RR  E+Q R + ++ RM++ ENM
Sbjct: 449 LRDSVDKANGEVVMEMNRRNKEKQARGKGRRGRMMAKENM 488

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,420,530
Number of extensions: 2233507
Number of successful extensions: 7782
Number of sequences better than 10.0: 50
Number of HSP's gapped: 7970
Number of HSP's successfully gapped: 70
Length of query: 630
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 514
Effective length of database: 40,180,143
Effective search space: 20652593502
Effective search space used: 20652593502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)