Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_4.2193.160ON53153125450.0
Skud_4.2213.160ON53153120320.0
Smik_4.2053.160ON53153119930.0
YDL030W (PRP9)3.160ON53053119580.0
NCAS0C035403.160ON51853512761e-171
NDAI0G028903.160ON53654712391e-165
TDEL0D046203.160ON51654111981e-159
ZYRO0B04950g3.160ON50653411941e-159
Kpol_479.263.160ON51753311911e-158
KAFR0C010503.160ON50653611381e-151
SAKL0C08800g3.160ON60153511091e-145
TPHA0A009103.160ON52753810601e-138
KLTH0C08888g3.160ON50653610101e-131
Ecym_35493.160ON5325389711e-125
CAGL0K01573g3.160ON5165459391e-120
Kwal_56.227993.160ON5315329351e-120
KNAG0K011203.160ON5275458901e-113
AEL085W3.160ON5275408891e-113
KLLA0F24662g3.160ON5305367433e-91
TBLA0B016003.160ON4863392222e-18
Kwal_14.10648.11ON16238760.49
Suva_10.1588.11ON16989760.55
SAKL0B00704g8.11ON16938750.67
NDAI0C065808.11ON16980750.69
ABR234C8.11ON17538741.0
Ecym_15318.11ON17138731.1
Suva_4.5391.309ON43878751.4
Skud_12.1398.11ON16484712.0
CAGL0K12804g8.11ON17238712.1
KLTH0G19096g8.11ON15938712.2
YBR279W (PAF1)1.309ON44578722.9
Smik_2.4211.309ON42780723.1
Smik_12.1348.11ON16658703.2
Skud_2.4101.309ON436104723.6
CAGL0J07370g2.15ON62326714.4
Suva_14.1162.15ON60083705.2
TBLA0G001702.15ON65926698.5
YNL227C (JJJ1)2.15ON59026698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_4.219
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   984   0.0  
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   787   0.0  
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   772   0.0  
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   758   0.0  
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   496   e-171
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   481   e-165
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   466   e-159
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   464   e-159
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   463   e-158
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   442   e-151
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   431   e-145
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   412   e-138
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   393   e-131
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   378   e-125
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   366   e-120
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   364   e-120
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   347   e-113
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   347   e-113
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   290   3e-91
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    90   2e-18
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    34   0.49 
Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {O...    34   0.55 
SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly si...    33   0.67 
NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {...    33   0.69 
ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON} Sy...    33   1.0  
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    33   1.1  
Suva_4.539 Chr4 (933471..934787) [1317 bp, 438 aa] {ON} YBR279W ...    33   1.4  
Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {O...    32   2.0  
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    32   2.1  
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    32   2.2  
YBR279W Chr2 (761257..762594) [1338 bp, 445 aa] {ON}  PAF1Compon...    32   2.9  
Smik_2.421 Chr2 (746964..748247) [1284 bp, 427 aa] {ON} YBR279W ...    32   3.1  
Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {O...    32   3.2  
Skud_2.410 Chr2 (730216..731526) [1311 bp, 436 aa] {ON} YBR279W ...    32   3.6  
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    32   4.4  
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    32   5.2  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    31   8.5  
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    31   8.9  

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/531 (93%), Positives = 495/531 (93%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60
           MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY
Sbjct: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXX 120
           KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSF        
Sbjct: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELE 120

Query: 121 XXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180
                       DINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM
Sbjct: 121 EELKNEQENYQLDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240
           ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240

Query: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300
           ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP
Sbjct: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300

Query: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360
           GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK
Sbjct: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360

Query: 361 YEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYDAT                LQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480
           YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ
Sbjct: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480

Query: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV
Sbjct: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/531 (72%), Positives = 438/531 (82%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60
           M+ LET+RSLLEDLEIIENAI  RIQRNPELYY YI E+ K+FPD+K P+PSL++ENKIY
Sbjct: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXX 120
           KLKK KRNRKQVILQQHEIDLFLRDY EKQ+  NE N  + V+ED+K++  F        
Sbjct: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120

Query: 121 XXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180
                       DINL R +YALFSSSA+PSKRTNILSERARD+DLN++FTRDEQYGEYM
Sbjct: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240
           EL+QFH LWLNVI+R DCSLLQFF+ +ELFVDDKK+LL PPMDRKNDRYM FLM+LS+Y+
Sbjct: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240

Query: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300
           E+FF+KSY LF+KE+VE  I+SDF+NSYC+G+++SE+KGIYCP C KWFKT  VFENH+ 
Sbjct: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300

Query: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360
           GKNHKKNEAKRK  VYSEYKLHRYL+ LKDE FHT+SF+ERKLAFTANERM EMDSLT+K
Sbjct: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360

Query: 361 YEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD T                LQEK  FGKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480
           YPCEICANR+YNGRRTFERHFNEE HLYHLRCLGIEPS  FKGITKIAE Q+LWK+ Q+Q
Sbjct: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480

Query: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
            +  SS A    +K  SQ KLP G+ELEEEDE+GNVMSKKVYDELKKQGLV
Sbjct: 481 HRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/531 (71%), Positives = 430/531 (80%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60
           M FLET+RSLLED+EIIENAI ERI+RNPELYY YI E+ K+FPD+K P+ SL++ENK++
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXX 120
           K+KK KRNRKQVILQQHEI LFLRDY EKQ+  N IN     QED+KDL SF        
Sbjct: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120

Query: 121 XXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180
                       DIN KR +YALFSSS + SKRTNILSERARD+DLN++FTRDEQYGEYM
Sbjct: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240
           ELEQFHSLWLNV KR DCSLLQFFD VELFVDDKKYLL PPMDRKNDRYM+FL+KL +Y+
Sbjct: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240

Query: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300
           E+FF+KSYALF+KEV+E  I+ DF+ SYC+G L+SE+KGI+CP CYKWFKT  VFENH+ 
Sbjct: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300

Query: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360
           GK HKKNE KRK  VYSEYKLHRYL+ LKDE  HTKSFVERKL FTANER+ EMD+LTQK
Sbjct: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360

Query: 361 YEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD T                LQEKH FGKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDPTDKDGDQQKGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420

Query: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480
           Y CEICAN++YNGRRTFERHFNE  HLYHLRCLGIEPS  FKGITKI EAQ+LW+N Q Q
Sbjct: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480

Query: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           PQ  +SIA+   + K S++KLP  +ELEEEDE+GNVMSKKV+DELKKQGLV
Sbjct: 481 PQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/531 (71%), Positives = 437/531 (82%), Gaps = 1/531 (0%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60
           M+ LET+RSLLE++EIIENAI ERIQRNPELYY YI E+ K+FPD K PR SL++ENKIY
Sbjct: 1   MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIY 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXX 120
           K KK KR RKQ+ILQQHEI++FLRDY+EKQ+  N+IN P++ QED+KDL +F        
Sbjct: 61  KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120

Query: 121 XXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180
                       DIN K+ +YALFSSS++PS+RTNILS+RARD+DLN +FTRDEQYGEYM
Sbjct: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240
           ELEQFHSLWLNVIKRGDCSLLQF D +ELF+DD+KYLL PPMDRKNDRYM+FL+KLS+YV
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV 240

Query: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300
           E+FF+KSYAL +   VE LIKSDF++SYCRG L+SE+KGIYCP C +WFKT +VFE+H+ 
Sbjct: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360
           GK HKKNE+KR+  VYSEYKLHRYL+ L DE   T+SFVERKLAFTANERM EMD LTQK
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 361 YEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD+T                LQE+HL GKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480
           Y CEIC+N++YNGRRTFERHFNEE H+YHLRCLGIEPSSVFKGITKI EAQ LWKN Q Q
Sbjct: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480

Query: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
            Q ++SIAAVP +   SQ K+P  +ELEEEDE+GNVMSKKVYDELKKQGLV
Sbjct: 481 SQ-LTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  496 bits (1276), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 271/535 (50%), Positives = 344/535 (64%), Gaps = 28/535 (5%)

Query: 3   FLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFP-DIKQPRPSLVSENKIYK 61
            LE KR+LLEDLE+IE+AI +R QRNPELYY  I +   L    I  P  S  S NKIYK
Sbjct: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYK 63

Query: 62  LKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXXX 121
            KK KR+RKQ +LQQ EI++FL+D++E++R++ ++   + V++D   L +F         
Sbjct: 64  RKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLG-KETVKDDNITLETFKTMIQDINA 122

Query: 122 XXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYME 181
                       IN K  RYA+FS+S   SK  NILS+R   +D+N+ F+R+EQYG+YM+
Sbjct: 123 KKSSSEVL---PINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179

Query: 182 LEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYVE 241
            E F+  WLNV+K GD +LLQF + + +F+D++KYL  PPMDRKN+RYM FL  L  YVE
Sbjct: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239

Query: 242 SFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIPG 301
           SFF++ YAL  K  +   I+S F   Y +   +   KG YC  C KWFKT++VF NHIPG
Sbjct: 240 SFFFRKYALINKSAITSQIESQF-TEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPG 298

Query: 302 KNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKY 361
           KNH KNE +RK  + SEYKLHR+  LL++E   T  F+E K+A TA+ERM EM  LT+ Y
Sbjct: 299 KNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENY 358

Query: 362 EAPAY--DATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDR 419
           E PAY  D                   + + L   SFDMPLGPDGLPMP+WLYKL GLD 
Sbjct: 359 EKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDV 418

Query: 420 EYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQS 479
           EYPCEIC+N+I+ GRR FE+HF   TH YHLRCLGIEPSS+FKGITKI EAQ+LW +  S
Sbjct: 419 EYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINS 478

Query: 480 QPQ----FVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGL 530
           Q       VSSI                 +++E ED  GNVMSKK+YDELKKQGL
Sbjct: 479 QKNSSKPMVSSIE----------------LQVEVEDSVGNVMSKKLYDELKKQGL 517

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  481 bits (1239), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 255/547 (46%), Positives = 345/547 (63%), Gaps = 35/547 (6%)

Query: 4   LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQ----PRPSLVSENKI 59
           LE +RSLLEDLEIIENAI+ R QRNPELYY  + +  +LFP  KQ    P  S+++ NKI
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPS-KQVEELPTHSIMTNNKI 64

Query: 60  YKLKKNKRNRKQVILQQHEIDLFLRDYKEKQR----LINEINIPQDVQEDE--------K 107
           YK KK KRNRKQ+ LQQHEI LF++D+  KQ+    L  E N      ++E        K
Sbjct: 65  YKTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFK 124

Query: 108 DLRSFXXXXXXXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLN 167
           D+ S                     +IN K  +Y++FS+S   S  + ILS RA D+D+N
Sbjct: 125 DILS-----EINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRASDLDIN 179

Query: 168 RLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKND 227
            +F+ +EQYGEY+ L  +++ WLNV+K+ D + LQF + +++F DDK+Y++ PPMDRKN+
Sbjct: 180 SIFSLEEQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNE 239

Query: 228 RYMSFLMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYK 287
            YM +L +   Y+ESFF + Y L +       +K +F+ S  +  L++E KG +C  C K
Sbjct: 240 PYMKYLQRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIKP-LENEKKGFFCKTCCK 298

Query: 288 WFKTQAVFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTA 347
           WFKT  VFE+H+ G+ H K+  KR + +Y+EYK HRY  LLK+E   T  FVERK+AFT 
Sbjct: 299 WFKTLTVFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTV 358

Query: 348 NERMVEMDSLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQE---KHLFGKSFDMPLGPDG 404
            ER+ EM  L +  +APAYD                  L+      +   S +MPLGPDG
Sbjct: 359 EERITEMKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDG 418

Query: 405 LPMPYWLYKLHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGI 464
           LPMP+WLYKL GLD  YPCEIC+N+I+ GRRTF++HF E TH+YHLRCLGIEP+  FKG+
Sbjct: 419 LPMPFWLYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGV 478

Query: 465 TKIAEAQRLWKNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDE 524
           TKI EAQRLW N ++          +  +KK  +T +P  M +E ED++GN+M++KVYDE
Sbjct: 479 TKIEEAQRLWNNMKND--------TIMGDKKFIET-IPDKMAIEVEDKEGNIMTQKVYDE 529

Query: 525 LKKQGLV 531
           LKKQGL 
Sbjct: 530 LKKQGLA 536

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  466 bits (1198), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 252/541 (46%), Positives = 335/541 (61%), Gaps = 35/541 (6%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSE---- 56
           M+ LE++RS LEDLE+IE +I  R +RNP LYY Y L+   L  DI  P  S ++     
Sbjct: 1   MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGY-LQKRALIDDI--PLSSSITNAYNA 57

Query: 57  NKIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIP---QDVQEDEKDLRSFX 113
           N+IYK K++KRNRKQ +LQQHEIDLFL++   K R +  +  P     ++++E     F 
Sbjct: 58  NRIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVNTHSLRDEEATFEIFK 117

Query: 114 XXXXXXXXXXXXXXXXXX-XDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTR 172
                               D+N +  ++A+FS+    SK   ILS  A+++ LN +F+R
Sbjct: 118 QNLEEIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSR 177

Query: 173 DEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSF 232
           +EQYGEY++L++FHS WLNVI+  +C+LLQF+  +E F+DD++Y+LAPPMDRKN RY  F
Sbjct: 178 EEQYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEF 237

Query: 233 LMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQ 292
           L+++S Y+E FF K+  L     +E  I+S+F  S     L +  KG YC  C KWFK  
Sbjct: 238 LVEISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLATP-LHTGGKGFYCIACCKWFKVP 296

Query: 293 AVFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMV 352
            VF++H+ GK+HK N +KR + + +EYKLHRYL LL +E   T+ F ERK+AFTA ERM 
Sbjct: 297 TVFDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQ 356

Query: 353 EMDSLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLY 412
           EM  L   Y AP Y                   L +    G SFD+PLG DGLP+PYWLY
Sbjct: 357 EMARLNHDYHAPDYGPD---EKEQEDPDSNKAELDKNSALGGSFDLPLGADGLPIPYWLY 413

Query: 413 KLHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQR 472
           KL GLD EY CEIC N+ Y GRR FE+HF E TH +HL+CLGIEPS  FKGIT I EAQ 
Sbjct: 414 KLQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQD 473

Query: 473 LWKNTQS--QPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGL 530
           LW+ T S  +PQ          +KK+         +LE ED++GNV+++KVY ELKKQGL
Sbjct: 474 LWRQTSSRNRPQ---------TQKKI---------DLEVEDQEGNVLTQKVYQELKKQGL 515

Query: 531 V 531
           V
Sbjct: 516 V 516

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  464 bits (1194), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 246/534 (46%), Positives = 333/534 (62%), Gaps = 31/534 (5%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60
           M  LET+R LLE LEIIE+AI++R  RNPELYY  I +   +   I+ P  + ++ N+IY
Sbjct: 1   MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGGIELPSTTAMAVNRIY 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQE---DEKDLRSFXXXXX 117
           K K+ KR+RKQ++ QQHEI+LFL    +KQ+ ++ +N   DV++   +E +   F     
Sbjct: 61  KSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDKFREAVD 120

Query: 118 XXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYG 177
                          DIN     + +FS++     ++ ILSE ARD+DLN++FTRDEQYG
Sbjct: 121 QINSKYEDQEGLAL-DINENIVNHEMFSATF---SKSTILSESARDLDLNQIFTRDEQYG 176

Query: 178 EYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLS 237
           + ++LE+FHS WLNVIKR DCS LQFFD ++ F+D  +YLL+PPMDRKN+RY  FL++L 
Sbjct: 177 DLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELF 236

Query: 238 EYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFEN 297
           +YVE FF K Y L    ++   ++SDF+  Y R  +   + G+YC  C KWFKT  VF++
Sbjct: 237 QYVEQFFAKVYVLVNSTILSQRMESDFE-EYLRMPIYKSNHGLYCVACGKWFKTPTVFQS 295

Query: 298 HIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSL 357
           H+ GK+H+ N  KR   + +EYKLHRYL++L+ +L  T+ FVERK+AFT  ERM EM  L
Sbjct: 296 HLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRL 355

Query: 358 TQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGL 417
            + YE P Y                     EK + G   ++PLG DGLP+P WLYKL GL
Sbjct: 356 ARIYEGPDYAPDEKEIEEKEDSVDTP---SEKKMNG-GIELPLGLDGLPIPLWLYKLQGL 411

Query: 418 DREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNT 477
           D  Y CEIC N+ Y GRR FERHF E THL+HL+CLGIE S  F+ IT I EAQ LW   
Sbjct: 412 DVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLW--- 468

Query: 478 QSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
                           K++S     +  ++E EDE+GNVM+++VY+ELKKQGLV
Sbjct: 469 ----------------KRISGNNTTSSRDIEVEDEEGNVMTQQVYEELKKQGLV 506

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  463 bits (1191), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 243/533 (45%), Positives = 335/533 (62%), Gaps = 18/533 (3%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLV--SENK 58
           M ++E  RSLLED+E+IE+AI++R QRNPE+YY Y  +   +    ++ +  +   S N+
Sbjct: 1   MSYIENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNR 60

Query: 59  IYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXX 118
           IYK +K+KR+RKQVILQQ+E + F++D + K   I EIN+ ++    + D R        
Sbjct: 61  IYKSRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREINVTKESNGIKLD-RYVELMGSI 119

Query: 119 XXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGE 178
                          IN    +Y++F+SS   +K  NILS++ + +++N  FTRDEQYGE
Sbjct: 120 DTKYEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYGE 179

Query: 179 YMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSE 238
           Y+ELE+F++ WLNVIK  +CS+LQ+   +E F+D  +Y+L PPMDRKN+RY+ FL  +  
Sbjct: 180 YLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIET 239

Query: 239 YVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENH 298
           Y+ SF  K+Y L + E    ++K D++    + ++K + KG +C LC KWFKT++VFENH
Sbjct: 240 YLTSFIKKTYVLIDWEEEAEVLKYDYEIECTKSLMK-QGKGNFCRLCGKWFKTESVFENH 298

Query: 299 IPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLT 358
           +PGKNH KN  K     + E+K+HR L  L  E   TK F+ERKLAFT++ER+ E+D +T
Sbjct: 299 LPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRMT 358

Query: 359 QKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLD 418
           + YE PAY                     +  +   SFDMPLGPDGLPMPYWLYKL GLD
Sbjct: 359 EVYERPAYSVGEPEEGKPNENSSKTSS-NKNDIINGSFDMPLGPDGLPMPYWLYKLQGLD 417

Query: 419 REYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQ 478
             Y CEICAN IY GRRTFE+HF+E TH YHLRCLGIEPSS FKGI  I EA  LW    
Sbjct: 418 MTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLW---- 473

Query: 479 SQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
                      +  + K S+       E+E ED++GNV+SK++Y+ELKKQGL+
Sbjct: 474 ---------GTMNVKDKSSKHAESNNYEIEVEDKEGNVLSKEIYEELKKQGLL 517

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  442 bits (1138), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 248/536 (46%), Positives = 334/536 (62%), Gaps = 35/536 (6%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFP--DIKQPRPSLVSENK 58
           M  LE KR L EDLE+IE+AI +R+QRNPELYY Y LE    F    ++ P    +  N+
Sbjct: 1   MANLEEKRDLCEDLEVIEDAIAKRLQRNPELYYNY-LEKLSSFEKHSLEVPSSIDIKNNR 59

Query: 59  IYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXX 118
           +YK KK KR++KQ++ QQHEI LF+ DY  KQ+ +N +   +D  +   D+  F      
Sbjct: 60  VYKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKRKDTTQISSDIGDFITSITE 119

Query: 119 XXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGE 178
                          +  K   Y++FS+S   + + +ILS+RA D+D+N+ FTRDEQ+GE
Sbjct: 120 NKSHVKSS-------LKDKIDYYSMFSAS---TTQKSILSKRAADLDINQTFTRDEQFGE 169

Query: 179 YMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSE 238
            M+LE+FH++WL+V+K    SLL FF  +E F+D K YL +P MDRKN RY  F+  +S 
Sbjct: 170 CMDLERFHNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISG 229

Query: 239 YVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENH 298
           YVESFF+K + L +KE V   ++ DF   Y    L +++ G +C  C K FKT++VF+NH
Sbjct: 230 YVESFFFKKFCLIDKEYVNARLQQDFI-LYLDNPLNNQN-GFFCVACNKSFKTKSVFDNH 287

Query: 299 IPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLT 358
           +PGK HK+N  KR+  + SEYKL+R+L LL+ E  +TK F ERK++FTANER  E++ L 
Sbjct: 288 LPGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLN 347

Query: 359 QKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLD 418
            +Y AP Y +                      L G  F+MPLGPDG+PMP+WLYKL GLD
Sbjct: 348 NEYNAPVYGSEEQEEGDEEHDEYASKNGNRSILDG-LFNMPLGPDGVPMPFWLYKLQGLD 406

Query: 419 REYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQ 478
             Y CEIC+NR + GRR FERHFNE+TH YHLRCLGI PS  F GIT I EAQ LW + Q
Sbjct: 407 VSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDHIQ 466

Query: 479 SQPQFVSSIAAVPAEKKLSQTKLPAG---MELEEEDEQGNVMSKKVYDELKKQGLV 531
           S             +KK    K P+G   M++E ED  GNV+++KVYD+LK+QGL+
Sbjct: 467 S------------TQKK----KAPSGKIDMDIEVEDADGNVLTRKVYDDLKRQGLL 506

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  431 bits (1109), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 232/535 (43%), Positives = 325/535 (60%), Gaps = 11/535 (2%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILE---AGKLFPDIKQPRP-SLVSE 56
           M+ LE KRS+LE LE+IENAI+ERI+RNPELYY Y  E     K    +  P P S +S 
Sbjct: 74  MEILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPASDISA 133

Query: 57  NKIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXX 116
           N+I+ +KK++R+RKQ++LQQHEID FL +Y+ +   ++ I + +D  E            
Sbjct: 134 NRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIKLDKDDSESAAPDFEQLEKA 193

Query: 117 XXXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQY 176
                            ++++   +++FSSS    K  +ILS R RD+D+NRLF RDE Y
Sbjct: 194 VKDAKSRYADESRTLAGVDVESVEHSMFSSSTSTHK--DILSTRGRDLDMNRLFARDEHY 251

Query: 177 GEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKL 236
           GE++ LE FH  WLN++K G  + LQF + VE+FV D  YL+AP ++R + +Y  F+  L
Sbjct: 252 GEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDA-YLVAPAVNRGSKKYQDFVGSL 310

Query: 237 SEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFE 296
             Y+  FF K+Y L     +   + + FD  Y R  +  E+KG++C  C +WFK + V++
Sbjct: 311 LGYMSEFFRKTYPLVNHSTLGRRLAALFDE-YLRAPVADETKGLFCIPCGRWFKLETVYK 369

Query: 297 NHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDS 356
           +H+ GK H KN AK    + +EYKLH+Y  LL   + +T++FVER  A TA+ER  E++ 
Sbjct: 370 SHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELER 429

Query: 357 LTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHG 416
           L ++YEAPAY                     E    G  F++PLGPDG P+PYWLYKL G
Sbjct: 430 LAKEYEAPAYSQHETEDAAREKQQKREPETDEG---GNPFNLPLGPDGYPIPYWLYKLQG 486

Query: 417 LDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKN 476
           LD EY CEIC+N  Y GRR FE+HF+E  H++ LRCLGIEPS+ FKGITKI EA+ LW  
Sbjct: 487 LDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEAKDLWAR 546

Query: 477 TQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
            Q+         A+ +    + T   A +E+E EDE+GNVMS+K+Y ELK+QGL+
Sbjct: 547 IQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGLL 601

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  412 bits (1060), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 238/538 (44%), Positives = 334/538 (62%), Gaps = 18/538 (3%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLF-PDIKQPRPSLVSENKI 59
           M  +E +RSLLEDLE+IE++IT+R QRNPELYY+Y     K+  PDI  P  ++ + NKI
Sbjct: 1   MSNIEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPDIDLPSKTVRNTNKI 60

Query: 60  YKLKKNKRNRKQVILQQHEIDLFLRDY--KEKQRLINEINIPQDVQEDEKDLRSFXXXXX 117
           YK +K+KR RKQ++LQQ+EI+ FL DY  KEKQ +  +++I +  ++   D   F     
Sbjct: 61  YKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQKLDISE-FRDKGADFVKFEELLE 119

Query: 118 XXXXXXXXXXXXXXXDINL--KRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQ 175
                          ++ L  K+ +YA+FSSS   +   NILS+R++ +DLN  F+++EQ
Sbjct: 120 SINNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQ 179

Query: 176 YGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMK 235
           YGE + LEQF+S WLNV+K  DCS+L++   + +F+D  +++L  PMDRKN RY+ F+  
Sbjct: 180 YGEILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIRI 239

Query: 236 LSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVF 295
           LS+Y ES+  K Y L      +  +K  F+    + I+K E KG  C  C KWFK   V+
Sbjct: 240 LSKYFESYLEKRYILNNWINFKTELKKSFEKYSIKPIVK-EKKGYLCISCGKWFKNSNVY 298

Query: 296 ENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMD 355
           + H+ GK H+K+ + RK  +Y+EYKLHR +  LK E   +K+++ERKLAFT  ER  E+ 
Sbjct: 299 DGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELK 358

Query: 356 SLTQKYEAPAY--DATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYK 413
            LT+KYE PAY  D                   ++++   KSF+MPLGPDG+P+P WLYK
Sbjct: 359 LLTKKYEEPAYNKDEPENTDKYEEDDNSMSNAAEDRN---KSFNMPLGPDGMPIPLWLYK 415

Query: 414 LHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRL 473
           L GLD +Y CEIC N+ Y GR+ +E HF+E TH  HL  LGI+ S  FKGIT IAEA+ L
Sbjct: 416 LQGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSL 475

Query: 474 WKNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           W +  +     +S +        + TKL    ++E ED +GNVMSKK+YDELKKQ LV
Sbjct: 476 WSSMHASNGSAASFS------NQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  393 bits (1010), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 310/536 (57%), Gaps = 35/536 (6%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYI-----LEAGKLFPDIKQPRPSLVS 55
           M   E  R+ LE+LE+IENA+T R++RNPE++YR I     +E    F  I     S  S
Sbjct: 1   MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPS---SQKS 57

Query: 56  ENKIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXX 115
            NK+Y +KK++R+RKQ++ Q+HEI  FL  Y +  + +  +    D+ E   D  S    
Sbjct: 58  ANKVYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEF--DMSEYRVDNGSVNKL 115

Query: 116 XXXXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQ 175
                                   +YA+FSSS   +K  NI+S +A+++D+N  FTRDEQ
Sbjct: 116 LEHIERIKEIHPKDDEFG-----DQYAMFSSSTPSNK--NIISRKAQNLDINSYFTRDEQ 168

Query: 176 YGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMK 235
           YGEY++LE FH  WL+V+K GD +LLQF   VE F D ++YLL P ++R + RY  F+  
Sbjct: 169 YGEYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTD-QRYLLQPAVNRNSSRYREFVAS 227

Query: 236 LSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVF 295
           L  Y+  +  ++Y L   +++    +  +  +  + I   ES G++C  C K FKT  V+
Sbjct: 228 LHHYLSDYAARAYPLLSWDLIHAKAQELYHTNVAKPIPSGES-GVFCIPCDKRFKTDTVY 286

Query: 296 ENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMD 355
             H+PGK H  N  K    +  E+ LH + R L  EL  T+ FVERKLAFT  ER  E++
Sbjct: 287 NAHLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELE 346

Query: 356 SLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLH 415
            LT  Y++P Y                    +E  +   S ++PLGPDG P+PYWLYKL 
Sbjct: 347 RLTDIYDSPVYGRQEQEDAQEDENKETED--KEDSVLDSSMNLPLGPDGFPIPYWLYKLQ 404

Query: 416 GLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWK 475
           GLD EYPCE+C N +YNGRR F++HF E+ H++ LR LGIEPS+ FKG+TKI +A++LW 
Sbjct: 405 GLDIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWS 464

Query: 476 NTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           + +S     +S   V +E KL         E+E EDE GNVMSKKVYDELKKQGL+
Sbjct: 465 HLRS-----TSSGRVSSEGKL---------EVEVEDEDGNVMSKKVYDELKKQGLL 506

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  378 bits (971), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/538 (39%), Positives = 304/538 (56%), Gaps = 13/538 (2%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPD--IKQPRPSL-VSEN 57
           M  LE KR++LE+LE+IE+AI++RI RNPE++Y YI E   +  D  +    P++ ++ N
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNSDEKVLSNIPNVDITAN 60

Query: 58  KIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLIN--EINIPQDVQEDEKDLRSFXXX 115
           ++Y +KK+KR+RKQ++LQQHEI  FL  Y +  + +N  + +   + ++  ++   F   
Sbjct: 61  RVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRDQ 120

Query: 116 XXXXXXXXXXXXXXXXXDINL--KRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRD 173
                            D +L  ++ +Y +FS+S    K  +ILS   + ID+N+ F+ +
Sbjct: 121 IQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKK--DILSLEGQSIDINKKFSWE 178

Query: 174 EQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFL 233
           E YGEY+ L+Q+H  +LN++K  + SLLQF   ++ F D   +L  PP+DR +  Y  FL
Sbjct: 179 EHYGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCD-HGHLKNPPVDRNSKIYHGFL 237

Query: 234 MKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQA 293
            +L +YV SFF  ++ L      +  IK+ F   Y    ++  S+G  C  C KWFK   
Sbjct: 238 ERLLKYVNSFFESAFPLINHVQFQKRIKNSFV-EYTSTPIEDSSRGCLCVACGKWFKAIT 296

Query: 294 VFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVE 353
           V+ +H+ G+ H  N   R+R +  EY L      L  EL  TKSFVERK AFT  ER+ E
Sbjct: 297 VYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQE 356

Query: 354 MDSLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYK 413
           +  L   Y A AY                              ++PLGPDG P+PYWLYK
Sbjct: 357 LAKLRDAYNANAYGDHEREDSQEDLSVSSSKETPPDD--NNPLNLPLGPDGYPIPYWLYK 414

Query: 414 LHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRL 473
           L GLD EY CEIC N +Y GRR FERHF+E+ H Y LRCLGIEP+S FKGI+KI++AQ L
Sbjct: 415 LQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQIL 474

Query: 474 WKNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           W   ++     S+ A  P             +E+E EDE GNVMS +VY++LKKQGL+
Sbjct: 475 WSRLKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL 532

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  366 bits (939), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 212/545 (38%), Positives = 303/545 (55%), Gaps = 48/545 (8%)

Query: 4   LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSE---NKIY 60
           L+T RSLLED+E+IE+AI+ R QRNPELYY Y +    +  DI  P+  L  +   NKIY
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDDI--PKLGLDDDRMVNKIY 60

Query: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQED--------------E 106
           K +K+KR  KQ   QQ+EI+ FL D  +K + I  + +   ++ D              +
Sbjct: 61  KARKHKRTLKQKRTQQYEINTFLDDIFKKNKYI--LKVRNQLKSDGLKYKDSECKFELLK 118

Query: 107 KDLRSFXXXXXXXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDL 166
           K L                       DI+    RY +   + +      ++SER   +D+
Sbjct: 119 KLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNGK------LVSERCSLLDI 172

Query: 167 NRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKN 226
           N +F +DEQ G  ++ E  +  WLN++K G  +  +F   +E F+DDKKYLL P MDRK 
Sbjct: 173 NTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKT 232

Query: 227 DRYMSFLMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCY 286
             Y  F+++  ++VE+ ++K   L  +E ++G +  DF+N   + I+ +ES   YC  C 
Sbjct: 233 KGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAII-TESGIYYCLYCD 291

Query: 287 KWFKTQAVFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFT 346
           K F +  ++++H  GK H K+ +       +E+KLH Y+  +++E  +TK +V+RK+AFT
Sbjct: 292 KMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFT 351

Query: 347 ANERMVEMDSLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLP 406
             ER+ EM+ LTQ+Y  P YD T                 + K + G   DMPLGPDGLP
Sbjct: 352 NKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGLGEDMPLGPDGLP 411

Query: 407 MPYWLYKLHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITK 466
           +PYWLYKL GLD    CEIC N++Y G + F++HF+  TH YHL+CLGIEPSS F+GITK
Sbjct: 412 IPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITK 471

Query: 467 IAEAQRLWKNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELK 526
           I EAQ LWK  Q Q      +A                   E ED++GNVMSK +Y+ELK
Sbjct: 472 IKEAQALWK--QMQRNTTQELAE------------------EVEDKEGNVMSKDIYEELK 511

Query: 527 KQGLV 531
           KQGLV
Sbjct: 512 KQGLV 516

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  364 bits (935), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/532 (40%), Positives = 305/532 (57%), Gaps = 34/532 (6%)

Query: 5   ETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLV--SENKIYKL 62
           E+ RS LE+LE+IE AI  R++RNPE++YR + E   +  D K    + +  + NKIY +
Sbjct: 29  ESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSV 88

Query: 63  KKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXX-- 120
           +K KR RKQ++ Q+HEI LFL +Y++K   +  +         E DLR +          
Sbjct: 89  RKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNV---------EFDLRRYQVTDGSVDGF 139

Query: 121 -XXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEY 179
                        DI+     Y +FS+S   + R +ILS++AR +D+N  FTR+EQYGE+
Sbjct: 140 LEHIETINSEVPDDIDDSMENYTMFSNST--AARRDILSKKARALDINAKFTREEQYGEF 197

Query: 180 MELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEY 239
           ++LE FH  WL+V+K G  SLLQF   +E F   K++LL P ++R + RY  F+  L  Y
Sbjct: 198 LDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALLCY 256

Query: 240 VESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHI 299
           ++ +  ++Y L + + +   I++ + + Y     ++   G++C  C K FK + V+  H+
Sbjct: 257 LQDYLMRAYPLQDWDKIHAEIQATYCD-YKSHPEEAGDSGLFCIPCDKTFKAETVYLAHL 315

Query: 300 PGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQ 359
            GK H  N  K+   +  EYKLH     L  EL  T+ FVERKLAFT  ER  EM+ LT 
Sbjct: 316 TGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTT 375

Query: 360 KYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDR 419
            YE+P Y                    QE      SFD+PLGPDG P+PYWLYKL GLD 
Sbjct: 376 VYESPVYGEQEQEDIAEADQKPTTN--QEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDI 433

Query: 420 EYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQS 479
           EYPCE+C N IY GRR F++HF E+ H++ L+ LG++PS  FKG+T I + ++LW + +S
Sbjct: 434 EYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRS 493

Query: 480 QPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
             +  +S AA P              E E EDE+GNVMSKKVY+ELKKQGL+
Sbjct: 494 SSK--ASNAAGPK------------FEEEIEDEEGNVMSKKVYEELKKQGLI 531

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/545 (37%), Positives = 305/545 (55%), Gaps = 37/545 (6%)

Query: 4   LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLF----PDIKQPRPSLVSENKI 59
           L+ + SL+  LEI+E+AI  R QRNP LYY  +    KL     P +  P+   V++NK+
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKVCPPQDH-VTKNKV 61

Query: 60  YKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDE---KDLRSFXXXX 116
           Y+++K+ R  KQV  QQHEI LFL+D   +  ++N+++  Q+    E   K+L  F    
Sbjct: 62  YRVEKSARKVKQVATQQHEIKLFLQD---RTDILNKLSRAQESGPGESQYKNLDEFKTAI 118

Query: 117 XXXXXXXXXXXXXXXXDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQY 176
                            +  ++ +YA+FSSS E    TNILS RA ++D+N +F R+EQY
Sbjct: 119 NGLTESNIPKRS----GLQSEKDQYAMFSSSIEKPP-TNILSARALELDINAIFNREEQY 173

Query: 177 GEYMELEQFHSLWLNVIKRGDCSLLQFFDTVE---LFVDDK-KYLLAPPMDRKNDRYMSF 232
           G Y++LE +H +WL ++K    ++LQ+ +++E   L  DDK  YL +PP+DR N +Y+ F
Sbjct: 174 GTYIQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRF 233

Query: 233 LMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQ 292
           L +L  Y++++  K + L ++ +VE  +   F N Y    + ++    +CP+C K ++  
Sbjct: 234 LERLGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGM 293

Query: 293 AVFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMV 352
            +F +H+  K H +   KR  ++ +E+++  YL  L  E   +K+F+ERKLAFT  ER  
Sbjct: 294 QLFNDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQE 353

Query: 353 EMDSLTQKYEAPAYDATX------XXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLP 406
           E+  LT +YEAP Y+                         Q   L     +MPLGPDG+P
Sbjct: 354 ELQRLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMP 413

Query: 407 MPYWLYKLHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITK 466
           +P WLYKL GLD +Y CEIC N  + GRR +++HF+E  H Y L+CLGI  S  F GI  
Sbjct: 414 IPLWLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGIAL 473

Query: 467 IAEAQRLWKNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELK 526
           I EAQ LW     +    S+ A   ++  L        +E+E EDE GNVMS+ VY +LK
Sbjct: 474 IEEAQELWAKISGK----STSARAGSDDSLK-------LEIEVEDEDGNVMSQTVYQDLK 522

Query: 527 KQGLV 531
           +QGL+
Sbjct: 523 RQGLL 527

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  347 bits (889), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/540 (38%), Positives = 299/540 (55%), Gaps = 22/540 (4%)

Query: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPD---IKQPRPSLVSEN 57
           M  LE KR++LE+LE+IE AI+ RI+RNPE+YY Y+ E   + PD   +       ++ N
Sbjct: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60

Query: 58  KIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIP--QDVQEDEKDLRSFXXX 115
           +IY  KK +R+RKQ+ILQQHEI  FL+ Y ++ + +N       + +++   +  +F   
Sbjct: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120

Query: 116 XXXXXXXXXXXXXXXXXDINLKRGR--YALFSSSAEPSKRTNILSERARDIDLNRLFTRD 173
                              +L+R R  Y++FS+S+   +   ILS   + ID+N+LF  +
Sbjct: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWE 178

Query: 174 EQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFL 233
           E YGEY+ LE+ H  WLNV+K G  +LLQF   +E F     YL APP+DR + RY  F+
Sbjct: 179 EHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVFI 237

Query: 234 MKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQA 293
            KL  Y+E  F  +Y L    ++E  I   F+ SY    ++   +G+ C  C K FK   
Sbjct: 238 QKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVGT 296

Query: 294 VFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVE 353
           VF  H+ GK H ++   +   + +E+ LH  +  L   + +T++ VERK AFT+ ER  E
Sbjct: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356

Query: 354 MDSLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYK 413
           M ++   Y+APAY +                   + +      ++PLGP G P+PYWLYK
Sbjct: 357 MATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVN----PLNLPLGPMGYPIPYWLYK 412

Query: 414 LHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRL 473
           L GLD EY CEICAN +Y GRR     F      Y LRCLGIEPS  FK I  IAEAQ+L
Sbjct: 413 LQGLDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQL 471

Query: 474 WKNTQSQ--PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
           +++ QS   P  +++  A       +  KL    E+E EDE GNVM+ +VY++LKKQGL+
Sbjct: 472 FQSLQSSTGPAGLATRRAGAISSSANTRKL----EVEVEDEDGNVMTHQVYEDLKKQGLL 527

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  290 bits (743), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 194/536 (36%), Positives = 291/536 (54%), Gaps = 22/536 (4%)

Query: 4   LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIYKLK 63
            E +R +LE+LE+IE+AI+ R++RNPE++YR+      L  +        VS N+IY+ K
Sbjct: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVSANRIYRSK 68

Query: 64  KNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFXXXXXXXXXXX 123
           K+KR+RKQ+  Q++EI LFL  Y+   RL+  +   Q  +  E+ L  F           
Sbjct: 69  KSKRSRKQIKAQEYEIALFLGRYR---RLLKSL---QKHKLSEEHLEYFRDTNASFEQFE 122

Query: 124 XXXXXXXXXDINLK-----RGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGE 178
                     +N +     +  Y +FS     SK  NI+S   + IDL+R F RDE +G 
Sbjct: 123 TVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGT 180

Query: 179 YMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSE 238
           Y++L +    WLN+IKR D ++L F   +E F +   YLL P +DR    Y   + +L +
Sbjct: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLK 239

Query: 239 YVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKS---ESKGIYCPLCYKWFKTQAVF 295
           Y ++++ K+Y L +KE++   I + FD     GI +S   ES  +Y  +  +WF +Q+ F
Sbjct: 240 YYKAYYSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEF 299

Query: 296 ENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMD 355
             H+  +      ++ ++ +  EY  H + + L   L +T SF ERKLAFT  E   E++
Sbjct: 300 NTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELE 359

Query: 356 SLTQKYEAPAYDATXXXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLH 415
            L ++YE+P Y                    +E       +++PLGPDG P+P WL K+ 
Sbjct: 360 KLQEQYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQ 419

Query: 416 GLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWK 475
           GLD +Y CEIC N+IY+GRR FE+HF  + H   L+ LGI PS  FK +T I E   LWK
Sbjct: 420 GLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWK 479

Query: 476 NTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531
             Q++    S++ +     K+S  K P  M LE ED +GNVMS +VY+ELKKQGL+
Sbjct: 480 ALQAK----STLKSGEPFSKISTVKEPE-MVLETEDNEGNVMSVQVYEELKKQGLL 530

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 137/339 (40%), Gaps = 61/339 (17%)

Query: 163 DIDLNRLFTRD--EQYGEYMELEQFHSLWLNVIKRGDCS-----LLQFFDTV------EL 209
            ID+N ++ RD  E+YG  + L++F++LW+  + +   S     L++F+  V      + 
Sbjct: 111 SIDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDR 169

Query: 210 FVDDKKYLLAPPMDRKNDRYMSFLMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYC 269
           ++D+  +   PP         S +  + EY+  F         +E V+ +   D   +  
Sbjct: 170 WIDETAF---PP---------SLIAGMLEYLTGF---------QERVDIVKPQDSSAAIT 208

Query: 270 RGILK------------------SESKGIYCPLCY-KWFKTQAVFENHIPGKNHKKNEAK 310
           R + +                       + C +C  K F T+ VF +H+    H K EA 
Sbjct: 209 RRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREAS 268

Query: 311 RKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKYEAPAYDATX 370
           R  I+     +   L+ L  EL    + VER+L  T  ER  E  +  Q+          
Sbjct: 269 RLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAE-HAAQQRIRTAVQGRGG 327

Query: 371 XXXXXXXXXXXXXXXLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDREYPCEICANRI 430
                                   + ++    DG  +P WLY+L GL   + CE+C  R 
Sbjct: 328 GDTTATPSATPSATPAATTPASASTVEV----DGRHVPRWLYRLQGLSSIFTCELCDGRE 383

Query: 431 YNGRRTFERHFNEETHLYHLRCLGI--EPSSVFKGITKI 467
           ++GR  +ERHF    H   L CLG+  E    F+G+ K+
Sbjct: 384 FHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKL 422

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T+   + H+ GK HK+   + K + Y++
Sbjct: 50  YCIHCAKYFETRIALKTHLKGKVHKRRVKELKGVPYTQ 87

>Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {ON}
           YLR074C (REAL)
          Length = 169

 Score = 33.9 bits (76), Expect = 0.55,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 14/89 (15%)

Query: 250 LFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIPGKNHKKNEA 309
           L  KE V+ L+    D +      K+     YC  C K+ +T    + H+ GK HK+   
Sbjct: 25  LATKESVQKLLNQPLDET------KAGLGQHYCIHCAKYMETAIALKTHLKGKVHKRRVK 78

Query: 310 KRKRIVYSE--------YKLHRYLRLLKD 330
           + K + Y++        Y L+++L  +KD
Sbjct: 79  ELKGVPYTQEVSDAAAGYNLNKFLDRVKD 107

>SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly
           similar to gnl|GLV|KLLA0D05621g Kluyveromyces lactis
           KLLA0D05621g and similar to YLR074C uniprot|Q08004
           Saccharomyces cerevisiae YLR074C BUD20 Protein involved
           in bud-site selection diploid mutants display a random
           budding pattern instead of the wild-type bipolar pattern
          Length = 169

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T    + H+ GK HK+   + K + Y++
Sbjct: 50  YCIHCAKYFETAMALKTHLKGKVHKRRVKELKGVPYTQ 87

>NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {ON}
           Anc_8.11 YLR074C
          Length = 169

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 14/80 (17%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE--------YKLHRYLRLLKDEL 332
           YC  C K+F+T    + H+  K HK+   + K + Y++        Y L+++L  +++  
Sbjct: 50  YCIHCAKYFETAIALKTHLKTKVHKRRVKELKGVPYTQEVADAAAGYNLNKFLNRVQE-- 107

Query: 333 FHTKSFVERKLAFTANERMV 352
            ++KS VE+    T NE ++
Sbjct: 108 INSKSGVEK----TENETLL 123

>ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR074C
           (BUD20)
          Length = 175

 Score = 33.1 bits (74), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T A  + H+ GK HK+   + + + Y++
Sbjct: 65  YCIHCAKYFETPAALKTHLKGKVHKRRVKELRGVPYTQ 102

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T    + H+ GK HK+   + K + Y++
Sbjct: 50  YCIHCAKYFETAVALKTHLKGKIHKRRVKELKGVPYTQ 87

>Suva_4.539 Chr4 (933471..934787) [1317 bp, 438 aa] {ON} YBR279W
           (REAL)
          Length = 438

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 165 DLNRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDR 224
           +++ L  +DE  G  ++L +F  L    + + D  LL  FD V+L  DD+  L  P +DR
Sbjct: 51  NISNLIQQDEDLGMPVDLMKFPGL----LNKLDSKLLYGFDNVKLDKDDRILLRDPRIDR 106

Query: 225 --KNDRYMSFLMKLSEYV 240
             K D      ++ +EYV
Sbjct: 107 LTKTDMSKVTFLRRTEYV 124

>Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {ON}
           YLR074C (REAL)
          Length = 164

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 14/84 (16%)

Query: 250 LFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIPGKNHKKNEA 309
           L  KE V+ L+    D +      K+     YC  C K+ +T    + H+ GK HK+   
Sbjct: 25  LATKESVQKLLNQPLDET------KAGLGQHYCIHCAKYMETAIALKTHLKGKVHKRRVK 78

Query: 310 KRKRIVYSE--------YKLHRYL 325
           + K + Y++        Y L+++L
Sbjct: 79  ELKGVPYTQEVSDAAAGYNLNKFL 102

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T    + H+ GK H++   + K I Y++
Sbjct: 50  YCIHCAKYFETGIALKTHLKGKIHRRRVKELKSIPYTQ 87

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 32.0 bits (71), Expect = 2.2,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE 318
           YC  C K+F+T    + H+ GK HK+   + K + Y++
Sbjct: 50  YCIHCAKYFETGVALKTHLKGKVHKRRVKELKGVPYTQ 87

>YBR279W Chr2 (761257..762594) [1338 bp, 445 aa] {ON}  PAF1Component
           of the Paf1p complex involved in transcription
           elongation; binds to and modulates the activity of RNA
           polymerases I and II; required for expression of a
           subset of genes, including cell cycle-regulated genes;
           involved in SER3 repression by helping to maintain SRG1
           transcription-dependent nucleosome occupancy; homolog of
           human PD2/hPAF1
          Length = 445

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 165 DLNRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDR 224
           ++  L  +DE  G  ++L +F  L    + + D  LL  FD V+L  DD+  L  P +DR
Sbjct: 51  NVTNLIQQDEDLGMPVDLMKFPGL----LNKLDSKLLYGFDNVKLDKDDRILLRDPRIDR 106

Query: 225 --KNDRYMSFLMKLSEYV 240
             K D      ++ +EYV
Sbjct: 107 LTKTDISKVTFLRRTEYV 124

>Smik_2.421 Chr2 (746964..748247) [1284 bp, 427 aa] {ON} YBR279W
           (REAL)
          Length = 427

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 165 DLNRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDR 224
           ++  L  +DE  G  ++L +F  L    + + D  LL  FD V+L  DD+  L  P +DR
Sbjct: 51  NVTNLIQQDEDLGMPVDLMKFPGL----LNKLDSKLLYGFDNVKLDKDDRILLRDPRIDR 106

Query: 225 --KNDRYMSFLMKLSEYVES 242
             K D      ++ +EYV +
Sbjct: 107 LTKTDVSKVTFLRRTEYVSN 126

>Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {ON}
           YLR074C (REAL)
          Length = 166

 Score = 31.6 bits (70), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 281 YCPLCYKWFKTQAVFENHIPGKNHKKNEAKRKRIVYSE--------YKLHRYLRLLKD 330
           YC  C K+ +T    + H+ GK HK+   + K + Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKSVPYTQEVSDAAAGYNLNKFLNRVQE 107

>Skud_2.410 Chr2 (730216..731526) [1311 bp, 436 aa] {ON} YBR279W
           (REAL)
          Length = 436

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 165 DLNRLFTRDEQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDR 224
           +++ L  +D+  G  ++L +F  L    + + D  LL  FD V+L  DD+  L  P +DR
Sbjct: 51  NVSNLIQQDDDLGMPVDLMKFPGL----LNKLDSKLLYGFDNVKLAKDDRILLRDPRIDR 106

Query: 225 --KNDRYMSFLMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDN 266
             + D      ++ +EYV +      + F K    GL   D D+
Sbjct: 107 LTRTDVSKVTFLRRTEYVSNTIAAHDSTFLKR-KRGLGDEDSDD 149

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227c
          Length = 623

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 282 CPLCYKWFKTQAVFENHIPGKNHKKN 307
           C +C K FK++   ENHI  K HK+N
Sbjct: 365 CFICKKSFKSEKQLENHIKTKLHKRN 390

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {ON}
           YNL227C (REAL)
          Length = 600

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 237 SEYVESFFYKSYALFEKEVVEGLIK-----SDFDNSYCRGILKSESKGIY-CPLCYKWFK 290
           +EY  SF  +S+   ++E  + L K      +F+NS  +   + +   IY C +C K FK
Sbjct: 297 NEYKTSFHLQSWQTVKEENWDELEKVYDNFGEFENS--KDDKEDDEILIYECFICNKTFK 354

Query: 291 TQAVFENHIPGKNHKKNEAKRKR 313
           ++   +NH   K HKKN A+ +R
Sbjct: 355 SEKQLKNHTNTKLHKKNMAEIRR 377

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 282 CPLCYKWFKTQAVFENHIPGKNHKKN 307
           C +C K FK+    ENH+  + HKKN
Sbjct: 355 CDICNKIFKSLKQLENHLSTRMHKKN 380

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
           JJJ1Co-chaperone that stimulates the ATPase activity of
           Ssa1p, required for a late step of ribosome biogenesis;
           associated with the cytosolic large ribosomal subunit;
           contains a J-domain; mutation causes defects in
           fluid-phase endocytosis
          Length = 590

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 282 CPLCYKWFKTQAVFENHIPGKNHKKN 307
           C +C K FK++   +NHI  K HKKN
Sbjct: 340 CFICNKTFKSEKQLKNHINTKLHKKN 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,858,268
Number of extensions: 2501895
Number of successful extensions: 9077
Number of sequences better than 10.0: 66
Number of HSP's gapped: 9308
Number of HSP's successfully gapped: 69
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)