Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1571.10ON1441447361e-101
Skud_3.81.10ON1441446591e-89
Smik_3.191.10ON1441446095e-82
YCL056C (PEX34)1.10ON1441445949e-80
KLLA0C00594g1.10ON1941341058e-06
KAFR0D001901.10ON185152943e-04
TDEL0C069301.10ON184141880.002
SAKL0C00572g1.10ON338120850.007
KAFR0C014103.97ON43961710.46
KNAG0C002701.10ON174170634.1
NDAI0I027603.504ON106940635.1
ZYRO0F18370g1.10ON220138625.2
CAGL0H02695g1.212ON54950635.7
KNAG0G011908.126ON149348636.4
Skud_15.93.5ON108343626.6
TBLA0H003302.413ON86029627.0
NOTE: 8 genes in the same pillar as Suva_3.157 were not hit in these BLAST results
LIST: Kpol_2002.13 NCAS0B09060 TBLA0A04970 KLTH0F00572g Kwal_33.13023 Ecym_1012 TPHA0E03960 NDAI0A00190

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.157
         (144 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...   288   e-101
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...   258   1e-89
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...   239   5e-82
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...   233   9e-80
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    45   8e-06
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    41   3e-04
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    39   0.002
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    37   0.007
KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.9...    32   0.46 
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    29   4.1  
NDAI0I02760 Chr9 complement(646478..649687) [3210 bp, 1069 aa] {...    29   5.1  
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    28   5.2  
CAGL0H02695g Chr8 complement(244561..246210) [1650 bp, 549 aa] {...    29   5.7  
KNAG0G01190 Chr7 (262965..267446) [4482 bp, 1493 aa] {ON} Anc_8....    29   6.4  
Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}...    28   6.6  
TBLA0H00330 Chr8 complement(61443..64025) [2583 bp, 860 aa] {ON}...    28   7.0  

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  288 bits (736), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60
           MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS
Sbjct: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60

Query: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120
           VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM
Sbjct: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNVITLCRIII 144
           VLIYPGTRLFKRLSNVITLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNVITLCRIII 144

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  258 bits (659), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%)

Query: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60
           MVPK++  EIGG+D WT +WN  SSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSW+S
Sbjct: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60

Query: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120
           VVRC+WKLIKLC+VKFKI+ERLNGQGNGLIKEKL+NF KMYNDQI+QI ANLLQDLSYLM
Sbjct: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNVITLCRIII 144
           VLIYPGTRLF+RLSN++TLCRIII
Sbjct: 121 VLIYPGTRLFRRLSNIMTLCRIII 144

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  239 bits (609), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (90%)

Query: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60
           MV ++ + E+ G++ W  VWNGVSSLLDFFAVLENLGVVDDKLY+SG+LRKVWLCYSWIS
Sbjct: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60

Query: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120
           V++CVWKLI LC+VKFKI++RLNG GNGL+KEKL+NF K Y DQI+QITA LLQDLSYLM
Sbjct: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNVITLCRIII 144
           VLIYPGTRLFKRLSN+ITLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIII 144

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score =  233 bits (594), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 130/144 (90%)

Query: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60
           MV K+N  EI  +D W  +W+GVSSLLDFFAVLENLGVV+DKLY+SG+LRKVWLCYS IS
Sbjct: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60

Query: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120
           V++CVWKLIKLC+VKFKI++RL+G+GNGL+K+KLINF K YN+ I+ ITA LLQDLSYLM
Sbjct: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNVITLCRIII 144
           VLIYPGTRLFKRLSN+ITLCRII+
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIIV 144

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 13/134 (9%)

Query: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDD------KLYLSGILRKVWL 54
           ++  E+A      D        VSS  D   +L + G++ D      KL    I  KVWL
Sbjct: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWL 81

Query: 55  CYSWISVVRCVWKLIKLCRVKFKINERLNGQGNG-------LIKEKLINFGKMYNDQIKQ 107
               +S+ R + +L  L R+K K+ +      +        L+KEK++      + +I+ 
Sbjct: 82  VSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141

Query: 108 ITANLLQDLSYLMV 121
           +  +LLQDL Y+++
Sbjct: 142 LCMDLLQDLLYMII 155

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 69/152 (45%), Gaps = 30/152 (19%)

Query: 22  GVSSLLDFFAVLENLGVVDD------KLYLSGILRKVWLCYSWISVVRCVWKLIKLCRVK 75
           G+ ++ D    L+NLGV+ +      KL    +  K+WL    +S+ RC   L  + R +
Sbjct: 29  GICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFKNLTHMYRTR 88

Query: 76  FKINERL------------NGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLI 123
            K    L            NG  NG++K+KL+   +  N  I+ +    LQ L YL+++I
Sbjct: 89  RKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEFLQVLLYLIIVI 148

Query: 124 YP------------GTRLFKRLSNVITLCRII 143
                         G R  + LSN+IT+ RII
Sbjct: 149 IEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 22/141 (15%)

Query: 23  VSSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSWISVVRCVWKLIKLCRVKF 76
           V S  D     ++LG++ +  +L       G   K+W     +SV +C+ ++ ++ R + 
Sbjct: 33  VCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNRI 92

Query: 77  KINERL-----NGQG--NGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLIYP---- 125
           ++   +     NG+G  N ++KEK++   +  N  +++   +LLQ+  YLM+++      
Sbjct: 93  RLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFKL 152

Query: 126 -----GTRLFKRLSNVITLCR 141
                  ++ + LSN +T+ R
Sbjct: 153 NIPKRARQILEPLSNFVTIMR 173

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 57/120 (47%), Gaps = 8/120 (6%)

Query: 10  IGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWISVVRCVWKLI 69
           IGG +  T V++ V  LL  F ++     V   L   G+  K+WL    +S+ + + +L 
Sbjct: 181 IGGLESLTNVFDDVY-LLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLF 239

Query: 70  KLCRVKFKINERLNGQGNG-------LIKEKLINFGKMYNDQIKQITANLLQDLSYLMVL 122
           +L R +  + +      +        +I +K        + QIK +  ++LQ+L+YL+V+
Sbjct: 240 RLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVV 299

>KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.97
           YOL097C
          Length = 439

 Score = 32.0 bits (71), Expect = 0.46,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 54  LCYSWISVVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLL 113
           + Y +++  +   + +K C  K+K  E L+G+   L  E L  F K + D+ KQ+   LL
Sbjct: 348 VAYQYLAFFKDDDEFLKECYDKYKSGELLSGEMKKLCIEVLQEFVKAFQDRRKQVDEELL 407

Query: 114 Q 114
           +
Sbjct: 408 E 408

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 28.9 bits (63), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 79/170 (46%), Gaps = 34/170 (20%)

Query: 5   ENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCYSW 58
           + A  +   D        + S+ D   +L++LG++  + +L   L       KVW     
Sbjct: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61

Query: 59  ISVVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQ---- 114
           +S+ + + +L++L + +FK    L  +   ++++K ++   + N  + +++ NL +    
Sbjct: 62  LSIRKNLKRLVRLVQTRFK----LVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFM 117

Query: 115 ------DLSYLMVLIY----------PGTRLFKR----LSNVITLCRIII 144
                 DL+ L++ ++          P  + FK+    +SNV+T+ R+++
Sbjct: 118 IIDTFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167

>NDAI0I02760 Chr9 complement(646478..649687) [3210 bp, 1069 aa] {ON}
           Anc_3.504 YGR140W
          Length = 1069

 Score = 28.9 bits (63), Expect = 5.1,   Method: Composition-based stats.
 Identities = 11/40 (27%), Positives = 24/40 (60%)

Query: 74  VKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLL 113
           +K+ INE +  + N + K ++  F + + D+I+ I  N++
Sbjct: 802 LKYLINELVTTRVNSIFKNQMNQFARKFGDKIETIVENIV 841

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 28.5 bits (62), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 20/138 (14%)

Query: 3   PKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCY 56
           P  N       D        +  L D   +L+ LG++ +   L   L       K+W   
Sbjct: 48  PDPNGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVT 107

Query: 57  SWISVVRCVWKLIKLCRVKFKINER---LNGQGN-GLIKEKLINFGKMYNDQ-------I 105
             +S  +   +L+K+ + K K+ E    L  +G+  L+K+ L N    + D        I
Sbjct: 108 LLLSARKSFSRLLKIMKAKSKLKEEMKELRTEGDEDLVKQVLRN---KFTDALKKCSIII 164

Query: 106 KQITANLLQDLSYLMVLI 123
           K +   LLQ L+YL +++
Sbjct: 165 KDVVLELLQTLAYLAIVV 182

>CAGL0H02695g Chr8 complement(244561..246210) [1650 bp, 549 aa] {ON}
           some similarities with uniprot|P47011 Saccharomyces
           cerevisiae YJL137c GLG2 self-glucosylating initiator of
           glycogen synthesis
          Length = 549

 Score = 28.9 bits (63), Expect = 5.7,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 76  FKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLIYP 125
           F++ + ++  G G +K  ++    +YND +  I+ NLL  L   +VL+ P
Sbjct: 26  FQLRKLIDAGGCGCVKTCIVVTKLLYNDILSDISKNLLNCLYDDIVLVDP 75

>KNAG0G01190 Chr7 (262965..267446) [4482 bp, 1493 aa] {ON} Anc_8.126
           YGL173C
          Length = 1493

 Score = 28.9 bits (63), Expect = 6.4,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 79  NERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLIYPG 126
           N+R +   N   KEKL  +G   +D+I  +T N ++ L +++   Y G
Sbjct: 509 NKRFDKWKNQYYKEKL-GYGSQDDDKIVDLTKNYVEGLQWVLYYYYRG 555

>Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}
           YOL145C (REAL)
          Length = 1083

 Score = 28.5 bits (62), Expect = 6.6,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 87  NGLIKEKLINFGKMYNDQIKQITANLLQDLSYLMVLIYPGTRL 129
           N L++E +I F  +Y       T   LQ+L+Y++ ++Y G  L
Sbjct: 385 NNLLEESIITFENLYK------TNESLQELNYILGMLYAGKAL 421

>TBLA0H00330 Chr8 complement(61443..64025) [2583 bp, 860 aa] {ON}
           Anc_2.413 YMR125W
          Length = 860

 Score = 28.5 bits (62), Expect = 7.0,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 17  TKVWNGVSSLLDFFAVLENLGVVDDKLYL 45
           T VWN    +L FFA+L  L +VDD + L
Sbjct: 141 TGVWNKSKLILRFFALLSPLLIVDDLINL 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.144    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,724,224
Number of extensions: 639173
Number of successful extensions: 2187
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2179
Number of HSP's successfully gapped: 30
Length of query: 144
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 45
Effective length of database: 42,129,465
Effective search space: 1895825925
Effective search space used: 1895825925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)