Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1561.9ON71271238210.0
YCL057W (PRD1)1.9ON71271234710.0
Smik_3.181.9ON71271234540.0
Skud_3.71.9ON71271234300.0
NCAS0B090701.9ON73070224130.0
Kpol_2002.121.9ON73970824080.0
TPHA0E039701.9ON74768823860.0
KNAG0C002601.9ON74467623790.0
ZYRO0F18392g1.9ON72570623690.0
SAKL0C00550g1.9ON73268923280.0
KAFR0D001801.9ON72370423220.0
TBLA0A075601.9ON74168123180.0
NDAI0A001801.9ON74068923140.0
KLLA0C00572g1.9ON71272222690.0
CAGL0B00418g1.9ON74369621900.0
Ecym_1011na 1ON71667820370.0
AGR406C1.9ON68368017580.0
AGR405Cna 1ON71767717280.0
ABR185WsingletonON4574149431e-119
NDAI0E020102.432ON7786985361e-57
KAFR0D029502.432ON7776745095e-54
SAKL0E03938g2.432ON7676805078e-54
Smik_11.1022.432ON7726364991e-52
NCAS0A042802.432ON7736814893e-51
ZYRO0G20130g2.432ON7866804859e-51
Skud_11.932.432ON7726434804e-50
Ecym_60992.432ON7735624787e-50
TBLA0I007102.432ON7736564778e-50
Kpol_297.82.432ON7876674761e-49
YKL134C (OCT1)2.432ON7726844751e-49
Suva_11.912.432ON7756434733e-49
TDEL0A020802.432ON7875544708e-49
KNAG0A062002.432ON7897144583e-47
CAGL0D02112g2.432ON7615504564e-47
KLTH0D04730g2.432ON7726814461e-45
AFR198W2.432ON7766404423e-45
Kwal_26.76162.432ON7705644415e-45
TPHA0G023902.432ON7955574328e-44
KLLA0B12397g2.432ON7796884105e-41
AFR010C8.185ON47284724.5
KLTH0B08580g5.59ON63460724.9
ZYRO0D06710g8.282ON320108715.3
CAGL0K12540g8.36ON32966698.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.156
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...  1476   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...  1341   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)  1335   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)   1325   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   934   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   932   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   923   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   920   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   917   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   901   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   899   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   897   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        895   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   878   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   848   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   789   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   681   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   670   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   367   e-119
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   211   1e-57
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   200   5e-54
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   199   8e-54
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   196   1e-52
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   192   3e-51
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   191   9e-51
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   189   4e-50
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   188   7e-50
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   188   8e-50
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   187   1e-49
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   187   1e-49
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   186   3e-49
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   185   8e-49
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   181   3e-47
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   180   4e-47
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   176   1e-45
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   174   3e-45
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   174   5e-45
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   171   8e-44
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   162   5e-41
AFR010C Chr6 complement(452964..454382) [1419 bp, 472 aa] {ON} S...    32   4.5  
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    32   4.9  
ZYRO0D06710g Chr4 complement(579323..580285) [963 bp, 320 aa] {O...    32   5.3  
CAGL0K12540g Chr11 complement(1224345..1225334) [990 bp, 329 aa]...    31   8.2  

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score = 1476 bits (3821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/712 (100%), Positives = 712/712 (100%)

Query: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60
           MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK
Sbjct: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60

Query: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120
           SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL
Sbjct: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180
           DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK
Sbjct: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180

Query: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240
           VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV
Sbjct: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300
           TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360
           NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420
           YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480
           QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600
           TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ
Sbjct: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/712 (90%), Positives = 683/712 (95%)

Query: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60
           MRLLLCKNWFASPVI+PLLYTR L SM  T SFP APQ PP+WSFTP+DISG+T EII  
Sbjct: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60

Query: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120
           SN FYDSMS+VESP+V+NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180
           DELNIDLSLRHD+FLQFARVWQD QS+ADS+ERETF+Y+EKSYKDYIHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180

Query: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240
           +KEIKKKISVNSINFSKNLGEQKE+ITFTKEQLEGVPDSIL QFETI+S KDSNETLYKV
Sbjct: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300
           TFKYPDIFPVMKLASS+QTRKQAFLADQNKV ENEAILLDTLKLRDE+ASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360
           NLYDKMA+DSTTVM+FLNDLK KLIPLG KELQ+LQDMKA+DVKK NQ  DPNYYIWDHR
Sbjct: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420
           YYDNKYLLENFNVDLEKISE+FPLE TITGML+IYETLFNLKFIETK+ Q KSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480
           Q+AVWNMDDPKSP F+GWIYFDLHPRDGKYGHAANFGLSSSFM++DTTRSYPVTALVCNF
Sbjct: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600
           TWNKNEL++LSSHYKTGEKIPE LI+SLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDLQ
Sbjct: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICDTWNQLRQDISL+SNGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLN KNGIQYRDIVLARGGL DIND+LKEFLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/712 (89%), Positives = 684/712 (96%)

Query: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60
           MRLLLCKNWF SP+I+PLLYTR L SM+   SFP APQ PP+W+FTPNDI+G+TKEII+K
Sbjct: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60

Query: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120
           SN FY+SMS VE+P VTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180
           DELNIDLSLRHD++LQFARVWQDAQS++DSIERETF+YIEKSYKDYIHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180

Query: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240
           +K+IKKKISVNSINFSKNLGEQKE+ITFTKEQLEGVPDS+LAQFETI+S KD NETLYKV
Sbjct: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300
           TFKYPDIFPVMKLASS+QTRK+AFLADQNKV ENEAILLDTL+LRD++ASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360
           NLYDKMAKDSTTVMDFLNDLK KLIPLG+KEL++LQ+MK+KDVKK NQDEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420
           YYDNKYLLENFNVDLEKISE+FPLETTITGMLQIYETLFNLKFIE K+ Q KSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480
           QLAVWNMDDPKSP+F+GWIYFDLHPRDGKYGHAANFGLSSSFM ND+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600
           TWNKNEL+ LSSHY+TGEKIPE LIDSLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDLQ
Sbjct: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC+TWNQLRQDISL+SNGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNGIQYRDIVLARGGL DI D LK+FLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1325 bits (3430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/712 (89%), Positives = 680/712 (95%)

Query: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60
           MRLLLCKNWF SPVI+PLLYTR LS+MT  ASFP APQ PP+WSFTP DI G+T EII+K
Sbjct: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60

Query: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120
           SNKFY+ MSQVESP+VTNF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASVDSSMKL
Sbjct: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180
           DELNIDLSLRHD+FLQFARVWQDAQ +ADS+++ETF+YIEKSYKD+IHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180

Query: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240
           +KEIKKKIS+NSINFSKNLGEQKE+ITFTKEQLEGVPDSILAQFET +S K   +TLYKV
Sbjct: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240

Query: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300
           TFKYPDIFPVMKLASS+QTRKQAFLADQNKV ENEAILLDTLKLRDE+ASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360
           NLYDKMAKDS TVMDFLNDLK KLIPLG+KELQ+LQDMK KDV++  +DEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420
           YYDNK+LLENFNVDLEKISE+FPLETTITGMLQIYETLFNLKFIETK PQ KSVWHEDVK
Sbjct: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480
           QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM+ND+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600
           TWNKNEL+ LSSHYKTGE+IPE LIDSLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDL+
Sbjct: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600

Query: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISLM NGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNG+QYRDIVLARGGL DIND+LKEFLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/702 (63%), Positives = 557/702 (79%), Gaps = 6/702 (0%)

Query: 16  TPLLYTR--FLSSMTTTASFPTAPQ-TPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVE 72
           T  + TR  F  ++ T      AP  T P+W ++P  I  +TKE+I+ +   YDS++ +E
Sbjct: 30  TAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIE 89

Query: 73  SPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132
            P+V + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV+++  L + +I+ S+R D
Sbjct: 90  EPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLD 149

Query: 133 VFLQFARVWQDAQSQADSIER--ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISV 190
           +F QF ++W   +   D   +  ET+++IEK +KDY+ +GL L E  R +VK+IKKKI+ 
Sbjct: 150 LFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIAS 209

Query: 191 NSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPV 250
           NS+N+SKNLGEQKE+++FTKEQL+GV +S++ QFE     K +NE  YKVTFKYPDIFPV
Sbjct: 210 NSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPK-TNEEKYKVTFKYPDIFPV 268

Query: 251 MKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDS 310
           +K A   +TRK A+++DQNKV +NEA+ ++TLKLR+++A LLGY TYANYNL  KMAK+ 
Sbjct: 269 LKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQ 328

Query: 311 TTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLEN 370
            TV DF+N+LK KL PLG+KE++ L+ +K KD ++     D +YYIWDHRYYDNK+L +N
Sbjct: 329 ETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDN 388

Query: 371 FNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDP 430
           +NVDLE+ISE++PLE+TI GML IYETL  LKF++  NP+ K VWHEDVKQLAVW MDD 
Sbjct: 389 YNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDE 448

Query: 431 KSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSL 490
           K+P FIGWIYFDLHPRDGKY HAANFG+SSS++  D  RS+PVTALVCNFSKST  KPSL
Sbjct: 449 KNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSL 508

Query: 491 LKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHL 550
           LKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+ L
Sbjct: 509 LKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSL 568

Query: 551 SSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQ 610
           S HY+TGEKI E L+DSLI TKHVNGALF LRQLHFGLFDM VH+ K++++L++   WN+
Sbjct: 569 SGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNE 628

Query: 611 LRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKN 670
           LR+ I L+ NG  L+KGY SFGHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN++ 
Sbjct: 629 LREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQA 688

Query: 671 GIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712
           G+QYRDIVLA GGL +I D LKEFLGREP+ DAFLKELGL N
Sbjct: 689 GVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/708 (61%), Positives = 560/708 (79%), Gaps = 10/708 (1%)

Query: 9   WFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM 68
           +FA P I    +T    S  T +S   APQ  P+W++TP  I    + +I+ SN+ +D++
Sbjct: 35  FFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNL 91

Query: 69  SQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128
           + + SP V NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ S
Sbjct: 92  AAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEAS 151

Query: 129 LRHDVFLQFARVWQDAQ------SQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVK 182
           LR D+F+QF ++W D +       ++DS   E++R+IEK +KD+I SGL L +  R  VK
Sbjct: 152 LRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK 211

Query: 183 EIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTF 242
           +I+KKI+ NS+NFSKNLGEQKEFI FTKE+L+GV D+++ QFE  +  K + E  +KVTF
Sbjct: 212 DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEK-TGEEKFKVTF 270

Query: 243 KYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNL 302
           KYPDI PV+K A +  TRK AF ADQNKV ENEA+ +DTLKLR++++++L Y  YANYNL
Sbjct: 271 KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL 330

Query: 303 YDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYY 362
             KMAK+  TV +FL+DLK KL PLG KE++IL+ +K KD+K+ N   D +YYIWDHRYY
Sbjct: 331 EMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYY 390

Query: 363 DNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQL 422
           DNKYL +NFNVDLEKISE++P+E++I GML+IYET+  LKF+E  +P +++VWHEDVKQL
Sbjct: 391 DNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQL 450

Query: 423 AVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSK 482
           +VW MD+P +P FIGWIYFDLHPRDGKYGHAANFG+SSS++  +  RSYPVTALVCNFSK
Sbjct: 451 SVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSK 510

Query: 483 STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTW 542
            T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWTW
Sbjct: 511 PTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTW 570

Query: 543 NKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNL 602
           NKNEL+ LS HYKTGEKIPE LI+SL+ TKHVNGALF LRQLHF  FDM+VH+ +D+  L
Sbjct: 571 NKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKL 630

Query: 603 SICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662
           ++ + WN LR+ I L+ NG  +SKGY SFGHIMS +YSAGYYGY+WAEVFATDMY+TKFA
Sbjct: 631 NLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFA 690

Query: 663 KDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710
            DPLN+K+G++YRDI+L+RGG+ ++ND+L+EFLGREP+  AFLKE+GL
Sbjct: 691 ADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/688 (63%), Positives = 542/688 (78%), Gaps = 13/688 (1%)

Query: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95
           APQ  P W F+P  I    K+II+ SN FY++M  +E+P++ NFV P + FENE    IN
Sbjct: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120

Query: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQ-------- 147
           QLTFLQHVS DK IRDAS++++  +   +I++SLR+D+F QF +++ D +          
Sbjct: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKT 180

Query: 148 ADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFIT 207
           A   + E F+Y+EK +KDY+ SGL L E  R ++KEIKK+I++NS+ FSKNLGEQ EF+ 
Sbjct: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVA 240

Query: 208 FTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLAD 267
           FTKE+LEGV D ++ QFET  + + + E  +KVTFKYPDIFPV+K A +  TRK AF AD
Sbjct: 241 FTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNAD 299

Query: 268 QNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPL 327
           QNKV ENE + +DTLKLR ++  +LGYDTYANYNL  KMAK+  TVM+FL DLK KL PL
Sbjct: 300 QNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPL 359

Query: 328 GEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETT 387
            EKE+++L+ +K  + ++ N   D +YYIWDHRYYDNKYL + FNVDLEKISE++P+E+T
Sbjct: 360 AEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVEST 419

Query: 388 ITGMLQIYETLFNLKFIETKNPQEKSVWH-EDVKQLAVWNMDDPKSPRFIGWIYFDLHPR 446
           I GML+IYET+ NLKFIE  +   KS W  +DVKQLAVW MDDP  P F+GWIYFDLHPR
Sbjct: 420 IQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPR 479

Query: 447 DGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHG 506
           +GKYGHAANFG++ S++  D+ R YPVTALVCNFS +T DKP+LLKHNEI TFFHELGHG
Sbjct: 480 EGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHG 539

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLID 566
           IHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIPE L++
Sbjct: 540 IHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLE 599

Query: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVHSCKD---LQNLSICDTWNQLRQDISLMSNGGT 623
           SLI TKHVNGALF LRQLHFGLFDMKVH+  D   + N+ +   WN LR++ISL+ NG  
Sbjct: 600 SLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDE 659

Query: 624 LSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGG 683
           ++KGY SFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPLNTK+GI+YRDI+LARGG
Sbjct: 660 MNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGG 719

Query: 684 LRDINDSLKEFLGREPSKDAFLKELGLQ 711
           +R+ ND+LKEFLGREPSK+AFLKELGLQ
Sbjct: 720 IRETNDNLKEFLGREPSKEAFLKELGLQ 747

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/676 (63%), Positives = 540/676 (79%), Gaps = 6/676 (0%)

Query: 41  PSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFL 100
           P W F    I      IIE +NKFYD + ++ +P++ N V+P+M  EN +G ++NQL FL
Sbjct: 69  PRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLCFL 128

Query: 101 QHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQA-----DSIERET 155
           QHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++ + +      D  + E 
Sbjct: 129 QHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQFEI 188

Query: 156 FRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEG 215
           ++++EK +KD++ +GL L E DR KVK+IK KI+ NS+ FSKNLGEQKEF+ F+KEQL+G
Sbjct: 189 YKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDG 248

Query: 216 VPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENE 275
           V D+++ QFE ++  + +NET YKVTFKYPDIFPV+K+A +++TRK AF  DQNKV +NE
Sbjct: 249 VSDTVMEQFEQVKD-ETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNE 307

Query: 276 AILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQIL 335
            + + TLKLRDE+A+LLGYDTYANYNL  KMAK  +TV  FLNDLK KL PLGEKE+ IL
Sbjct: 308 ELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGIL 367

Query: 336 QDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQIY 395
           + +K  + K+     D  YYIWDHRYYD KYL +NFNVD E I+E++P+++TI GML+IY
Sbjct: 368 KSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIY 427

Query: 396 ETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAAN 455
           ET+F LKF+E K+  +K+VW+EDVKQ+AVW MD+ K+P F+GWIYFDLHPRDGKYGHAAN
Sbjct: 428 ETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAAN 487

Query: 456 FGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNK 515
           FG++SS++  D +RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+N+
Sbjct: 488 FGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNR 547

Query: 516 ESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVN 575
            +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L  LS HYKTGE+IPE L+DSLI TKHVN
Sbjct: 548 AARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVN 607

Query: 576 GALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIM 635
           GALF LRQLHFGLFDM VH+ KD+ +L +   W  LRQ+ISL+ NGG  +KGY SFGHIM
Sbjct: 608 GALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIM 667

Query: 636 SDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFL 695
           SDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGL +I+D+LKEFL
Sbjct: 668 SDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFL 727

Query: 696 GREPSKDAFLKELGLQ 711
           GREPSKDAFLKELGLQ
Sbjct: 728 GREPSKDAFLKELGLQ 743

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/706 (61%), Positives = 550/706 (77%), Gaps = 9/706 (1%)

Query: 11  ASPVITPLLY--TRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM 68
           A P +   +Y  ++F  S  ++ +   APQ+ PSW+FTP  +   T  +IE S +FYDS+
Sbjct: 22  AVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL 81

Query: 69  SQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128
           +Q+ +P V N V+P+M  EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ S
Sbjct: 82  AQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQS 141

Query: 129 LRHDVFLQFARVW---QDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIK 185
           LRHD+FLQF ++W   +D   +  S E E ++Y+EK ++DY   GL+L E  R KVK++K
Sbjct: 142 LRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLK 201

Query: 186 KKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETL-YKVTFKY 244
            KI+ NS+ FSKNLGEQKEF+ FTKE+L+GV +S++ QFE     KD N T  YKVTFKY
Sbjct: 202 IKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQF---KDENGTTKYKVTFKY 258

Query: 245 PDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYD 304
           PDIFPV+K A + +TRK AF  DQ+KV +NE + ++TL+LR+E+A +LGY TYANYNL  
Sbjct: 259 PDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLEL 318

Query: 305 KMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDN 364
           KMAK+   V  FLN+LK KL PLG KE + L+ +K K+ +      D +YY+WDHRYYDN
Sbjct: 319 KMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRYYDN 378

Query: 365 KYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAV 424
           KYL +N+NVDLEKISE++P+E+TI+GML IYETL  LKF+E  +P+++SVWHEDVKQLAV
Sbjct: 379 KYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAV 438

Query: 425 WNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKST 484
           W MD+P  P F+GWIYFDLHPRDGKYGHAANFG+S+S++  D TRSYPVTALVCNFSK +
Sbjct: 439 WKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFSKPS 498

Query: 485 KDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNK 544
             KPSLLKHNEI TFFHELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+
Sbjct: 499 AKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNE 558

Query: 545 NELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSI 604
            EL  LSSHY++GEKIP+ L+ SLI TKHV+GALF LRQLHFGLFDM VH+ K++  L +
Sbjct: 559 RELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDL 618

Query: 605 CDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKD 664
              WN+LR+++SL+ NG T +KGY SFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA D
Sbjct: 619 LKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAAD 678

Query: 665 PLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710
           PL++K G+QYRDIVL RGGL + ND+L+EFLGREPS++AFLKELGL
Sbjct: 679 PLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGL 724

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/689 (62%), Positives = 535/689 (77%), Gaps = 6/689 (0%)

Query: 25  SSMTTTASFP-TAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPF 83
           S+M+ T S     PQ  PSW ++P DI   T E I  ++  +D+++ VE+P V + V+PF
Sbjct: 46  STMSATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPF 105

Query: 84  MKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQD 143
           ++ EN   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ 
Sbjct: 106 LEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQA 165

Query: 144 AQSQADSIER--ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGE 201
            +  A   +   E ++++EK +KDY+ +GL L E  R +VKE++KKIS NS+ FSKNLGE
Sbjct: 166 CKDDAKFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGE 225

Query: 202 QKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRK 261
           QKEF+ FT E+L+GV  S++ QFE   +  D  E  +KV+FKYPDI PV+K A + +TRK
Sbjct: 226 QKEFVAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAKNPETRK 283

Query: 262 QAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321
           +AF  DQNKV +NE + L+TL+LRDE+A LLGY TYANYNL  KMAK   TV+ FL DLK
Sbjct: 284 RAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLK 343

Query: 322 KKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEF 381
            KL PLG KE++ L+ +K KD K+     D +YYIWD+RYYDNKYL EN+NVD EKISE+
Sbjct: 344 NKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEY 403

Query: 382 FPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441
           FPLE TI GML+IYET+  LKF+E  + ++K VWHEDVKQLAVW +D  +SP F+GWIYF
Sbjct: 404 FPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYF 463

Query: 442 DLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501
           DLHPRDGKYGHAANFG++SS+ V D  RS+PVTALVCNFSK +  KP+LLKH+EI TFFH
Sbjct: 464 DLHPRDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFH 522

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIP 561
           ELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HY+TGEKIP
Sbjct: 523 ELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIP 582

Query: 562 EPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNG 621
           E L+DSLI TKHVNGALF LRQL FGLFDM VH+CKDL++L +   WN LRQ++SL+ NG
Sbjct: 583 EQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENG 642

Query: 622 GTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLAR 681
             ++KG+ SFGHIMS +YSAGYYGY+WAEVFA DMYHTKFA DPLN   G++YRDIVL+R
Sbjct: 643 DQVTKGFNSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSR 702

Query: 682 GGLRDINDSLKEFLGREPSKDAFLKELGL 710
           GGL +I+D+L+EFLGREP+ +AFLKELGL
Sbjct: 703 GGLYEIDDNLREFLGREPNNEAFLKELGL 731

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/704 (62%), Positives = 553/704 (78%), Gaps = 12/704 (1%)

Query: 13  PVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVE 72
           P  + L+Y R  S+MT +A    APQ  PSW++ P+ +    + +I+ SN+ YD +S ++
Sbjct: 23  PATSYLVYNRLYSNMTISAFI--APQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80

Query: 73  SPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132
            P V N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140

Query: 133 VFLQFARVWQDAQSQADSIERE----TFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKI 188
           +FLQF ++WQ+   + D   +E    T+++IEK +KDY+ SGL L E  R K+KEIK KI
Sbjct: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKI 200

Query: 189 SVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIF 248
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE     +++ E  +KVTFKYPDIF
Sbjct: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259

Query: 249 PVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAK 308
           PV+K A + +TR++AFLADQNKV +NE + ++TLKLR+E+A+ L Y TYANYNL +KMAK
Sbjct: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319

Query: 309 DSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLL 368
              TV+DFLNDLK +L PL  KE+ IL+D+K K+ K+ N++ D +YYI+DHRYYDNKYL 
Sbjct: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379

Query: 369 ENFNVDLEKISEFFPLETTITGMLQIYETLFNLKF-IETKNPQEKSVWHEDVKQLAVWNM 427
           +NFNVDLE ISE++PLE TI GML+IYE LF LKF  ETKN   KSVWHEDVKQLAVW M
Sbjct: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEETKN---KSVWHEDVKQLAVWKM 436

Query: 428 DDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM-VNDTTRSYPVTALVCNFSKSTKD 486
           D+P+ P F+GWIYFDLHPRDGKYGHAANFG+SSS++ +    RSYPVTALVCNFSKST  
Sbjct: 437 DNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTAT 496

Query: 487 KPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNE 546
           +PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NE
Sbjct: 497 RPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANE 556

Query: 547 LMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICD 606
           L  LS HY++ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VH+  ++++L++  
Sbjct: 557 LKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLK 616

Query: 607 TWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            WN+LR++I L+  G  LSKGY SFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL
Sbjct: 617 LWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPL 676

Query: 667 NTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710
           +++ G+QYRDIVLA GGL +I D+L++FLGREPSK+AFLKELGL
Sbjct: 677 DSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/681 (62%), Positives = 541/681 (79%), Gaps = 7/681 (1%)

Query: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95
           APQ  P+W++TP+ +    +++I++SN FYD+++ ++SP   NF+ P+M +EN++G +IN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIER-- 153
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W   +   D  E+  
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 154 ---ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTK 210
              E + ++ K ++D++ +GL LDE  R K+KEIKK I+ NS+ F+ NLGEQ EF+ FTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 211 EQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNK 270
           E+L+GV DS++ QFE     K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299

Query: 271 VSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEK 330
           VSEN  +  +TLKLR+++A +LGY TYANYNL  KMAK   +V  FL DL  +L PLG K
Sbjct: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSK 359

Query: 331 ELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITG 390
           E++IL+ +K K+ K+ N   D +YY+WDHRYYDNKYL +N+NVDLEKISE++PL++TI G
Sbjct: 360 EIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEG 419

Query: 391 MLQIYETLFNLKFIETKN-PQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449
           ML IYETL NLKFIE K+  + K+VWH++VKQLAVW MD+P++P F+GWIYFDLHPRDGK
Sbjct: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479

Query: 450 YGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           YGHAANFG+SSS++  +  RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLI 569
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIP  L++SL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYA 629
            TKHVNGALF LRQLHFGLFDMKVH+ KDL+NL     WN+LR+++SL+ NG   +KGY 
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDIND 689
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK G++YRD VLARGGL +I D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 690 SLKEFLGREPSKDAFLKELGL 710
           +L +FLGR+PS +AFLKELGL
Sbjct: 720 NLIQFLGRKPSNEAFLKELGL 740

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/689 (62%), Positives = 550/689 (79%), Gaps = 6/689 (0%)

Query: 25  SSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFM 84
           +++     F     T P W++TP  I   TK  IEK+NK+Y+S+S++ESP++ N + P+M
Sbjct: 55  NTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYM 114

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDA 144
            +EN++G +INQLTFLQHVS+DK+IRDAS++++  L++ +I  SLR +++ QF +VW+  
Sbjct: 115 NYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETV 174

Query: 145 QSQADSIER---ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGE 201
           Q+  D ++    ET+++IEK +KD + +GL+ +   +LK   IK KIS +++ FS NLGE
Sbjct: 175 QNDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKY--IKGKISADALTFSSNLGE 232

Query: 202 QKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRK 261
           Q E+++FTKE+L+GV ++++ QFE     K +NE  YKVTFKYPDIFPV+K A + +TRK
Sbjct: 233 QNEYVSFTKEELDGVSETVMDQFEKFIDPK-TNEKKYKVTFKYPDIFPVLKTAKNPKTRK 291

Query: 262 QAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321
            AFL DQNKV ENE +L + LKLR E+A+ LGY TYANYNL  KMAK+  TV+ FLNDLK
Sbjct: 292 IAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLK 351

Query: 322 KKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEF 381
           +KL PL EKE++IL+D+K K+ ++     D +YYIWDHRYYDNKYL +NFNVD+EKISE+
Sbjct: 352 EKLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEY 411

Query: 382 FPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441
           +PLE+TI GML+IYET+ NLKFIE  +P  K+VWH DVKQL+VWNMDD  +P F+GWIYF
Sbjct: 412 YPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYF 471

Query: 442 DLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501
           DL+PRDGKYGHAANFG++SS++  +  RSYPVTALVCNFSK TK+KP+LLKH+EI TFFH
Sbjct: 472 DLYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFH 531

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIP 561
           ELGHGIHDLVGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIP
Sbjct: 532 ELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP 591

Query: 562 EPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNG 621
           E L+DSLI TKHVNGALF LRQLHFGLFDM VH+ KD++NL +   WN+ R++I L+ NG
Sbjct: 592 EDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENG 651

Query: 622 GTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLAR 681
              +KGY SFGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+
Sbjct: 652 ENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAK 711

Query: 682 GGLRDINDSLKEFLGREPSKDAFLKELGL 710
           GGL +IND+L EFLGREPS   FLKELGL
Sbjct: 712 GGLYEINDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/722 (59%), Positives = 543/722 (75%), Gaps = 22/722 (3%)

Query: 1   MRLLLCKNWFASP----VITPLLYTRF----LSSMTTTASFPTAPQTPPSWSFTPNDISG 52
           MR +L    F S     VI  L +  F    + S+ T   F   PQ  PSW++T  ++  
Sbjct: 1   MRNVLANLRFKSATSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLK 59

Query: 53  RTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDA 112
           +T E I+ SN+  DS+  + +P+V NFV P++  EN + P+ NQLTFLQHVSSDKE+RD 
Sbjct: 60  QTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDT 119

Query: 113 SVDSSMKLDELNIDLSLRHDVFLQFARVWQ----DAQSQADSIERETFRYIEKSYKDYIH 168
           S   +  ++   I+ SLR  +F QF  VW     DAQ + D  E   ++++EK +KD++ 
Sbjct: 120 STKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLR 177

Query: 169 SGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIE 228
           SGL L E  R KVKEIKKKIS NS+ FSKNLGEQ EFITFTKE+L GV ++++ QFET++
Sbjct: 178 SGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD 237

Query: 229 SGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEV 288
              +   T YKVTFKYPDIFPV+K A +++TRK+AF+ DQNKV +NEA+ L+TL+LR+++
Sbjct: 238 ---EDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDL 294

Query: 289 ASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQ 348
           A LL YD+YA+YNL  KMAK    V+ FLNDLK KL PLGEKEL  L+++K ++ K+ N 
Sbjct: 295 AELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNT 354

Query: 349 DEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKN 408
             D  YYIWD+RYYDN+YL +NF +D EKI+E+FPLE+TI GMLQIYET+  LKFIE  N
Sbjct: 355 PYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDN 414

Query: 409 PQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTT 468
                 WH DVK+L+VW MDD   P F+GWIYFDLHPR+GKYGHAANFG+SSSF+ +D +
Sbjct: 415 ---GDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGS 470

Query: 469 RSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528
           RSYPVTALVCNFSK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWD
Sbjct: 471 RSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWD 530

Query: 529 FVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGL 588
           FVEAPSQMLEFWTWNK EL  LS HY+T EKIP+ L+DSL++TKH+NGALF LRQLHFGL
Sbjct: 531 FVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGL 590

Query: 589 FDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLW 648
           FDMKVH+ KD+  L++ + WN LR++I L+ NG   +KG+ SFGHIMSDSYSAGYYGY+W
Sbjct: 591 FDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMW 650

Query: 649 AEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKEL 708
           A+VFA+DMY+TKF +DPLN+  G+QYRDI+LARGGL +I D+L EFLGR+P+  AFLKEL
Sbjct: 651 ADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKEL 710

Query: 709 GL 710
           GL
Sbjct: 711 GL 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/696 (60%), Positives = 528/696 (75%), Gaps = 8/696 (1%)

Query: 20  YTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNF 79
           Y++  ++  T     T PQ PPSW F P DI  +TKE I  +  FYD +  +++P + N 
Sbjct: 52  YSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENL 111

Query: 80  VEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFAR 139
           + P++  ENE   +INQLTFLQHVS DK IRDAS++++M L +  I+   R D+F QF  
Sbjct: 112 IVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDL 171

Query: 140 VWQDAQSQADSIER-ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKN 198
           +W   + + D  E  E +R++EK +KDY+ +GL L      KVKEIKKKI+ N + FSKN
Sbjct: 172 IWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKN 231

Query: 199 LGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQ 258
           LGEQKE+I FT E+L+GVP+S++ QFE +    +      KVT+KYPDIFPV+K A + +
Sbjct: 232 LGEQKEYILFTAEELKGVPESVIEQFEKVND--EFGIQKLKVTYKYPDIFPVLKNAQNPE 289

Query: 259 TRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLN 318
           TR +AF+ DQNKV ENE +  DTLKLR+E+A +LGYDTYANYNL  KMAK++ TV+ F+N
Sbjct: 290 TRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVN 349

Query: 319 DLKKKLIPLGEKELQILQDMKAKDVKKR-NQDEDPNYYIWDHRYYDNKYLLENFNVDLEK 377
           DL  KL    +KEL IL+++K ++ +   N   D +YYIWDHRYYDNKYL ENFNVD EK
Sbjct: 350 DLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEK 409

Query: 378 ISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIG 437
           I+E++PLE+TI GML+IYETL  LKF+E K  + K  WH+DVKQLAVW +D P++P F+G
Sbjct: 410 IAEYYPLESTIDGMLKIYETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVG 467

Query: 438 WIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIV 497
           WI+FDLHPRDGKYGHAANFGLSSS++  + TRSYP+TALVCNFSKSTKDKPSLLKH+EI 
Sbjct: 468 WIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEIT 527

Query: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTG 557
           TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL+ LS +YK  
Sbjct: 528 TFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDN 587

Query: 558 EKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--SCKDLQNLSICDTWNQLRQDI 615
            KI   L++SLIKTKHVNGALF LRQLHFGLFDMKVH  S ++L  L I   WN LR+ I
Sbjct: 588 AKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKI 647

Query: 616 SLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675
            L+SNG   + GY SFGHIMS SYSAGYYGY+WAEVFATDMY+TKF  DPLN + G++YR
Sbjct: 648 CLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYR 707

Query: 676 DIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQ 711
           DIVLARGGL +I+D+L+EFLGR+P+KDAFL+ELGL 
Sbjct: 708 DIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/678 (55%), Positives = 508/678 (74%), Gaps = 9/678 (1%)

Query: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95
           +P+  PSW F  ++I    ++ I++  KFYDS++ +E+P + NFV   +  E+E    ++
Sbjct: 45  SPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMS 104

Query: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQAD--SIER 153
           QLTFLQHVS+DKE+RDAS++++  + E  I+ S R+D++ QF++VW+  +   +    + 
Sbjct: 105 QLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDP 164

Query: 154 ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQL 213
           E + Y+E   KDYIH+G+ L E  R K+KEIKKK++ NS+ FS NLGEQ ++I FTK++L
Sbjct: 165 ELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDEL 224

Query: 214 EGVPDSILAQFE-TIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVS 272
            GV ++ L QFE  IE G +     YK+TFKYPDI PV+  A + +TRK+A++ DQNKV 
Sbjct: 225 VGVSETTLGQFEKVIEDGVEK----YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVP 280

Query: 273 ENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKEL 332
           +NE IL++TLKLR+E+A + G+ TYA+Y L  KMAK   TV +FL DLK KL+P G+K+L
Sbjct: 281 QNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDL 340

Query: 333 QILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGML 392
           + L+ +K ++ K+     + ++  WD+RYYD+KYL ENF+VD E+++++FPL+ TI GML
Sbjct: 341 ENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGML 400

Query: 393 QIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGH 452
            IY+ LFNLKF+E      K+VWHEDVKQ AVW++D   +P F+GWIYFDLHPR+GKYGH
Sbjct: 401 NIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKYGH 459

Query: 453 AANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVG 512
           AANFGL S ++  + TR YPVT LVCNFSK +  +P+LLKH E+VTFFHELGHGIH LVG
Sbjct: 460 AANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVG 519

Query: 513 QNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTK 572
           +++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+IP+ L+DSLIKTK
Sbjct: 520 KSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTK 579

Query: 573 HVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFG 632
           HVN  L  LRQLHF LFDM VH+ K+L  L I   WN LR++++L+SNG  L+KGY SF 
Sbjct: 580 HVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFS 639

Query: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLK 692
           HIMS  YSAGYYGY+W+EVFA DMYHT FA +PL+T  G +YRDI+LA+GGLRDI DSL+
Sbjct: 640 HIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLE 698

Query: 693 EFLGREPSKDAFLKELGL 710
           EFLGREP+  AFLKELGL
Sbjct: 699 EFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/680 (50%), Positives = 472/680 (69%), Gaps = 13/680 (1%)

Query: 37  PQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQ 96
           PQ  PSW+F+  D+   + ++I ++   Y ++ Q + P + N++ P +  E E   + NQ
Sbjct: 10  PQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLWNQ 69

Query: 97  LTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIER--- 153
           L FL++VS D EIR+AS +++  LD+  I L+ ++D++  F  VW  AQ + D   +   
Sbjct: 70  LVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVW--AQYKDDEKFKKEN 127

Query: 154 -ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQ 212
            E +RY+EK    Y  SG+++   +R ++ E+K KI+   + FS NLGE+ E+I FTKE+
Sbjct: 128 FELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEE 187

Query: 213 LEGVPDSILAQFE-TIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKV 271
           LEGVPD++L QFE  IE G +     +KVTFKYPDI PV++LAS+ +TR++A +AD+N+V
Sbjct: 188 LEGVPDTVLNQFEKIIEGGVEK----FKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243

Query: 272 SENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKE 331
           + NE +L +TL+LR E+A LLG+  +A YNL DKMAK+  TV+ FLNDL +KL+P+G+ +
Sbjct: 244 AANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303

Query: 332 LQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGM 391
           L+IL+  KA+D K +N   D  +Y WD  YY NK L E +NV+ + ++++FP+E+ I GM
Sbjct: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363

Query: 392 LQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYG 451
           L IY TLF LKF+E  +  EKSVWHEDVKQ AVWN+DD  +P+F GW+YFDLHPRDGKYG
Sbjct: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423

Query: 452 HAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLV 511
           HAANFG+ S++   D ++SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDLV
Sbjct: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483

Query: 512 GQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKT 571
           G N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP+ L+D+    
Sbjct: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543

Query: 572 KHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASF 631
             +N  L  L QL  GLFDM VH+ +D +   +   WN L ++I LM+     S GY SF
Sbjct: 544 GGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSF 602

Query: 632 GHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSL 691
           GHIM+   +  YYGYLW++VFA DMY TKF  +P N   G++YRD +LA GGL D+ D+L
Sbjct: 603 GHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNL 661

Query: 692 KEFLGREPSKDAFLKELGLQ 711
           ++FLGR+P+  AFL+ LGL+
Sbjct: 662 RKFLGRDPNNKAFLRGLGLK 681

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/677 (47%), Positives = 460/677 (67%), Gaps = 7/677 (1%)

Query: 37  PQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM-SQVESPAVTNFVEPFMKFENELGPIIN 95
           PQ PP W++T  ++      + +KS+  Y+S+ SQ +   + N++ P +  + E   + N
Sbjct: 15  PQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLLWN 74

Query: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQAD--SIER 153
           QL FL++VS D ++R+AS+ +   LD+   ++S ++D++  F  +W   +   +      
Sbjct: 75  QLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNY 134

Query: 154 ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQL 213
           E ++Y+EK    Y  +   L   + +++ ++ +KISV+++ FS NLGE+ E+ITFT+E+L
Sbjct: 135 ELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFTEEEL 194

Query: 214 EGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSE 273
           EGV   +L QFE I  G        KVTFKYPDI PV++ A++ +TR++A++ADQN+V+ 
Sbjct: 195 EGVSPLVLDQFERIIEGGVKK---LKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAA 251

Query: 274 NEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQ 333
           NE +L +TL LR  +A L GY  YA YNL DKMAK+  TV+ FL DL ++L+P+GEK+ +
Sbjct: 252 NEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDRE 311

Query: 334 ILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQ 393
           IL+  KA+D K +N   D   Y WD+ YY+NK L E + +D E ++++FP+E+ I GML 
Sbjct: 312 ILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLD 371

Query: 394 IYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453
            Y+TLF LKF+E  +P +K+VWHEDVKQ AVWN+DD   P F GWIYFDL+PRDGKY HA
Sbjct: 372 TYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHA 431

Query: 454 ANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513
           ANFG++S+F   D ++SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH LV  
Sbjct: 432 ANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVAN 491

Query: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKH 573
           NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP  L+D+   +  
Sbjct: 492 NKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNSSG 551

Query: 574 VNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGH 633
           +   L+ L QL  GLFDM VH+ ++   L +   WN +R++ISL+++    S GY +FGH
Sbjct: 552 LGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610

Query: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKE 693
           IM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGL D+ND+L++
Sbjct: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670

Query: 694 FLGREPSKDAFLKELGL 710
           FLGREP+  AFL+ LG 
Sbjct: 671 FLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  367 bits (943), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 191/414 (46%), Positives = 262/414 (63%), Gaps = 7/414 (1%)

Query: 298 ANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIW 357
           A Y L  K AK+   V  FLNDL++KL P      + L+ +K ++ K+     D   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 358 DHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHE 417
           D  YY+ K L +NF+VD E+ +++FPLE TI  ML  Y TLF   F+E   P  ++VWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALV 477
           D KQ +VW MDD  +P+F GW+YFDLHPRDGK+GH A F    + M  + +R YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
           CNFS  +K+KP+LLKH E+  FFHELGHG H L+   +         VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 538 EFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS-C 596
           E+W W K+ +  LS H +TGE+IPE L+D ++K+K  N A+  L Q+   L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 597 KDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDM 656
              + L +   WN L +D+ L+ N    ++ Y SF HI+ + Y+AGYYGY W++VFA DM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAADM 402

Query: 657 YHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710
           Y ++F K  L+   G  Y D ++ARGGL ++ D+L EFL REP+ +A+L++ GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  211 bits (536), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 180/698 (25%), Positives = 319/698 (45%), Gaps = 70/698 (10%)

Query: 29  TTASFPTAPQTPPSWSFTPNDIS-GRTKEIIE--KSNKFYDSMSQVESPAVTNFVEPFMK 85
           TT  F     T PS     +D+S  + K+II+  KS++  D           NFV    +
Sbjct: 80  TTGLFANPYLTTPSGLREFSDVSLAKAKKIIDNLKSDRSLDGK--------VNFVIELDR 131

Query: 86  FENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQ 145
             + L  +I+   F++    ++   +A+ D   KL E    L+   ++        QD Q
Sbjct: 132 LSDTLCRVIDLCEFIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQ 191

Query: 146 SQAD-SIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGE-QK 203
             +  S E +   YI    +D+I SG+ +D   + +   + + ISV    +  N+ +  +
Sbjct: 192 VLSKLSEEEKKVGYI--LLQDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLAR 249

Query: 204 EFITFTKEQLE--GVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRK 261
             I   + +L+  G+   +  Q      GKD     YK+       F ++K  +  + RK
Sbjct: 250 NHIKVKRSELDNAGIEFDVACQL-----GKDITGKYYKIPTYGHLPFLILKACTDPEIRK 304

Query: 262 QAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321
           + ++A  +   +    L + +K+R  +A  +G + YA Y +  KMAK+   V +FL  L 
Sbjct: 305 KIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLM 364

Query: 322 KKLIPLGEKELQILQDMKAKDVKKRNQDE-----------DPNYYIWDHRYYDNKYLLEN 370
             L P   KEL+ + D+   +  ++  D+           D  YY   HR      LL++
Sbjct: 365 DFLKPKAAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDD 424

Query: 371 FNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDP 430
           + +D+     ++PL   I G+  I+E+++ ++F E     +   W  DV++L V +    
Sbjct: 425 YALDV-----YYPLGNVIQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS---- 474

Query: 431 KSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM----------------VNDTTRSYPVT 474
           +    IG IY DL  R GK  +AA+F +  S                  V+ T    P+ 
Sbjct: 475 EKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPII 534

Query: 475 ALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVE 531
           +L+CNF+    ++ +   LL  NEI T FHE+GH IH ++G+ +    +G      DFVE
Sbjct: 535 SLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVE 593

Query: 532 APSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDM 591
            PS ++E +  +   L  +  HYKTG+++P  L++  ++         T  Q    + D 
Sbjct: 594 LPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQ 653

Query: 592 KVHSCKDLQNLSICDT---WNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLW 648
           +++    +QN+   D    +++L +++ ++ +    S   A FGH+    Y A YY YL+
Sbjct: 654 RLYDKNIVQNIDSVDVVKIYHELEKELEVLVDDE--SNWCAKFGHLF--GYGATYYCYLF 709

Query: 649 AEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRD 686
               A+ ++   F KDP +   G ++++ VL  GGLR+
Sbjct: 710 DRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  200 bits (509), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 176/674 (26%), Positives = 307/674 (45%), Gaps = 49/674 (7%)

Query: 46  TPNDISGRTKEIIEKSNKFYDSMSQVESP-AVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           TP  +   +K  + K+N+    M    +   +  ++    +  + L  +I+   F++ V 
Sbjct: 89  TPEGLLTFSKASLWKANELVKIMKNDNTKQGLLKYIVRLDQLSDTLCRVIDLCEFIRSVH 148

Query: 105 SDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYK 164
            DKE   A+     ++ E    L+   ++  +   +  D +  +  +  E  +      +
Sbjct: 149 PDKEFLSAAQQCHEEMFEFMNTLNTDVELCDKLKTLLHDNEILS-KLSEEEIKVGRILLE 207

Query: 165 DYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQK-EFITFTKEQLE--GVPDSIL 221
           D+  SG+ ++   R +  E+ ++IS+   +F  N  + K  +I     +LE  G+   +L
Sbjct: 208 DFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLESAGLNRLLL 267

Query: 222 AQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDT 281
              +     KD+    YK+    P  + V+K   + + R   + A  +  SE    L   
Sbjct: 268 NSLK-----KDAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHL 322

Query: 282 LKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAK 341
           +KLR  +A+L+G ++++ Y L  K+AK    V +F+  L K + P  EKEL+ + D+K +
Sbjct: 323 VKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKRE 382

Query: 342 DVKKRNQDEDPNYYI----WDHRYYDNKYLLENFNVD---LEKISEFFPLETTITGMLQI 394
           D  K N  E          WD  YY + Y       +    E +S +F L     G+  +
Sbjct: 383 DQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDL 442

Query: 395 YETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAA 454
              ++ +K +E   P     W  DV+++ V + ++      IG IYFDL  R GK  + A
Sbjct: 443 LTQIYGIK-LEPAIPVSGETWFNDVRKINVISEEEG----IIGIIYFDLFERYGKTSNPA 497

Query: 455 NFGLSSSFMV----------------NDTTRSYPVTALVCNFSKST--KDKP-SLLKHNE 495
           +F +  S  +                + T    P+ +LVCNFS+ T   DK   LL  +E
Sbjct: 498 HFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSE 557

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYK 555
           I T FHE+GH IH ++G+      +G      DFVE PS ++E +  +   L  +S HY+
Sbjct: 558 IETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYE 616

Query: 556 TGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCK---DLQNLSICDTWNQLR 612
           TGEKI E  +   +K      +  T  Q    + D ++HS K   +L NL++ + +  L 
Sbjct: 617 TGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLE 676

Query: 613 QDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGI 672
           + + ++ +    S     FGH+    Y A YY YL+    A  +++  FA DP N  NG 
Sbjct: 677 RRLQVLVDDR--SNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGE 732

Query: 673 QYRDIVLARGGLRD 686
           ++++ +L  GG +D
Sbjct: 733 KFKESLLKWGGSKD 746

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  199 bits (507), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 175/680 (25%), Positives = 313/680 (46%), Gaps = 62/680 (9%)

Query: 46  TPNDISGRTKEIIEKSNKFYDSMSQVESP-AVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +    +  + ++N+  ++M    SP    N++    +  + L  +I+   F++   
Sbjct: 80  SPQGLRKFCRHSLTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASH 139

Query: 105 SDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIE 160
            D     A+ D   ++ E    LN D++L  D+      V  D    ++ +  E  +  +
Sbjct: 140 PDPHFVQAAQDCHEEMFEIMNVLNTDVAL-CDIL---KHVLTDPTILSE-LSPEEIKVGK 194

Query: 161 KSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFI--TFTKEQLEGVPD 218
              +D+  SG+ ++   R +   + ++ISV   +F  N     E++   + K ++E +  
Sbjct: 195 ILLEDFEKSGIHMNPEVREQFIALSQQISVVGQDFINN----TEYVRSNYIKVEVEELNK 250

Query: 219 SILAQFETIESGKDSNETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAI 277
           S + +    +  KD     YK+ TF Y   + +++       R + + A  +  SE +  
Sbjct: 251 SGINKIVLNQLSKDIKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSA-LHSCSEKQIA 308

Query: 278 LLDTL-KLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQ 336
            LD L KLR  +A+++G  ++A+Y L  KMAK    V  F+  L     P   +EL+ + 
Sbjct: 309 RLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIA 368

Query: 337 DMKAKDVKKRNQDEDPNYYI-----WDHRYYDNKYLLEN---FNVDLEKISEFFPLETTI 388
           D+KAK V      E  +  +     WD  +Y + + L+    FN   E+IS +F L   I
Sbjct: 369 DLKAKHVPGNKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNN--EQISSYFSLGVVI 426

Query: 389 TGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDG 448
            G+  +++ ++ + ++E   P+    W  +V+++ V +  +      IG +Y DL  R G
Sbjct: 427 QGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVSEKEG----VIGVVYCDLFERQG 481

Query: 449 KYGHAANFGLSSSFMVNDTTR----------------SYPVTALVCNFSKST---KDKPS 489
           K  + A+F +  S  + D                     PV +LVCNFS +T   +    
Sbjct: 482 KTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSIC 541

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMH 549
           LL+ +EI T FHE+GH +H ++G+ K    +G      DFVE PS ++E +  +   L  
Sbjct: 542 LLQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQR 600

Query: 550 LSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS---CKDLQNLSICD 606
           ++SHY TGE IPE L+ S               Q    + D ++H     K++Q L I  
Sbjct: 601 MASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVK 660

Query: 607 TWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            ++ L + + ++S+    S     FGH+    Y A YY YL+    A+ ++   FA DP 
Sbjct: 661 LYHNLERQLEVLSDDK--SNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPF 716

Query: 667 NTKNGIQYRDIVLARGGLRD 686
             ++G ++++ VL  GG RD
Sbjct: 717 CRRSGEKFKNSVLKWGGSRD 736

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  196 bits (499), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 174/636 (27%), Positives = 292/636 (45%), Gaps = 53/636 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARV 140
           +  + L  +I+   F++    + E   A+ D   ++ E    LN D+SL         + 
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVLNTDVSL-----CNMLKS 179

Query: 141 WQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG 200
             +    A  +  E  +  +    D+  SG+ ++   R K  ++ ++IS+    F  ++ 
Sbjct: 180 VLNNPEIAPKLSEEELKVGKILLDDFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHID 239

Query: 201 EQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV-TFKYPDIFPVMKLASSSQT 259
                    K   + +  S ++ F   +  KD     YKV TF Y   F ++K       
Sbjct: 240 YPGS--NSVKIPCKDLDSSKVSTFLLKQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVV 296

Query: 260 RKQAFLADQNKVSENEAILLDTL-KLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLN 318
           RK+ + A  +  S+ +   LD L KLR  +A+L+   +YA Y L  KMAK+   V DF+ 
Sbjct: 297 RKKIWTA-LHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFIL 355

Query: 319 DLKKKLIPLGEKELQILQDMKAKDVKK---RNQDEDPNYYI-WDHRYYDNKYL-LENFNV 373
            L    I     EL+ + D+KAKD+KK    N DE       WD  YY  KY+ L   NV
Sbjct: 356 TLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNV 415

Query: 374 -DLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKS 432
              ++IS +F L   I G+  +++ ++ ++ +E     E   W  DV++L V + ++   
Sbjct: 416 PSAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAIADEGETWSPDVRRLNVISEEEG-- 472

Query: 433 PRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV----------------NDTTRSYPVTAL 476
              IG IY DL  R+GK  + A+F +  S  +                N +    PV +L
Sbjct: 473 --IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISL 530

Query: 477 VCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAP 533
           VCNFS    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE P
Sbjct: 531 VCNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELP 589

Query: 534 SQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKV 593
           S ++E +  +   L  +  HY+TGE I + ++   +KT +      T  Q    + D   
Sbjct: 590 SILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSF 649

Query: 594 HSCK---DLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAE 650
           H  K   D+ N ++ D +  L + + ++ +    S     FGH+    Y A YY YL+  
Sbjct: 650 HDEKIMSDIDNFNVVDNYQALERHLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDR 705

Query: 651 VFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRD 686
             A+ +++T F  DP +  NG +++  +L  GGL+D
Sbjct: 706 TIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  192 bits (489), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 171/681 (25%), Positives = 307/681 (45%), Gaps = 64/681 (9%)

Query: 46  TPNDISGRTKEIIEKSNKFYDSMSQVES-PAVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +   + + +EK+    D+M    S      F+    +  + L  +I+   F++   
Sbjct: 86  SPKGLKEFSNKSLEKARSLVDTMKNDRSFKGEMGFIMNLDRLSDTLCRVIDLCEFIRSTH 145

Query: 105 SDKEIRDASVDSSMKLDE-LNIDLSLRHDVFLQ--FARVWQDAQSQADSIERETFRYIEK 161
            D+    A+ D   ++ E +N+   L  DV L      V  D    +  +  E  +  + 
Sbjct: 146 PDEAFVKAAQDCHEQMFEFMNV---LNTDVVLCDILKHVLNDPNINS-KLTPEEIKVGKL 201

Query: 162 SYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEF---ITFTKEQLEGVPD 218
             +D+  SG+ +D   R +   + ++IS+   +F  N+   K     I  ++    GV  
Sbjct: 202 LLEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVNS 261

Query: 219 SILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAIL 278
            +L Q       KD     YK+         +++    +  R + + +  +  ++    L
Sbjct: 262 LLLKQLP-----KDITGKYYKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPNDQIRRL 316

Query: 279 LDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDM 338
              +KLR  +A LL   ++A Y L  KMAK    V DF+  L   + P   +EL+ + D+
Sbjct: 317 THLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADL 376

Query: 339 KAKDVKKRNQDE-----------DPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETT 387
           K K++     D            D  YY   H    +  L EN  +++     +F +   
Sbjct: 377 KCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YFTMGNI 431

Query: 388 ITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRD 447
           + G+  I++ ++ ++ +E   P+E   W  +V++L V +    ++   IG +Y DL  R 
Sbjct: 432 MKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCDLFERA 486

Query: 448 GKYGHAANFGLSSSFMV----ND------------TTRSYPVTALVCNFSKS--TKDKP- 488
           GK  + A+F +  S  +    ND            T    PV +LVCNFS +  + DK  
Sbjct: 487 GKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMI 546

Query: 489 SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELM 548
            LL+ NEI T FHE+GH +H ++G+++    +G      DFVE PS ++E +  +K  L 
Sbjct: 547 CLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLH 605

Query: 549 HLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS---CKDLQNLSIC 605
            +  HY+T E++ E +I++ +K         T  Q    + D +++S    KDL ++ + 
Sbjct: 606 EIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVV 665

Query: 606 DTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDP 665
             +  L +D+ ++ +    S     FGH+    Y A YY YL+    A+ ++   FAKDP
Sbjct: 666 KIYQTLEEDLKVLVDNK--SNWCGKFGHLFG--YGASYYSYLFDRAIASKVWDQLFAKDP 721

Query: 666 LNTKNGIQYRDIVLARGGLRD 686
            + + G ++++ VL  GGLRD
Sbjct: 722 FSREGGEKFKNCVLKWGGLRD 742

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  191 bits (485), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 162/680 (23%), Positives = 308/680 (45%), Gaps = 60/680 (8%)

Query: 46  TPNDISGRTKEIIEKSNKFYDSMSQVESP-AVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P+ +   +++ + ++ +  + M   E+P  + N++    +  + L  +I+   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 105 SDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIE 160
            D    DA+ D   ++ E    LN D++L + +     R   +       +  E  +  +
Sbjct: 157 PDSHFVDAAQDCHEEMFEFMNVLNTDVNLCNKL-----RTVLNTPEVVCKLSSEEVKVGK 211

Query: 161 KSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLE--GVP 217
              +D+  SG+ ++   R +   + ++IS+   +F  N    +  +IT   E +   G+ 
Sbjct: 212 ILLEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGIN 271

Query: 218 DSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAI 277
             IL+Q       KD     YK+       + V++       RK+ + A  +   + + +
Sbjct: 272 QLILSQL-----SKDIKGKHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIV 325

Query: 278 LLDTL-KLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQ 336
            LD L +LR  +A L+G  +YA Y L  KMAK    V DF++ L K   P  ++EL  + 
Sbjct: 326 RLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFIS 385

Query: 337 DMKAKDV-----KKRNQDEDPNYYIWDHRYYDNKYLLENFN---VDLEKISEFFPLETTI 388
           D+K K +     +  N D       WD  +Y   Y ++      +D ++IS +F L   +
Sbjct: 386 DLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVM 445

Query: 389 TGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDG 448
            G+  ++  ++ ++ +E    Q+   W  +V++L V + ++      IG +Y DL  RDG
Sbjct: 446 QGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVSDEEG----VIGVVYCDLFERDG 500

Query: 449 KYGHAANFGLSSSFMV----ND------------TTRSYPVTALVCNFSKST---KDKPS 489
           K  + ++F +  S  +    ND            T    P+ +LVCNF+ S         
Sbjct: 501 KTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLC 560

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMH 549
           LL  +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  
Sbjct: 561 LLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLRQ 619

Query: 550 LSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS---CKDLQNLSICD 606
           +  H  TGE +PE L+ + ++         T  Q    + D ++H       +  L +  
Sbjct: 620 IGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVA 679

Query: 607 TWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            +  L +++ ++ +  +   G   FGH+    Y A YY YL+    A+ ++ + F +DP 
Sbjct: 680 LYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPF 735

Query: 667 NTKNGIQYRDIVLARGGLRD 686
           +   G ++++ VL  GG +D
Sbjct: 736 SRAGGQRFKEYVLKWGGAKD 755

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  189 bits (480), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 168/643 (26%), Positives = 297/643 (46%), Gaps = 67/643 (10%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARV 140
           +  + L  +I+   F++    D +   A+ D   ++ E    LN D+SL         + 
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPDDKFVKAAQDCHEQMFEFMNVLNTDVSL-----CNILKS 179

Query: 141 WQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG 200
             ++   +  +  E  +  +    D+  SG+ ++   R K  E+ ++IS+        +G
Sbjct: 180 VLNSPEVSSKLSDEELKVGKILLDDFEKSGIYMNPDVREKFIELSQEISL--------IG 231

Query: 201 EQKEFITFT--------KEQLEGVPDSILAQFETIESGKDSNETLYKV-TFKYPDIFPVM 251
           +  EFI  T        K   + + +  ++ F   +  KD     YK+ TF Y   + ++
Sbjct: 232 Q--EFINHTDYPGSNSVKIPCKDLDNGNVSAFLLKQLNKDVKGQNYKIPTFGYA-AYALL 288

Query: 252 KLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDST 311
           K     + RK+ + A  +   +    L   +KLR  +A+L+  ++YA Y L  KMAK+  
Sbjct: 289 KSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPK 348

Query: 312 TVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKK--RNQDEDPNYYI--WDHRYYDNKYL 367
            V DF+  L    I     EL+ + ++K KD+KK    + +D    +  WD  YY  KYL
Sbjct: 349 DVQDFILTLMNGTIDKTANELKFIAELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYL 408

Query: 368 LENFN--VDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVW 425
             N +   + ++IS +F L   I G+  +++ ++ ++ +E +   E   W  DV++L V 
Sbjct: 409 QLNPSDAPNAKEISYYFTLGNVIEGLSDLFQHIYGIR-LEPEIADEGETWSPDVRRLNVI 467

Query: 426 NMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV--NDTTRS------------- 470
           + ++      IG IY DL  R+GK  + A+F +  S  +  N+T  S             
Sbjct: 468 SEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYF 523

Query: 471 -YPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVP 526
             PV +LVCNF+    ++K     L+ +E+ T FHE+GH +H ++G+      +G     
Sbjct: 524 QLPVISLVCNFAPIPIASKKTLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT 583

Query: 527 WDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHF 586
            DFVE PS ++E +  +   L  +S HY+TGE I   ++ S ++T +      T  Q   
Sbjct: 584 -DFVELPSILMEHFAKDIRILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKM 642

Query: 587 GLFDMKVHS---CKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGY 643
            + D   H      D+ N  I   +  L + + ++ +    S     FGH+    Y A Y
Sbjct: 643 AMLDQSFHDEEIISDIDNFDIVKNYQALERRLKVLVDDQ--SNWCGRFGHLF--GYGATY 698

Query: 644 YGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRD 686
           Y YL+    A+ +++  F  DP + KNG +++  +L  GGL+D
Sbjct: 699 YSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  188 bits (478), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 153/562 (27%), Positives = 267/562 (47%), Gaps = 51/562 (9%)

Query: 164 KDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKN---LGEQKEFITFTKEQLE--GVPD 218
           +D+  SG+ ++   R +  E+ + IS+    F  N   +G    F+    + LE  GV  
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITNTEYVG--TSFVEIETDVLEASGVSQ 268

Query: 219 SILAQFETIESGKDSNETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAI 277
            +L Q     SGK      YK+ T+ Y   + +++   S   RK+ + A  +   +    
Sbjct: 269 MVLQQLSKDLSGK-----FYKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCPEKQIKR 322

Query: 278 LLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQD 337
           L   ++LR ++A ++G   YA Y L  KMAK    V +F+N L +   PL  +EL+ L D
Sbjct: 323 LKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLAD 382

Query: 338 MKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLEN----FNVDLEKISEFFPLETTITGMLQ 393
           MK  +  K   +   +   WD  Y+ +  LL        +  + ++ +F L   I G+  
Sbjct: 383 MKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSD 442

Query: 394 IYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453
           ++++++ ++ +E    +    W  +V+++ V +    ++   IG IY DL  R GK  + 
Sbjct: 443 LFQSIYGIR-LEPVVAKTGETWDPEVRKIQVIS----EANGVIGVIYCDLFERQGKTPNP 497

Query: 454 ANFGLSSSFMV--NDTTRS--------------YPVTALVCNFSKSTKDKPS--LLKHNE 495
           A+F +  S  +  N+T  S               PV +LVCNFS +  D  S  LL+ +E
Sbjct: 498 AHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLSE 557

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYK 555
           + T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +SSHY 
Sbjct: 558 VETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHYA 616

Query: 556 TGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDI 615
           TGE++P+ ++ +  +         T  Q+   + D ++HS  D  +  I   ++ L +++
Sbjct: 617 TGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKEL 675

Query: 616 SLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675
            ++ +    S     FGH+    Y A YY YL     A  +++  F  DP +   G +++
Sbjct: 676 QVLVDDR--SNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKFK 731

Query: 676 DIVLARGGLRD----INDSLKE 693
           + VL  GG RD    I D+L E
Sbjct: 732 NSVLKWGGSRDPWRCIADALDE 753

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  188 bits (477), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 161/656 (24%), Positives = 301/656 (45%), Gaps = 51/656 (7%)

Query: 75  AVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL----DELNIDLSLR 130
            + N++    +  + L  +I+   F++    +K    A+ +    +    + LN D++L 
Sbjct: 119 GLANYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQECHEHMYAFMNTLNTDIALC 178

Query: 131 HDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISV 190
             +     R   D +     +  E  +  +   +D+  SG+++    R +   + + IS+
Sbjct: 179 DRL-----RTVLDNKEVLKRLTDEEIKVGKLLLEDFEKSGIQMSPEIRDRFISLSQDISL 233

Query: 191 NSINFSKNLG-EQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFP 249
              +F  N    +K++I    ++ +   D    +++     KD +   YK+       + 
Sbjct: 234 AGQDFLNNTSYTEKDYIKIKCDEFDKACDYPALKYKL---SKDLSGKYYKIPTYGKIPYT 290

Query: 250 VMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKD 309
            +      + RK+ ++A  +  ++    L   +K R E+A LL   +Y+ Y L  KMAK 
Sbjct: 291 ALLKCKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKG 350

Query: 310 STTVMDFLNDLKKKLIPLGEKELQILQDMKAK----DVKKRNQDEDPNYYIWDHRYYDNK 365
              V +FLN L K ++P   KEL+ + + K       ++   Q    N   WD  YY N 
Sbjct: 351 PKEVNNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYY-NP 409

Query: 366 YLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVW 425
               +       I E+F L   I G+  ++ +++ ++F E    ++   W +DV++L V 
Sbjct: 410 IQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRF-EPGKIEDGETWSKDVRKLNVI 468

Query: 426 NMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV---------------NDTTRS 470
           + D+      IG IY DL  R+GK    +++ +  S  +               N T ++
Sbjct: 469 SEDEG----LIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKN 524

Query: 471 Y--PVTALVCNFSKSTKD---KPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSV 525
           +  P+ +LVCNF  +      +   L+H+EI T FHE+GH +H ++G+ +    +G   V
Sbjct: 525 FQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCV 584

Query: 526 PWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLH 585
             DFVE PS ++EF+  N   L+ +S HY +GE I   +++  ++      A  T  Q  
Sbjct: 585 S-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGK 643

Query: 586 FGLFDMKVHS--CKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGY 643
             L D ++H+     L N+ + + ++ L +++S++ +  T S     FGH+    Y A Y
Sbjct: 644 MALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPD--TESNWCGRFGHLY--GYGALY 699

Query: 644 YGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREP 699
           Y YL+    AT ++ + F  DP + K G  +++ +L  GG +D    + + LG EP
Sbjct: 700 YCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKDPWKCVADVLG-EP 754

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 172/667 (25%), Positives = 300/667 (44%), Gaps = 59/667 (8%)

Query: 58  IEKSNKFYDSMSQVESP-AVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDS 116
           +EKS K  D +    +P  +  +V+      + L  +I+   F++    D +  +A+ D 
Sbjct: 111 LEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDC 170

Query: 117 SMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEP 176
             ++ E    L+   ++      V ++ +  A  +  E  R      +D+  SG+ +   
Sbjct: 171 YEEMFEFMNMLNTDVNLCFTLKHVLENKEI-ASKLSEEELRVGRILLEDFEKSGIYMKPE 229

Query: 177 DRLKVKEIKKKISVNSINFSKNLGEQKEF-ITFTKEQLE--GVPDSILAQFETIESGKDS 233
            R +   + + ISV    F  N    K+  +  +  QL+  G+   +L+Q E   +GK+ 
Sbjct: 230 VREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEKDIAGKN- 288

Query: 234 NETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLL 292
               YK+ T+ Y   F ++K   S + R++ ++A  N  +E    L D +KLR  ++ LL
Sbjct: 289 ----YKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLL 343

Query: 293 GYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQD----MKAKDVKKRNQ 348
           G  +YA Y L  KMAK+   V++F+  L     P+  KEL  + +    +K+        
Sbjct: 344 GKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVC 403

Query: 349 DEDPNYYIWDHRYYDNKYLLENFNVDL---EKISEFFPLETTITGMLQIYETLFNLKFIE 405
           D       WD  YY      +    +L   E++ ++F L   + G+  +++ ++ +K +E
Sbjct: 404 DILKTVRPWDRDYYSAIEREQTSAKNLYGSEEVLKYFTLGNVMQGLSNLFQKIYGIK-LE 462

Query: 406 TKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSS---- 461
              P+    W  +V+++ V + D+      IG IY DL  R GK  +AA+F +  S    
Sbjct: 463 LDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSGKTSNAAHFTICCSRDIS 518

Query: 462 -FMVNDTTR-----------SYPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHG 506
            +   D+T              P+ +LVCNFSK   S  D    L   E+ T FHE+GH 
Sbjct: 519 PYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHA 578

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIP----E 562
           +H ++G+ K    +G      DFVE PS ++E++  +   L  +  HY T E +     E
Sbjct: 579 MHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLE 637

Query: 563 PLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS---CKDLQNLSICDTWNQLRQDISLMS 619
           P +  L   +H      T  Q    + D  +H       L +L +   +  L + + ++ 
Sbjct: 638 PHLQDLKYLQHCE----TYSQAKMAMLDQTLHGETISSHLDHLDVVKLYQDLERQLGVLV 693

Query: 620 NGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVL 679
           +    S     FGH+    YSA YY YL+    A+ ++   F ++P +  +G +YR+ VL
Sbjct: 694 DDK--SNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFSRASGDKYRNSVL 749

Query: 680 ARGGLRD 686
             GG RD
Sbjct: 750 QWGGSRD 756

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  187 bits (475), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 174/684 (25%), Positives = 309/684 (45%), Gaps = 70/684 (10%)

Query: 46  TPNDISGRTKEIIEKSNKFYDSMSQ--VESPAVTNFVEPFMKFENELGPIINQLTFLQHV 103
           +P+ +   ++  ++++ +  D M     ES  +T ++    +  + L  +I+   F++  
Sbjct: 85  SPDGLRKFSQVSLQQAQELLDKMRNDFSESGKLT-YIMNLDRLSDTLCRVIDLCEFIRST 143

Query: 104 SSDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYI 159
             D     A+ D   ++ E    LN D+SL         +   +    +  +  E  +  
Sbjct: 144 HPDDAFVRAAQDCHEQMFEFMNVLNTDVSL-----CNILKSVLNNPEVSSKLSAEELKVG 198

Query: 160 EKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFT--------KE 211
           +    D+  SG+ ++   R K  ++ ++IS+        +G+  EFI  T        K 
Sbjct: 199 KILLDDFEKSGIYMNPDVREKFIQLSQEISL--------VGQ--EFINHTDYPGSNSVKI 248

Query: 212 QLEGVPDSILAQFETIESGKDSNETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNK 270
             + + +S ++ F   +  KD     YKV TF Y   + ++K   +   RK+ + A  + 
Sbjct: 249 PCKDLDNSKVSTFLLKQLNKDVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSC 307

Query: 271 VSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEK 330
             +    L   +KLR  +A+L+   +YA Y L  KMAK+   V DF+  L    I     
Sbjct: 308 SDKQVKRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTAN 367

Query: 331 ELQILQDMKAKDVKK---RNQDEDPNYYI-WDHRYYDNKYLLEN--FNVDLEKISEFFPL 384
           EL+ + ++KAKD+KK    N DE       WD  YY  KY   N   + + ++IS +F L
Sbjct: 368 ELKFIAELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTL 427

Query: 385 ETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLH 444
              I G+  +++ ++ ++ +E     E   W  DV++L V + ++      IG IY DL 
Sbjct: 428 GNVIQGLSDLFQQIYGIR-LEPAITDEGETWSPDVRRLNVISEEEG----IIGIIYCDLF 482

Query: 445 PRDGKYGHAANFGLSSSFMV----------------NDTTRSYPVTALVCNFSK---STK 485
            R+GK  + A+F +  S  +                + T    PV +LVCNFS    ++K
Sbjct: 483 ERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASK 542

Query: 486 DKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKN 545
                L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +  
Sbjct: 543 KSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIR 601

Query: 546 ELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCK---DLQNL 602
            L  +  HY TGE I   ++   +K+ +      T  Q    + D   H  K   D+ N 
Sbjct: 602 ILTKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNF 661

Query: 603 SICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662
            + + +  L + + ++ +    S     FGH+    Y A YY YL+    A+ +++  F 
Sbjct: 662 DVVENYQALERRLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFE 717

Query: 663 KDPLNTKNGIQYRDIVLARGGLRD 686
            DP + KNG +++  +L  GGL+D
Sbjct: 718 DDPYSRKNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  186 bits (473), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 169/643 (26%), Positives = 289/643 (44%), Gaps = 67/643 (10%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARV 140
           +  + L  +I+   F++    D     A+ D   ++ E    LN D+SL         + 
Sbjct: 128 RLSDTLCRVIDLCEFIRSTHPDDAFVKAAQDCHEQMFEFMNVLNTDVSL-----CNMLKT 182

Query: 141 WQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG 200
             ++   +  +  E  +  +    D+  SG+ ++   R K  ++ ++IS+        +G
Sbjct: 183 VLNSPKISSKLSEEELKVGKILLDDFEKSGIYMNPDVREKFIQLSQEISL--------VG 234

Query: 201 EQKEFITFT--------KEQLEGVPDSILAQFETIESGKDSNETLYKV-TFKYPDIFPVM 251
           +  EFI  T        K     + +S ++ F   +  KD     YKV TF Y   + ++
Sbjct: 235 Q--EFINHTDYPGSNSVKISCRELDNSNVSAFLLKQLNKDVKGQNYKVPTFGYA-AYALL 291

Query: 252 KLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDST 311
           K     Q RK+ + A  +   +    L   +KLR  +A L+   +YA Y L  KMAK+  
Sbjct: 292 KSCEKEQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPK 351

Query: 312 TVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKK---RNQDEDPNYYI-WDHRYYDNKYL 367
            V DF+  L    I     EL+ + ++KAKD+KK      DE       WD  YY  KYL
Sbjct: 352 DVQDFILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYL 411

Query: 368 LENFN--VDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVW 425
             N +     ++IS +F L   I G+  +++ ++ +K +E     E   W  DV++L V 
Sbjct: 412 QLNPSNAPSAKEISSYFTLGNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVI 470

Query: 426 NMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV--NDTTRS------------- 470
           + ++      IG IY DL  R GK  + A+F +  S  +  N+T  S             
Sbjct: 471 SEEEG----IIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFF 526

Query: 471 -YPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVP 526
             PV +LVCNF+    ++K     L+ +E+ T FHE+GH +H ++G+      +G     
Sbjct: 527 QLPVISLVCNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT 586

Query: 527 WDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHF 586
            DFVE PS ++E +  +   L  +  HY+TGE +   ++ S ++T +      T  Q   
Sbjct: 587 -DFVELPSILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKM 645

Query: 587 GLFDMKVHS---CKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGY 643
            + D   H      ++ N  +   +  L + + ++ +    S     FGH+    Y A Y
Sbjct: 646 AMLDQSFHDEEVISNIDNYDVVKNYQALERRLKVLVDDQ--SNWCGRFGHLF--GYGATY 701

Query: 644 YGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRD 686
           Y YL+    A+ +++  F  DP + KNG +++  +L  GGL+D
Sbjct: 702 YSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 744

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  185 bits (470), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 143/554 (25%), Positives = 258/554 (46%), Gaps = 44/554 (7%)

Query: 164 KDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQ 223
           +D+  SG+ ++   R +   + ++IS+    F  N    +    + K + E V +S + +
Sbjct: 216 EDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRS--NYIKIKCEEVDNSGINK 273

Query: 224 FETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTL- 282
               +  KD     YK+       + +++     + R   + A  ++ S+ +   LD L 
Sbjct: 274 LLISQLPKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTA-MHRCSDKQINRLDQLL 332

Query: 283 KLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKD 342
           +LR  +A L+G +++A Y L  KMA+    V DF+  L   + P   +EL+ + ++K+K 
Sbjct: 333 RLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSKQ 392

Query: 343 VKKR------NQDEDPNYYIWDHRYYDNKYLLENFN--VDLEKISEFFPLETTITGMLQI 394
            K+        QD       WD  YY + Y L+     +D E+IS +F L   I G+  +
Sbjct: 393 EKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSDL 452

Query: 395 YETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAA 454
           +E+++ ++ +E   P+    +  +V++L V    +      IG +Y DL  R GK  + +
Sbjct: 453 FESIYGIR-LEPVVPKTGETFSPEVRRLNVVCEQEG----VIGVVYCDLFERAGKTSNPS 507

Query: 455 NFGLSSSFMVNDTTRSY----------------PVTALVCNFSKSTKDKP---SLLKHNE 495
           +F +  S  +      +                PV ALVCNFS ST  +     LL+ NE
Sbjct: 508 HFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQLNE 567

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYK 555
           + T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +  H++
Sbjct: 568 VETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPSILMEHFARDVRVLERIGKHHR 626

Query: 556 TGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHS---CKDLQNLSICDTWNQLR 612
           TG  I E L+ + ++         T  Q    + D  +H     KD  +  +   + QL 
Sbjct: 627 TGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQLE 686

Query: 613 QDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGI 672
           +D+ ++ +    S     FGH+    Y A YY YL+    A+ ++ + F+ DP +  NG 
Sbjct: 687 RDMKVLVDDK--SNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVNGE 742

Query: 673 QYRDIVLARGGLRD 686
           ++++ VL  GG R+
Sbjct: 743 KFKECVLKWGGSRN 756

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  181 bits (458), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 165/714 (23%), Positives = 320/714 (44%), Gaps = 67/714 (9%)

Query: 12  SPVITPLLYTRFLSSMTTTASFPTAPQTP---PSWSFTPNDISGRTKEIIEKSNKFYDSM 68
           S  +T LL+++            TAP+T      +  +P  +   TK  +  +N   +++
Sbjct: 73  SGTMTNLLFSKL-------GGGATAPKTGLFNNPYLHSPKGLKQFTKRSLSIANSLVETL 125

Query: 69  SQVESP-AVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDE----L 123
              ++P  +  F+    +  + L  +I+   F++     +     + +   ++ E    L
Sbjct: 126 RTDKTPDGLLKFIVRLDQLSDTLCRVIDLCEFIRSAHPSEAYISVAQECHEEMFEFMNIL 185

Query: 124 NIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKE 183
           N D++L + +     +     +     + +E  +  +   +D+  SG+ +    R +  E
Sbjct: 186 NTDVNLCNTL-----KQVLSTKEIVSKLTQEELKVGKILLEDFEKSGIYMSTDTRDRFIE 240

Query: 184 IKKKISVNSINFSKNLG-EQKEFITFTKEQLE--GVPDSILAQFETIESGKDSNETLYKV 240
           + + IS+   +F  N    + EFI    E+L+  GV   +L Q  T   G     T YKV
Sbjct: 241 MSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPILLRQLTTTVRG-----THYKV 295

Query: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300
                  + +++   +   RK  + A  +   +    L   +K+R  +++++G   +A Y
Sbjct: 296 PAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVY 355

Query: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVK--KRNQDEDPNYYI-- 356
            L  KMAK    V++F+  L +   P+  +EL++L +MK  D+   + N +++    +  
Sbjct: 356 QLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRP 415

Query: 357 WDHRYYDNKYL----LENFNVDLEKISEFFPLETTITGMLQIYETLFNLKF-IETKNPQE 411
           WD  YY  K       +N   + E I+ +F L + + G+  ++++++ +   +    P E
Sbjct: 416 WDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLEGLSNLFKSIYGISLEVVASIPGE 475

Query: 412 KSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSS---------- 461
              W  +V+++ V      ++   IG +Y DL  R  K    A+F +  S          
Sbjct: 476 --TWSSEVRRVNV----KTENNNIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDP 529

Query: 462 ----FMVNDTTRSY--PVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNK 515
                 VN     +  P+ +LVCNF++++ ++  LL+ +EI T FHE+GH +H ++GQ K
Sbjct: 530 SILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTK 589

Query: 516 ESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVN 575
               +G      DFVE PS ++E +  +   L  +  HY T EK+PE L+   + +    
Sbjct: 590 LQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYL 648

Query: 576 GALFTLRQLHFGLFDMKVHSCK---DLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFG 632
               T  Q    + D +++       +++L + + ++ L +++ ++ +  T   G   FG
Sbjct: 649 QNCETFAQAKMAMLDQRLYDNNIIFHVRDLDVVELYHDLERNLEVLVDDQTNWCG--KFG 706

Query: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRD 686
           H+    Y A YY YL     A  ++   F  DP +   G  +++ VL  GGLRD
Sbjct: 707 HLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGLRD 758

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 143/550 (26%), Positives = 249/550 (45%), Gaps = 41/550 (7%)

Query: 165 DYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLEGVPDSILAQ 223
           D+  SG+ +    R +  E+ ++ISV    F  N     KEFI   +++++    S ++ 
Sbjct: 194 DFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMD---KSGISP 250

Query: 224 FETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLK 283
             T    +D     YK+         ++K       RK+ + A  N        L   ++
Sbjct: 251 LLTARLNRDLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHNCPKAQIQRLNQLVR 310

Query: 284 LRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDV 343
           LR  +++LLG  +Y++Y L +KMA     V  F+  L     PL  +EL+ +   K    
Sbjct: 311 LRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNAP 370

Query: 344 KKRNQDEDPNYYI---WDHRYYDNKYLLEN--FNVDLEKISEFFPLETTITGMLQIYETL 398
             R+  ++    I   WD  Y+ +KY  +N    +  E++  +F L   I G+ ++++ +
Sbjct: 371 DSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRI 430

Query: 399 FNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGL 458
           + +  ++    +    W  DV++L V + ++      +G IY DL  R GK  + A+F +
Sbjct: 431 YGIT-LQPSRTENGETWSPDVRRLDVISEEEG----LVGVIYCDLFERVGKISNPAHFTV 485

Query: 459 SSSFMV----ND------------TTRSYPVTALVCNFSKST---KDKPSLLKHNEIVTF 499
             S  V    ND            T    PV +LVCNFS       ++   L  NEI T 
Sbjct: 486 CCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETL 545

Query: 500 FHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEK 559
           FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  + SHY+T E 
Sbjct: 546 FHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEP 604

Query: 560 IPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---SCKDLQNLSICDTWNQLRQDIS 616
            PE L++  +          T  Q    + D K+H   S  D++ +     + +L   + 
Sbjct: 605 APEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQ 664

Query: 617 LMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRD 676
           ++++    S     FGH+    Y A YY YL+    A+ ++ + F  DP N   G ++++
Sbjct: 665 VLADDE--SNWCGRFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKE 720

Query: 677 IVLARGGLRD 686
            VL  GGL++
Sbjct: 721 RVLKWGGLKN 730

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  176 bits (446), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 162/681 (23%), Positives = 316/681 (46%), Gaps = 65/681 (9%)

Query: 58  IEKSNKFYDSMSQVES-PAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKE-IRDASVD 115
           ++++ +  D M Q  S     N++    +  + L  +I+   F++    D + +R A + 
Sbjct: 98  LKEAQQLVDQMRQDRSHQGHLNYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLC 157

Query: 116 SSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDE 175
                + +N+ L+    +     RV  D    A  +  E  +  +   +D+  SG+++  
Sbjct: 158 HEEMFEFMNV-LNTDSTLCEILKRVLSD-DLIASKLSEEELKVGKILLEDFEKSGIDMAP 215

Query: 176 PDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLE--GVPDSILAQFETIESGKD 232
               +   + ++IS+    F  N    + E++  +  +LE  G+   +L         +D
Sbjct: 216 EVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLLLNHL-----SRD 270

Query: 233 SNETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASL 291
           +    YKV T+ Y   F +++   S   R + + A  +   +    L   +KLR  +A +
Sbjct: 271 TKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTAVHSCPEKQITRLKHLVKLRGLLAQI 329

Query: 292 LGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAK--DVKKRNQD 349
           +G ++Y++Y L  KMAK    V  F+  L + + PL  +EL+ L ++K+   D+     D
Sbjct: 330 MGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTD 389

Query: 350 EDPNYYI--WDHRYYDNKYLLENFNVDL--EKISEFFPLETTITGMLQIYETLFNLKFIE 405
           E+   ++  WD  +Y     L+     L  E+I+ +F L T + G+  + E ++ ++ +E
Sbjct: 390 EEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIR-LE 448

Query: 406 TKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV- 464
               +    W  +V+++ V  + D +    IG +Y DL  R GK  + A+F +  S  + 
Sbjct: 449 PAVAKVGETWSPEVRRINV--VSDQEG--VIGVVYCDLFERQGKTSNPAHFTVCCSRQIY 504

Query: 465 -NDTTRS---------------YPVTALVCNFSKSTKDKP--SLLKHNEIVTFFHELGHG 506
             +T  S                PV +LVC+FS+++  K    LL+ +E+ T FHE+GH 
Sbjct: 505 PEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHA 564

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLID 566
           IH ++G+      +G      DFVE PS ++E +  +   L  +  HY T E +P+ L+ 
Sbjct: 565 IHSMLGRTSLQNISGT-RCATDFVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELL- 622

Query: 567 SLIKTKHVNGALF-------TLRQLHFGLFDMKVHSCKDLQN--LSICDTWNQLRQDISL 617
                 H+N           T  Q    + D ++HS + L +  + + + ++++ + + +
Sbjct: 623 ------HLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGV 676

Query: 618 MSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDI 677
           +++    S     FGH++   Y A YY YL+    A+ ++   FA DP + K+G ++++ 
Sbjct: 677 LTDDK--SNWCGRFGHLL--GYGASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNS 732

Query: 678 VLARGGLRDINDSLKEFLGRE 698
           VL  GG RD  + + + L ++
Sbjct: 733 VLRWGGSRDPWNCIADALDKQ 753

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  174 bits (442), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 168/640 (26%), Positives = 293/640 (45%), Gaps = 60/640 (9%)

Query: 90  LGPIINQLTFLQHVSSDKEIRDASVDSSMKLDE-LNIDLSLRHDVFL--QFARVWQDAQS 146
           L  +I+   FL+    D++   A+ +   ++ E +NI   L  DV L  +  +V  D ++
Sbjct: 141 LCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEIMNI---LNTDVVLCKRLKQVLSD-EN 196

Query: 147 QADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGE-QKEF 205
            +  +  E  R      +D+  +G       R +  ++ + IS+   +F  N       +
Sbjct: 197 ISSKLSSEEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSY 256

Query: 206 ITFTKEQLE--GVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQA 263
           I    + LE  G    +L Q       KD+    YK+       + ++    S   R+Q 
Sbjct: 257 IKIPCKDLESSGTSHLVLRQLT-----KDTMGNNYKIPTSGYAPYTLLNACPSEAIRRQV 311

Query: 264 FLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKK 323
           + A  +   +    L   L+LR ++A+++G   Y +Y L  KMAK    V +FLN L   
Sbjct: 312 WTAMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDH 371

Query: 324 LIPLGEKELQILQDMKAKDVKKRNQDEDPNYYI---WDHRYYDN---KYLLENFNVD-LE 376
             PL   EL+ L  +K ++V+  N  E     +   WD  YY +    +   N  VD   
Sbjct: 372 TKPLAAGELEELAKLK-RNVE--NLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFT 428

Query: 377 KISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFI 436
            I+ +F L   + G+  ++  ++ +  ++    Q    W  DV++L V +    ++   I
Sbjct: 429 SINTYFSLGVVMQGISDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVIS----ETEGII 483

Query: 437 GWIYFDLHPRDGKYGHAANFGLSSSFMV---------------NDTTR-SYPVTALVCNF 480
           G IY DL  R GK    ++F +  S  +                D +R   PV +L+CNF
Sbjct: 484 GLIYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNF 543

Query: 481 --SKSTKDKP-SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
             ++  K+K   LL+ +++ T FHE+GH +H ++G+ +    +G   V  DFVE PS ++
Sbjct: 544 RATRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILM 602

Query: 538 EFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCK 597
           E +  ++  L+ +SS+Y TGE IPE L+ +  +  +      T  Q+   + D ++HS  
Sbjct: 603 EHFAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSIT 662

Query: 598 DLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMY 657
           D  +  I   ++ L +++ ++ +  T   G   FGH+    Y A YY YL     A  ++
Sbjct: 663 DQDD--IIAVYHGLEREMEVLVDDQTNWCG--RFGHLF--GYGASYYSYLMDRAIAAKIW 716

Query: 658 HTKFAKDPLNTKNGIQYRDIVLARGGLRD----INDSLKE 693
              F KDP +  +G ++++ VL  GG RD    I D+L E
Sbjct: 717 DHLFKKDPFSRSSGEKFKEGVLKWGGSRDAWQCIADALDE 756

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  174 bits (441), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 141/564 (25%), Positives = 264/564 (46%), Gaps = 44/564 (7%)

Query: 164 KDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLE--GVPDSI 220
           +D+  SG++++     +   I ++IS+    F  N    + +++    ++L+  GV   +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 221 LAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLD 280
           L Q       +D     YKV       F +++   +   R + + A  +   +  + L  
Sbjct: 263 LNQL-----SRDLKNQNYKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPEKQISRLKQ 317

Query: 281 TLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKA 340
            + LR  +AS++G  +YA Y L  KMAK    V  F+  L     PL  +EL++L  +K+
Sbjct: 318 LVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKS 377

Query: 341 K--DVKKRNQDEDPNYYI--WDHRYYDNKYLLENFNVDLEK--ISEFFPLETTITGMLQI 394
               V     D D   ++  WD  +Y     L+     LE   IS +F L T + G+ ++
Sbjct: 378 GHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRL 437

Query: 395 YETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAA 454
           +E ++ ++ +E    +    W  +V+++ V +  +      IG +Y DL  R GK  + A
Sbjct: 438 FEDIYGIR-LEPVVAKAGETWSPEVRRINVVSEKEG----IIGVVYCDLFERQGKTSNPA 492

Query: 455 NFGLSSSFMV--NDTTRS--------------YPVTALVCNFSKSTKDKP--SLLKHNEI 496
           +F +  S  +   +T  S               PV +LVC+F++++  +    LL+ +++
Sbjct: 493 HFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDV 552

Query: 497 VTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKT 556
            T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY T
Sbjct: 553 DTLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYAT 611

Query: 557 GEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQN--LSICDTWNQLRQD 614
            + IP  L+       +      T  Q    + D ++HS K L +  L +   ++ + +D
Sbjct: 612 DQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKD 671

Query: 615 ISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQY 674
           + ++++    S     FGH++   Y A YY YL+    A+ ++   FA+DP N +NG ++
Sbjct: 672 MEVLADDQ--SNWCGRFGHLLG--YGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKF 727

Query: 675 RDIVLARGGLRDINDSLKEFLGRE 698
           ++ VL  GG +D  + + + L R+
Sbjct: 728 KESVLKWGGSKDPWECVADALDRK 751

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  171 bits (432), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 155/557 (27%), Positives = 268/557 (48%), Gaps = 53/557 (9%)

Query: 164 KDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLEGVPDSILA 222
           +D+  SG+ ++   R K  E+ ++IS+    F  N     K  I   +E L       L+
Sbjct: 224 EDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILIDRESLN------LS 277

Query: 223 QFE---TIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILL 279
           + E   T +   D     YK+    P  + ++   S+   RK+ +    +   E    L 
Sbjct: 278 ELELPFTYQLKTDITGKHYKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLK 337

Query: 280 DTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMK 339
             + LR ++A LL   ++A Y L  KMAK+   V  F++ L     PL  KEL  L ++K
Sbjct: 338 KMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVK 397

Query: 340 AKDVKKRNQDEDPNYYI-----WDHRYYD--NKYLLENFNVDLEKISEFFPLETTITGML 392
           A D+    ++ D N+ +     WD  YY   N+Y  +    DL ++  +F L   I G+ 
Sbjct: 398 AADLGLAFKN-DSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLS 456

Query: 393 QIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGH 452
            ++  ++ ++F E   P+ +  W  +V++L V +    +S   IG +Y DL  R  K  +
Sbjct: 457 NLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYCDLFERPSKKTN 511

Query: 453 AANFGLS-----------SSFMVNDTTRS----YPVTALVCNFSKS---TKDKPSLLKHN 494
           AA+F +            S+  V   ++      P+ +L+CNFSKS    ++ P  L+ +
Sbjct: 512 AAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLH 571

Query: 495 EIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHY 554
           EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   +  +SSHY
Sbjct: 572 EIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHY 630

Query: 555 KTGEKI-PEPLIDSLIKTKHV-NGALFTLRQLHFGLFDMKVHS---CKDLQNLSICDTWN 609
            + E   PE L   L  T ++ N  L+T  Q    + D  +HS    +D +++++  ++N
Sbjct: 631 ISQEPASPELLQTWLHSTDNLQNLELYT--QAKMSMLDQILHSNEIFEDQKDINVVKSYN 688

Query: 610 QLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTK 669
            L + + L S+    S     FGH+    Y A YY YL+    A+ ++ + F ++P +  
Sbjct: 689 DLEKKLELFSDDQ--SNWCGKFGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRT 744

Query: 670 NGIQYRDIVLARGGLRD 686
           +G++++D VL  GG RD
Sbjct: 745 SGLKFKDSVLRWGGSRD 761

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  162 bits (410), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 171/688 (24%), Positives = 307/688 (44%), Gaps = 67/688 (9%)

Query: 42  SWSFTPNDISGRTKEIIEKSNKFYDSMSQVESP-AVTNFVEPFMKFENELGPIINQLTFL 100
           S+  + N +   T+   EK+ +    +  +E+   +  +++   +  + L  +I+   F+
Sbjct: 84  SYLKSANGLVEFTQHSFEKAKELVQKIHSIETQDEMKYYIKDLDQLSDVLCRVIDLCEFI 143

Query: 101 QHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDVFLQFARVWQDAQSQADSIERETF 156
           +    DK+    +     K+ E    LN D+ L  D+  Q  R     +S    ++ E  
Sbjct: 144 RATHPDKKFVQTAQQCHEKMFEIMNILNTDVRL-CDLLTQCLR-----ESDVLGLDSEEI 197

Query: 157 RYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLG-EQKEFITFTKEQLEG 215
           R  +   +D+  SG+ +    R K  ++ ++ISV   +F  N    +  +I  + E ++ 
Sbjct: 198 RTGKILLEDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDA 257

Query: 216 -VPDSILAQFETIESGKDSNETLYKV-TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSE 273
            V   + +Q +     KD     YKV T+ Y  I   +    S +  +     + +  S+
Sbjct: 258 HVNKMVCSQMK-----KDITGEYYKVPTYGY--IPHTLLRTCSDEVIRMKIWTEMHSCSD 310

Query: 274 NEAILLDTL-KLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKEL 332
            +   L  L  LR E+A LLG   +A Y L+ KMAK    V  FL  L          EL
Sbjct: 311 AQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASEL 370

Query: 333 QILQDMKAK--DVKKRNQDEDPNYYI--WDHRYYDN-KYLLENFNVDL---EKISEFFPL 384
           + L  +K++    +  +  E+    +  WD  YY + + L +  +  L   E IS  F L
Sbjct: 371 KPLAVLKSELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSL 430

Query: 385 ETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLH 444
              + G+  ++E ++ +K +    P+    W  DV+++ V +  D      IG +Y DL 
Sbjct: 431 GVVMQGLSDLFEKIYGIKLVPA-TPKTGETWSPDVRRIDVVDEHDG----LIGVMYCDLF 485

Query: 445 PRDGKYGHAANFGLSSS--------------FMVNDTTRSY--PVTALVCNF-------S 481
            R+GK  + A+F +  S                VN   + +  PV +LVC+F        
Sbjct: 486 EREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMG 545

Query: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
                +  LL+ NEI T FHE+GH +H ++G+ +    +G      DFVE PS ++E + 
Sbjct: 546 DGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFA 604

Query: 542 WNKNELMHLSSHYKTGEKIP-EPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600
            +   L  +SSHYKTG+ +  E L +  ++ + +     T  Q+     D ++H+     
Sbjct: 605 RDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCE-TFSQIKMSFLDQELHNLDHTT 663

Query: 601 NLSI--CDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYH 658
           + SI     +++L + ++++ +    S     FGH+    Y A YY YL+    A+ ++ 
Sbjct: 664 DGSIDVIAIYHRLERRLAVLPDDQ--SNWCGKFGHLFG--YGASYYSYLFDRAIASKIWD 719

Query: 659 TKFAKDPLNTKNGIQYRDIVLARGGLRD 686
             F +DP N  NG ++++ +L  GG RD
Sbjct: 720 HLFEQDPFNRTNGTKFKEGLLQWGGSRD 747

>AFR010C Chr6 complement(452964..454382) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER143W
           (DDI1)
          Length = 472

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 4/84 (4%)

Query: 15  ITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNK-FYDS---MSQ 70
           ++P+       S   TA+ PT P +P       NDI     E IE   K   +S    S 
Sbjct: 114 VSPVAQVPVAVSPAVTAAVPTQPTSPSGGPAAANDIITPEDEYIETFRKSLLNSPSLASN 173

Query: 71  VESPAVTNFVEPFMKFENELGPII 94
           +  P V   ++    F+  +GP++
Sbjct: 174 IPIPGVNQLIQDSQLFKQLIGPVL 197

>KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} similar
           to uniprot|P38699 Saccharomyces cerevisiae YHR178W STB5
           binds Sin3p in two-hybrid assay Zinc finger (6-Cys)
          Length = 634

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 52  GRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRD 111
           GRT  ++E +  F      +E P    F+  + K  +   P++N++ FL  VS+ ++ ++
Sbjct: 176 GRTTPMVEPNGSF----KHIERPLYDRFIAAYFKHNHRSYPLLNKIEFLNKVSTIRDFKE 231

>ZYRO0D06710g Chr4 complement(579323..580285) [963 bp, 320 aa] {ON}
           weakly similar to uniprot|Q04608 Saccharomyces
           cerevisiae YDR124W Hypothetical ORF
          Length = 320

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 24/108 (22%)

Query: 492 KHNEIVTFFHELGHG----IHDLVGQNKESRFNG-----------PGSVPWDFVEAPSQM 536
           K NEI  F  + G+     + D +  N   +F+            P  V WD V+   ++
Sbjct: 15  KFNEIAVFLLKEGYEFSIFVKDKIDSNSNCKFSQAYVTTAVEDILPIGV-WDLVDG-EKI 72

Query: 537 LEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQL 584
           +++     ++L    +HY T   IP PL + ++  K+V+GAL  LRQ+
Sbjct: 73  IKY----DSKLCAPQNHYPT---IPLPLTNLIVVEKYVHGALKLLRQV 113

>CAGL0K12540g Chr11 complement(1224345..1225334) [990 bp, 329 aa]
           {ON} some similarities with uniprot|P41546 Saccharomyces
           cerevisiae YFL031w HAC1 transcription factor
          Length = 329

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 252 KLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLL----GYDTYANYNLYDKMA 307
           K A  S+ RK+ ++A+  K      ++LD L+ + ++ S+L     +DTY N    D+M+
Sbjct: 54  KAAQKSRDRKRNYVANLEKKCNTMKVVLDQLQSKIDIKSMLIDPSVWDTYINMEQDDEMS 113

Query: 308 KDSTTV 313
             ST V
Sbjct: 114 FSSTDV 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,512,271
Number of extensions: 3981385
Number of successful extensions: 14726
Number of sequences better than 10.0: 160
Number of HSP's gapped: 15209
Number of HSP's successfully gapped: 163
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)