Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.2223.164ON41641620630.0
Skud_4.2243.164ON40841615520.0
Smik_4.2083.164ON41741813700.0
YDL027C3.164ON42042813101e-180
ZYRO0B04862g3.164ON4083143676e-39
TDEL0D045903.164ON3763762833e-27
SAKL0C07392g3.164ON3613252734e-26
KLTH0F06512g3.164ON3703452542e-23
NCAS0I020703.164ON4233412376e-21
Kwal_33.141793.164ON3742622198e-19
KAFR0F022103.164ON3573102021e-16
Kpol_1045.433.164ON3822601843e-14
TPHA0P006703.164ON3803391514e-10
KLLA0C03872g3.164ON3763301096e-05
KNAG0K017303.164ON329196950.003
CAGL0K01639g3.164ON403182760.76
KLTH0G12892g8.295ON492865697.0
KLLA0B14036g1.519ON106335688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.222
         (416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   799   0.0  
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   602   0.0  
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   532   0.0  
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   509   e-180
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   145   6e-39
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   113   3e-27
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   109   4e-26
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   102   2e-23
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...    96   6e-21
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...    89   8e-19
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...    82   1e-16
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    75   3e-14
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    63   4e-10
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    47   6e-05
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    41   0.003
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    34   0.76 
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    31   7.0  
KLLA0B14036g Chr2 complement(1234021..1237212) [3192 bp, 1063 aa...    31   8.0  

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/416 (94%), Positives = 393/416 (94%)

Query: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK 60
           MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK
Sbjct: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK 60

Query: 61  SYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVK 120
           SYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVK
Sbjct: 61  SYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVK 120

Query: 121 IYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVFYKDI 180
           IYKVSPLLILFTTVSLFTFILTSTM                       KRWQKNVFYKDI
Sbjct: 121 IYKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQFKRWQKNVFYKDI 180

Query: 181 LNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQFL 240
           LNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQFL
Sbjct: 181 LNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQFL 240

Query: 241 SFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQ 300
           SFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQ
Sbjct: 241 SFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQ 300

Query: 301 YKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESE 360
           YKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESE
Sbjct: 301 YKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESE 360

Query: 361 TANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE 416
           TANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE
Sbjct: 361 TANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE 416

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/416 (72%), Positives = 337/416 (81%), Gaps = 10/416 (2%)

Query: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK 60
           M RLPLGL    RAV+N  P NS  +FN CS RQL  S + LP           G+EG +
Sbjct: 1   MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTSYRALP---------KHGMEGFQ 51

Query: 61  SYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFS-RSPKNGDKPIV 119
           SYKLS +SH   SY  + V +PV+SIFK T+KR FHSS  A+IKFMFS RSPKNGDKP+V
Sbjct: 52  SYKLSLISHKYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLV 111

Query: 120 KIYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVFYKD 179
           KIYKVSP  I+F T SLFTFILTST+                       K+WQKN+FYKD
Sbjct: 112 KIYKVSPFFIIFATASLFTFILTSTIIVIPFVLHFFFPLLIIFIFFKQFKKWQKNIFYKD 171

Query: 180 ILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQF 239
           IL+SLPRTELKI VPTMRSLQ+QPM+QSWKDISSRMGIPNEFAKGLNVDLVKQ+ETRKQF
Sbjct: 172 ILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQF 231

Query: 240 LSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASV 299
           LSFL+KRVLESFTKNEMG+RSYFLGDNVEKWI+ SYDLELDI++CRSELRKFQ+SIF+SV
Sbjct: 232 LSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSV 291

Query: 300 QYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQES 359
           +YKLYLDSMK+ PL+PSK  EGK+H+ADVYVIILD+SFPEIMFNGGGYSKADFFKILQES
Sbjct: 292 RYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQES 351

Query: 360 ETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLR 415
           ETANS+K HN IIA+KSVNTPLS HF+ITAKGDSGDFFSKY +S VDG HTEYTLR
Sbjct: 352 ETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/418 (66%), Positives = 325/418 (77%), Gaps = 3/418 (0%)

Query: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK 60
           M R+PLGLV   R   N   FN+T  FN    R+L  S K + L  +  + +    EG +
Sbjct: 1   MLRIPLGLVSITRPATNTALFNNTIRFNAFLPRKLGNSPKPVSLAVIFPSISKYAREGFQ 60

Query: 61  SYKLSSL-SHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKF-MFSRSPKNGDKPI 118
             ++ SL S N  S   + +SN ++   KL +KRAFHS+ HA+IKF  FSRS +N +KP 
Sbjct: 61  PRRIFSLMSSNYCSCPHQFLSNSMSLSSKLISKRAFHSTRHAEIKFSFFSRSHRNNNKPF 120

Query: 119 VKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVFYK 178
           VK+YKVSP  ILF T S+FTFILTST+                       K+WQ N FYK
Sbjct: 121 VKVYKVSPFFILFATASIFTFILTSTIIVIPFIFHFFFPLLIMLVFFKQFKKWQNNTFYK 180

Query: 179 DILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQ 238
           DIL SLP+TELKITVPTMRSLQ+QPMIQSW++ISSRMGIPNEFAKGLNVDL KQDETRKQ
Sbjct: 181 DILISLPKTELKITVPTMRSLQLQPMIQSWREISSRMGIPNEFAKGLNVDLEKQDETRKQ 240

Query: 239 FLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFAS 298
           FLSFL+KRVLESFTKNEMGIRSYFLGD VEKWI+ESYDLELDI+NCRSELRKFQ+ +F+S
Sbjct: 241 FLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLELDIDNCRSELRKFQNFVFSS 300

Query: 299 VQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQE 358
           V+Y+LYLDS+K LPLNPSKKFEGKKH+ADVYVIILD+SFPEIMF+G GYSKADFFKIL+E
Sbjct: 301 VRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFPEIMFSGEGYSKADFFKILRE 360

Query: 359 SETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE 416
           SETANS+KM N IIA+KSVN PLS HF+ITA GDSG+FFSKYH++K+DGK+TEYTLRE
Sbjct: 361 SETANSSKMLNMIIAIKSVN-PLSSHFVITANGDSGNFFSKYHITKIDGKNTEYTLRE 417

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  509 bits (1310), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 275/428 (64%), Positives = 326/428 (76%), Gaps = 20/428 (4%)

Query: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLP-LLR-----LPSTCTSS 54
           M ++P+GL  R R + N    NS  L N   F         LP +LR     +PS  TS 
Sbjct: 1   MFKVPVGLASRTRELMNSVTLNS--LNNGKGFNMY------LPGILRAFPKPVPSAITSP 52

Query: 55  GI-----EGHKSYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFS- 108
            I     E  +  KLS +S N  S   + +S+  +S  +L  KRAFHSS  A+IKF+FS 
Sbjct: 53  AIPKYRGESFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSS 112

Query: 109 RSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXXXX 168
           +SPKNG+KP VK+YKVSP  I+F T S+FTFILTST+                       
Sbjct: 113 KSPKNGNKPFVKVYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFFFPLLIMFFFFKQF 172

Query: 169 KRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVD 228
           K+WQKN+FYKD+L SLP+T+LKIT+PTMRSLQ+QPM+QSWK+ISSRMGIPNEFAKGLNVD
Sbjct: 173 KKWQKNIFYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVD 232

Query: 229 LVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSEL 288
           LVKQ+ETRKQFLSFL+KRVLESFTKNE+GIRSYFLGD+VEKWIKESYDLELDI+NCRSEL
Sbjct: 233 LVKQEETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSEL 292

Query: 289 RKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYS 348
           RKFQ  IF+SV+YKLYLDSMK+LPLNPSKK EGKKH+ADVYVIILD+SFP IMFNGG YS
Sbjct: 293 RKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYS 352

Query: 349 KADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGK 408
           KADFFKILQESET+NS+K  NTIIA+KSVNT LS HF+IT  GDSG+FFSKY++SK++ K
Sbjct: 353 KADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDK 412

Query: 409 HTEYTLRE 416
           +TEYTL+E
Sbjct: 413 NTEYTLKE 420

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  145 bits (367), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 157/314 (50%), Gaps = 38/314 (12%)

Query: 114 GDKPIVKIYKVSPLLILFTTVSLFT--FILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRW 171
           G++P ++++K+SPL+I   ++   T  F++   M                       ++W
Sbjct: 118 GNRPPLRVFKISPLVIFLASIGALTVFFLILPFMLTFFLPLFVVGISVYQF------RKW 171

Query: 172 QKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISS-RMGIPNEFAKGLNVDLV 230
           + N  +  +LN L ++E+++   T+ ++ ++ + + +    +   G+  E  KG++  + 
Sbjct: 172 KNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKM- 230

Query: 231 KQD---------ETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDI 281
           K+D             + LSF++ RV+E+   +E GIR+YFLGD+V  WIKE YD EL  
Sbjct: 231 KRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGS 290

Query: 282 ENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIM 341
            +CRS +R F++ I   + Y +YL S              K+HLADV V +L     E  
Sbjct: 291 SDCRSFVRGFKNEIIFWIVYPIYLKSST----------HPKRHLADVSVAVLQGHHAE-- 338

Query: 342 FNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYH 401
                 +  DFF  L ++     N   N  I+VKS ++ L   F+I   G+SGDF++KY 
Sbjct: 339 -----RNNYDFF--LVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYD 391

Query: 402 VSKVDGKHTEYTLR 415
           V +    HTEYT+R
Sbjct: 392 VHENSDGHTEYTIR 405

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  113 bits (283), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/376 (25%), Positives = 166/376 (44%), Gaps = 58/376 (15%)

Query: 46  RLPSTCTSSGIEGHKSYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKF 105
           R  S C S  +  H  Y              RP+S   N +F  T  R     P      
Sbjct: 50  RQVSACRSLTLTRHSPY-------------VRPLSFVGNRLFHTTTPRYMPPYP------ 90

Query: 106 MFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXX 165
                    ++P  K+Y++SP++ + T +  F  +L + +                    
Sbjct: 91  ---------NQPPFKVYRISPIVAVLTGIG-FLMLLFAVLPFIFTFFFPLIIAGICAYQF 140

Query: 166 XXXKRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGL 225
               +W++ V ++DIL  L  + +K+   T+++L ++ + +  +       +  +  K  
Sbjct: 141 ---SKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSF 197

Query: 226 NVDLVKQ-----DETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELD 280
           + DL  +          + L F++ R+LE+   NE GIR+YFLGD+V +W++++Y LELD
Sbjct: 198 DADLRARLDKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELD 257

Query: 281 IENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEI 340
               ++  +     +   + + LYL S      NP      +KHLA+V + +L   F   
Sbjct: 258 TTQYKTNAQVGDGELIMLLVFPLYLKSNS----NP------RKHLANVSLALLQGLFE-- 305

Query: 341 MFNGGGYSKADFFKILQE-SETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSK 399
                G + A++ + L   SET    +M   +IAV+ V    +  F+I+  G SGD++SK
Sbjct: 306 -----GTNGANYLEFLSSISETDAECQM---VIAVQPVTNFSTKLFVISTDGRSGDWYSK 357

Query: 400 YHVSKVDGKHTEYTLR 415
           Y   +    HTEYT++
Sbjct: 358 YDSKEDSDGHTEYTVK 373

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  109 bits (273), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 134/325 (41%), Gaps = 37/325 (11%)

Query: 93  RAFHSSPHAQIKFMFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXX 152
           R  H+ P  +  F      + G +P +  ++ SP ++ F  V L    L++         
Sbjct: 68  RNLHTHPPRRTPF------RPGPRPTIAPFRTSPWVMFFAGVGL----LSALFVVLPLVF 117

Query: 153 XXXXXXXXXXXXXXXXKRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDIS 212
                           KRW+    Y  +  SL  T+L +   ++R L    +    +   
Sbjct: 118 TLFFPLVVAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDR 177

Query: 213 SRMGIPNEFAKGLNVDLVKQDET----RKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVE 268
           +   + +    G  +  +  DE      +Q L+FLE RVLES   NE G+R +FLG +V+
Sbjct: 178 AGAELFDTVVNGRKMRDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVD 237

Query: 269 KWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADV 328
            WI++ YDL+LD   C +  R     +  SV Y LYL S  +           ++ LADV
Sbjct: 238 SWIRDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTN-----------RRKLADV 286

Query: 329 YVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIIT 388
            ++ LD+    +    G Y   D          A  ++    +I++  V T +   FII+
Sbjct: 287 SIVFLDE---RLAAGSGFYPPGDL---------AGQDERCPMVISIVPVRTLVPRQFIIS 334

Query: 389 AKGDSGDFFSKYHVSKVDGKHTEYT 413
             G SG+  S+         H EYT
Sbjct: 335 TPGASGNNASRLTQRTTRDGHREYT 359

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/345 (26%), Positives = 148/345 (42%), Gaps = 56/345 (16%)

Query: 89  LTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVKIYKVSPLL---ILFTTVSL--------F 137
           L  KR+FH     +  F   R P  G  P  K+Y   PLL    L  T++L        F
Sbjct: 60  LIQKRSFHRDAILRSPFQNGRFPGEGKSPF-KLYTFPPLLGIVALIGTIALLLVVLPLVF 118

Query: 138 TFILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVFYKDILNSLPRTELKITVPTMR 197
           TF+    +                       KRWQ       +   L  T++ I   T+ 
Sbjct: 119 TFLFPLIIAGIAVFQF---------------KRWQNTTLLGQLHRCLLATKMSINYKTVW 163

Query: 198 SLQMQPMIQSWKD-----ISSRMGIPNEFAKGLNVDLVKQDETRKQFLSFLEKRVLESFT 252
            LQ Q M +S          S  G+ +E  +   +D         + L+FL++RVLE+F 
Sbjct: 164 GLQTQ-MFESLLGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFK 221

Query: 253 KNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLP 312
            NE+G+R +FLG +   W+K+ YDL L  +  R   +   +S+  ++ Y LYL       
Sbjct: 222 NNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL------- 274

Query: 313 LNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTII 372
           L+ S++   +K +A V + +LD S            +   FK ++  E A+ NK    +I
Sbjct: 275 LSSSQE---RKLIAYVAIGVLDDSMA---------GQTGSFKFVE--ELASQNKECPMVI 320

Query: 373 AVKSVNTPLSHHFIITAKGDS-GDFFSKYHVSKVDGKHTEYTLRE 416
           +++   +  +  F++   G++ G   S Y+V   D  H E+T R+
Sbjct: 321 SIRPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYRD 365

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score = 95.9 bits (237), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 92/341 (26%), Positives = 150/341 (43%), Gaps = 55/341 (16%)

Query: 93  RAFHSSPHAQIKFMFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXX 152
           R FHS+P  Q KF  +  P N     +KI ++  +L++F+++     IL  T+       
Sbjct: 121 RKFHSTP--QKKFNGNEGPPNRR---IKIIRIPSILLIFSSLG----ILIITLMILPLLI 171

Query: 153 XXXXXXXXXXXXXXXXKRWQKNVFYKDILNSL---PRTELKITVPTMRSLQMQPMIQSWK 209
                           ++W++N  YK +L  L    +  + I   T+ SLQ + +     
Sbjct: 172 SAFFPFLILGIALFQFRKWKQNTLYKQLLAHLKNKSKGHMSIKYSTLNSLQYKIL----N 227

Query: 210 DIS----SRMGIPNEFAKGLNVDLVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFLG- 264
           DIS    S+   P+     +N  +       +  L+ L+ R++E+   +E+GIR+YFLG 
Sbjct: 228 DISFMKNSQGFKPDILNMKMNDFINSNARDSEALLNLLQSRIMEAIETDELGIRTYFLGA 287

Query: 265 ----DNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFE 320
               +NV  W+ E  D ELD +N  S+ +     +  SV Y LYL S+K           
Sbjct: 288 ADNINNVTHWVNEGLDFELDTKNSISKGKLVNGEMILSVTYALYLKSLK----------S 337

Query: 321 GKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTP 380
            K+ +A+V +++LD+S            K   F  +  ++ A +NK    + A+K V   
Sbjct: 338 PKRRIAEVSIVVLDES----------VEKNHVF--ISINDLAKTNKSCPMVFAIKPVKID 385

Query: 381 LS-----HHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE 416
           LS       FI+   G SG   S Y V      + E+ LRE
Sbjct: 386 LSLLLQPFQFILDDYGRSG---SNYDVYNTKSGNREFRLRE 423

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 116/262 (44%), Gaps = 48/262 (18%)

Query: 169 KRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQS---------------WKDISS 213
           K+W+     + +   L  ++++I   T+  LQ + M +S                 D+S+
Sbjct: 145 KKWKSATLMQQLHRRLLTSKMRIDRHTILGLQAR-MFESLLGSERNSAIFFRRAMDDMSA 203

Query: 214 RMGIPNEFAKGLNVDLVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKE 273
           R      F  G +             +SFL+ R+LE+F  NE GIR YFLG +V+ W++ 
Sbjct: 204 RQMDDTSFKSGAD-----------DMISFLDSRILEAFKSNEQGIRDYFLGADVKTWVEN 252

Query: 274 SYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIIL 333
            Y+L LD ++ R+  +  + +   ++ Y LYL S            + KK LADV V +L
Sbjct: 253 GYELSLDSDSPRTIGKSIEGTFVMTITYPLYLLSSN----------QRKKLLADVTVAVL 302

Query: 334 DKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDS 393
             S P          K   F ++QE+     NK    +I++K      ++ FI+    D+
Sbjct: 303 GDSTP---------GKPSPFFLMQENFA--DNKDCPMVISIKPARALNTNQFILDETDDN 351

Query: 394 GDFFSKYHVSKVDGKHTEYTLR 415
           G+  S+Y V      H E+  R
Sbjct: 352 GNHPSRYTVKTTSDGHREFRYR 373

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 132/310 (42%), Gaps = 46/310 (14%)

Query: 107 FSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXX 166
           ++ SP    +P V+IY+++ L +L  +      +L STM                     
Sbjct: 89  YNGSPFEDKEPRVRIYRITTLNLLLGSA---VVLLLSTMILPILLKLIFPMIILGIFIYQ 145

Query: 167 XXKRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLN 226
             + W++   +  I   L RT L I   T+ SLQ   + +  K    +    NE      
Sbjct: 146 Y-RIWKRTKLFDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILKKSVPKSWYTNEDISDAE 204

Query: 227 VDLVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFL--GDNVEKWIKESYDLELDIENC 284
           +            LSF++ RV+E+F KNEMGI  YFL  G N +        L +D EN 
Sbjct: 205 I-----------LLSFIKLRVIEAFKKNEMGISDYFLRRGQNFD-----DLSLLIDKENS 248

Query: 285 RSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNG 344
           +  +R+   +   +++++L L           K      +LADV + +LD S        
Sbjct: 249 QFLIRRLAGNFIVTMRHQLLL-----------KNENVDIYLADVMISVLDDS-------- 289

Query: 345 GGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSK 404
              S+   F  L+E   A SNK    +I+V S +  L   F+IT +G++G F+ K+ VS 
Sbjct: 290 ---SQTGIFMPLKE--LAKSNKSCKMVISVVSNSDILPRQFVITDEGETGKFYGKFTVSH 344

Query: 405 VDGKHTEYTL 414
               H E+ +
Sbjct: 345 GKDGHREFRI 354

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 120/260 (46%), Gaps = 35/260 (13%)

Query: 169 KRWQKNVFYKDILNSLPRTELKITVPTMRSLQ---MQPMIQS-WKDISSRMGIPNEFAKG 224
           KRW+ N       + L  + L+  + TM ++    ++ M+ +  K   S  GI NE    
Sbjct: 146 KRWRANRMINKWFDGLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSYGGIFNETLNA 205

Query: 225 LNVD-----LVKQDETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYD--L 277
           + ++      ++ +E+ ++  +F+E RV+E+  KNE GIR+  L  N EK +  + D   
Sbjct: 206 MKMNPMYKNSIEFNESGEKLRNFIEYRVIEAIYKNEEGIRTT-LFHNYEKALDPNIDKPF 264

Query: 278 ELDIENCRSELRKFQD-SIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKS 336
            LD  N  S  R  +D S+ +SV Y LY + +KD P            +  V ++ ++  
Sbjct: 265 RLDFNNVNSFQRFEKDGSLISSVTYPLYTN-LKDKP---------AVVVGYVSIVTMNDH 314

Query: 337 FPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDF 396
              I    G   K D  K L+             II+++S +  + ++FII   G++G  
Sbjct: 315 PLRINLGSGDIPKVDLSKKLK------------FIISIRSPSEMIPNYFIIDTVGETGKI 362

Query: 397 FSKYHVSKVDGKHTEYTLRE 416
           FS Y V K    H EYTL +
Sbjct: 363 FSHYSVGKTTDGHNEYTLNK 382

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 138/339 (40%), Gaps = 52/339 (15%)

Query: 89  LTNKRAFHSSPHAQIKFMFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXX 148
            T KR FH S H ++  M  R    G  P V I++++P+ I    ++ +  I        
Sbjct: 83  FTTKRHFHQS-HYKLYSMGKRPFFEGRTP-VTIFRLTPMKIFLFALTFYVMIF----LLV 136

Query: 149 XXXXXXXXXXXXXXXXXXXXKRWQKNVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSW 208
                               ++W+ N   K  +NSL +T++     T   L+   +    
Sbjct: 137 PFILSILLPAAILGYAFFQYRKWRLNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSVE 196

Query: 209 KDISSRM----GIPN-EFAKGLNVDLVKQ--DETRKQFLSFLEKRVLESFTKNEMGIRSY 261
           KD  S++      PN    + +N D+ +    E   +F  F+E RVLE+F  +E G+RS 
Sbjct: 197 KDARSQVFGFTNTPNGPIFRAMN-DMTRDLSTEASDKFKKFIEARVLEAFVSDEDGVRSA 255

Query: 262 FLGDNVEKW-IKESYDLELDIENCRSELRKF--QDSIFASVQYKLYLDSMKDLPLNPSKK 318
              D+  K  IK S    L IE  R   R F  +D  + +  + L ++S       PS  
Sbjct: 256 LASDHTWKQAIKTSR--PLGIEFGRMVERSFVARDKKYMTYAFPLSINS-------PSG- 305

Query: 319 FEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVN 378
              + HL  V ++              G++  D              K +  +I     N
Sbjct: 306 --SQSHLGRVSIVACHPL-------SAGFNPPD--------------KTNLKLILCIESN 342

Query: 379 TPLSHH-FIITAKGDSGDFFSKYHVSKVDGKHTEYTLRE 416
           + LS   FII   G +G+FFSKY V K    HTEYT+++
Sbjct: 343 SKLSPDLFIIDTNGMTGEFFSKYDVQKFK-DHTEYTVKK 380

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 139/330 (42%), Gaps = 44/330 (13%)

Query: 93  RAFHSSPHAQI---KFMFSRSPKNGDKPIVKIYKVSPLLILFTTVSLFTFILTSTMXXXX 149
           R FHS+P   +   +  F +SP N  +    I+ +SP   + +T+ LF   +T  +    
Sbjct: 78  RNFHSTPRNMVLGGRDPFRKSPFNNPR---FIFSISPFSFILSTL-LFAGFITMIVFVLP 133

Query: 150 XXXXXXXXXXXXXXXXXXXKRWQKNVFYKDILNSLPRTELKITVPTMRSL---QMQPMIQ 206
                              K ++     + + ++  +T++K++  T R L   QM P  +
Sbjct: 134 FLLALLFPMVIFGIGWYQFKAFRTRKLMQLLDHAFNQTKMKLSSTTRRELIMKQMVPKFK 193

Query: 207 SWKDISSRMGIPNEFAKGLNVDLVKQDE--TRKQFLSFLEKRVLESFTKNEMGIRSYFLG 264
           S+  +    G P + ++    D  +  E     +FLSF++ R+ ESF KNE  I+S  LG
Sbjct: 194 SFTQLKDFSGFPFKLSQAF-TDKFQSGEFPNADRFLSFVKSRLDESFYKNEHNIKSIVLG 252

Query: 265 DNVEKWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEG-KK 323
            +   ++    +L  +  +  S +R  ++           + +   + LN     EG +K
Sbjct: 253 SDTA-YVPGHMELVTNSYSFVSSVRNNEN-----------IQAFSFMLLNMGS--EGVRK 298

Query: 324 HLADVYVIILDKSFPEIMFNGGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSH 383
            +A VY++       E++   G Y               + +K+   +I V+++ +P S 
Sbjct: 299 PVALVYIVTKANPGDELLMFTGDY--------------IDDSKLSPMVIYVRAL-SPFSK 343

Query: 384 HFIITAKGDSGDFFSKYHVSKVDGKHTEYT 413
              IT  G++G   ++Y V +      EYT
Sbjct: 344 CCFITDVGETGA-NAQYSVKRKKDGSKEYT 372

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 41/196 (20%)

Query: 119 VKIYKVS--PLLILFTTVSLFTFILTSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVF 176
           ++ Y++S  PLLI F+TV+L  F++   +                       K+WQ+N  
Sbjct: 88  IRYYRISMVPLLI-FSTVTLMVFVIVLPVLLKLFFPVILVAIIVYQF-----KKWQRNQL 141

Query: 177 YKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETR 236
           Y  ++  LP+++L  T     SL+     +S+  +S      NE   G +V+        
Sbjct: 142 YSRLMKYLPKSDLYTTKSQFMSLR-----RSFGLLS------NEAVVGKSVE-------- 182

Query: 237 KQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIK-----ESYDLELDIENCRSELRKF 291
             F +F++ R++E+  K+ M IRS  +  +   WI      E Y L + +   +   +  
Sbjct: 183 --FTNFVKTRIMEALAKDTMKIRSTLIKPS---WIPKNAAVEEYQLTIGLNRVKMFAKAL 237

Query: 292 Q---DSIFASVQYKLY 304
           Q    ++F SV+Y L+
Sbjct: 238 QGQSKAVF-SVEYPLF 252

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 75/182 (41%), Gaps = 35/182 (19%)

Query: 92  KRAFHSSPHAQIKFMFSRSPKNGDK---------PIVKIYKVSPLLILFTTVS-LFTFIL 141
           KR F+++    IKF+FS+  K+            P+V +  +   ++LFT +  LFTF  
Sbjct: 99  KRGFYTTSKKSIKFIFSKGDKDNHNKMKYYSIPTPVVILSTIGGFVLLFTILPFLFTFGF 158

Query: 142 TSTMXXXXXXXXXXXXXXXXXXXXXXXKRWQKNVFYKDILNSLPRTELKITVPTMRSLQM 201
              +                       +RW+ +  YK +   L  +++ +    + SL+ 
Sbjct: 159 PFLI---------------GMIVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLK- 202

Query: 202 QPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQFLSFLEKRVLESFTKNEMGIRSY 261
                 ++ I   + +   F+      L  + ET    ++ L++R+ ESF  N+  I + 
Sbjct: 203 ------YRLIEQGLPMLTNFSNKTTKQLSSRGET---LINQLQQRIKESFANNDNNIANV 253

Query: 262 FL 263
           F+
Sbjct: 254 FV 255

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 267  VEKWIKESYDLELDIENCRSELRKFQDSIFASVQYKLYLDSM---KDLPLNPSKK--FEG 321
            +EK +  S +L   +   R +LRKF D++ A+ Q +  LDS+   K   LNPS K  +E 
Sbjct: 3744 IEKGMALSENLLYLLITSRGQLRKFADNLHATAQLRKELDSIASTKSALLNPSLKTNYET 3803

Query: 322  KKHLA 326
              HL 
Sbjct: 3804 FSHLC 3808

>KLLA0B14036g Chr2 complement(1234021..1237212) [3192 bp, 1063 aa]
           {ON} similar to uniprot|P33418 Saccharomyces cerevisiae
           YKL205W LOS1 Nuclear pore protein involved in nuclear
           export of pre-tRNA
          Length = 1063

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 3/35 (8%)

Query: 278 ELD--IENCRSELRKFQDSIFASVQYKLYLDSMKD 310
           E+D  +EN RS+L+ FQDSI A +  +LY D + D
Sbjct: 447 EIDEFVENIRSKLKTFQDSI-AVINPELYFDIISD 480

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,182,629
Number of extensions: 1818471
Number of successful extensions: 5607
Number of sequences better than 10.0: 36
Number of HSP's gapped: 5762
Number of HSP's successfully gapped: 36
Length of query: 416
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 304
Effective length of database: 40,638,807
Effective search space: 12354197328
Effective search space used: 12354197328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)