Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1551.8ON97974963e-66
YCL057C-A (MOS1)1.8ON97974531e-59
Smik_3.171.8ON97974442e-58
Skud_3.61.8ON97974356e-57
TPHA0E039801.8ON86853071e-37
NCAS0B090801.8ON93882976e-36
CAGL0B00396g1.8ON88742966e-36
SAKL0C00528g1.8ON110942952e-35
AFR743W1.8ON82962922e-35
ZYRO0F18414g1.8ON87692896e-35
TBLA0A049601.8ON96702908e-35
Ecym_10101.8ON82962853e-34
Kpol_2002.111.8ON86702853e-34
KLTH0F00550g1.8ON82962792e-33
KLLA0C00550g1.8ON82942783e-33
Kwal_33.130161.8ON82692629e-31
KAFR0D001701.8ON90972481e-28
KNAG0C002501.8ON94932438e-28
NDAI0A001701.8ON96962421e-27
TDEL0C069401.8ON86962411e-27
Skud_4.6285.417ON97824651.1
Skud_2.2053.307ON134134651.2
AEL217W5.76ON83424622.5
TBLA0B023603.104ON30635622.6
Skud_2.1923.285ON61964613.9
Smik_2.2143.307ON139031604.6
Smik_2.2023.285ON61764595.9
KNAG0J022103.285ON58164596.3
KLTH0E00726g5.716ON31429588.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.155
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   195   3e-66
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   179   1e-59
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   175   2e-58
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   172   6e-57
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   122   1e-37
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   119   6e-36
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   118   6e-36
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   118   2e-35
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   117   2e-35
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   115   6e-35
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   116   8e-35
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   114   3e-34
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   114   3e-34
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   112   2e-33
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   111   3e-33
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   105   9e-31
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   100   1e-28
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    98   8e-28
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    98   1e-27
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...    97   1e-27
Skud_4.628 Chr4 complement(1120830..1123766) [2937 bp, 978 aa] {...    30   1.1  
Skud_2.205 Chr2 complement(369005..373030) [4026 bp, 1341 aa] {O...    30   1.2  
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    28   2.5  
TBLA0B02360 Chr2 (551024..551944) [921 bp, 306 aa] {ON} Anc_3.10...    28   2.6  
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...    28   3.9  
Smik_2.214 Chr2 complement(382964..387136) [4173 bp, 1390 aa] {O...    28   4.6  
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...    27   5.9  
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...    27   6.3  
KLTH0E00726g Chr5 (74503..75447) [945 bp, 314 aa] {ON} weakly si...    27   8.3  

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  195 bits (496), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  179 bits (453), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 91/97 (93%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQAQ   PAKSTPS +SN+NGS+VST+LD KWDIVLSNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  175 bits (444), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 90/97 (92%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQAQA  PAK TPS +S++NGS VSTVLD KWDIVLSNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  172 bits (435), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 84/97 (86%), Positives = 90/97 (92%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQA+   PAKST S +S +NGSAVST+LDAKWDIV+SNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  122 bits (307), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 71/85 (83%)

Query: 13 STPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIG 72
          S    N+N   ++  ++L+ KWD+VLSNMLVKT +GFG+GV TS+L FKRRAFP WLGIG
Sbjct: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61

Query: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97
          FGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  119 bits (297), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 57/88 (64%), Positives = 70/88 (79%), Gaps = 1/88 (1%)

Query: 10 PAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWL 69
          P +STP T++    +   ++L+ KWD+VLSNMLVK  +GF +GV  SV+FFKRR FP WL
Sbjct: 7  PNQSTP-TSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWL 65

Query: 70 GIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          GIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 66 GIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  118 bits (296), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 53/74 (71%), Positives = 65/74 (87%)

Query: 24 SAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGD 83
          + V ++L+ KWD+VLSNM+VK  +GFG+GV TSVLFFKRR+FP WLG+GFG GRGY+EGD
Sbjct: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74

Query: 84 AIFRSSAGLRSSKV 97
          AIFRS+AGLRS KV
Sbjct: 75 AIFRSTAGLRSVKV 88

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  118 bits (295), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 67/94 (71%), Gaps = 15/94 (15%)

Query: 1   MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
           MSEQ Q   P KS               +L+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73

Query: 61  KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRS 94
           KRRAFP WLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MS Q +  AP++S               +L+ KWD+VLSN++VKT +GFG GVF SVLFF
Sbjct: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFP WLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  115 bits (289), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%)

Query: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN+LVK+ +GFG+GV  SVL FKRRAFP WLGIGFG+GRGYAEGDAIFR
Sbjct: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77

Query: 88 SSAGLRSSK 96
          S+AGLR+SK
Sbjct: 78 SAAGLRTSK 86

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  116 bits (290), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (88%)

Query: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWDIV+SNMLVKT  GFG GV  SV+FFKRRAFP WLG+GFG+GRGY+EGDAIFR
Sbjct: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86

Query: 88 SSAGLRSSKV 97
          S+AGLRS +V
Sbjct: 87 STAGLRSFQV 96

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  114 bits (285), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (70%), Gaps = 15/96 (15%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          M E+ +  AP++S               +L+ KWD+VLSN++VK  +GF +GV  SVLFF
Sbjct: 1  MGEKLEVAAPSRS---------------ILNDKWDVVLSNLVVKAGLGFSVGVLASVLFF 45

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFP WLGIGFG+GRGYAEGDAIFRS AGLR+ K
Sbjct: 46 KRRAFPVWLGIGFGLGRGYAEGDAIFRSHAGLRTMK 81

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  114 bits (285), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 61/70 (87%)

Query: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN LVKT++GFG GV  SV+ FKRRAFP WLGIGFG+GRGY+EGDAIFR
Sbjct: 17 SILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAIFR 76

Query: 88 SSAGLRSSKV 97
          S+AGLR S V
Sbjct: 77 SAAGLRKSTV 86

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  112 bits (279), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQ       K +P++ S         +L+ KWD+VLSN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQL------KVSPTSRS---------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFP W+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  111 bits (278), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 15/94 (15%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSEQ Q     K+ PS            +LD +WD+VLSN++ KTA+G G+G+  SVLFF
Sbjct: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRS 94
          KRRAFP W+G+GFG+GRGYAEGDAIFR++AGLR 
Sbjct: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLRK 79

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  105 bits (262), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 59/69 (85%)

Query: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA P W+G+GFG+GRGY+EGDAIFR
Sbjct: 13 SLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAIFR 72

Query: 88 SSAGLRSSK 96
          SSAGLR+ K
Sbjct: 73 SSAGLRTVK 81

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 73/97 (75%), Gaps = 7/97 (7%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSE+ +   PA+ +       N S   ++L+ KWD+VLSNMLVK  +GFG+GV TSV+FF
Sbjct: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFF 53

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 98.2 bits (243), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 4/93 (4%)

Query: 9  APAKSTPSTNSNENGSAVSTV----LDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRA 64
          +   +T     N NG   + +    L+ KWD+VLSNMLVK  MGFG+GV TSVL F+RRA
Sbjct: 2  SETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRA 61

Query: 65 FPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          FP WLGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 62 FPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 97.8 bits (242), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 68/96 (70%), Gaps = 7/96 (7%)

Query: 2  SEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFK 61
          +E   A AP +   +T          ++L+ KWDIVLSN LVK  +GFG+GV TSV+FFK
Sbjct: 8  TEHQNAVAPPQQQLATID-------KSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 62 RRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          RR FP WLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 97.4 bits (241), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/96 (64%), Positives = 73/96 (76%), Gaps = 11/96 (11%)

Query: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60
          MSE++QA     + PS           ++L+ KWD+VLSNMLVKT +GFG+GV  SVLFF
Sbjct: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFF 49

Query: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFP WLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85

>Skud_4.628 Chr4 complement(1120830..1123766) [2937 bp, 978 aa] {ON}
           YDR359C (REAL)
          Length = 978

 Score = 29.6 bits (65), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 2   SEQAQAPAPAKSTPSTNSNENGSA 25
           S +AQ+P P+ S PS+N   +G A
Sbjct: 831 SSRAQSPVPSNSKPSSNLTRSGQA 854

>Skud_2.205 Chr2 complement(369005..373030) [4026 bp, 1341 aa] {ON}
           YBR081C (REAL)
          Length = 1341

 Score = 29.6 bits (65), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 12  KSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKT 45
           KS PST   E  S V   L A+ D VLS  + KT
Sbjct: 73  KSFPSTQEGEQSSVVPATLSAQPDNVLSQTIEKT 106

>AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR250C
          Length = 834

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 9   APAKSTPSTNSNENGSAVSTVLDA 32
           +PA S+P  + + NG+A STV+DA
Sbjct: 802 SPAMSSPKRSPDYNGTADSTVIDA 825

>TBLA0B02360 Chr2 (551024..551944) [921 bp, 306 aa] {ON} Anc_3.104
           YOL093W
          Length = 306

 Score = 28.5 bits (62), Expect = 2.6,   Method: Composition-based stats.
 Identities = 10/35 (28%), Positives = 21/35 (60%)

Query: 6   QAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSN 40
           + P   KSTP  N N++ S +  ++D  +D ++++
Sbjct: 73  ELPDEYKSTPKLNHNQSDSGIKIIMDCAFDELMND 107

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 26/64 (40%)

Query: 23  GSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEG 82
           G AVS V   +W  VL   LV  AM        +   F    F   + I     RGYAE 
Sbjct: 173 GFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTNVNADIFVAVVFIFVIIINLFGSRGYAEA 232

Query: 83  DAIF 86
           + IF
Sbjct: 233 EFIF 236

>Smik_2.214 Chr2 complement(382964..387136) [4173 bp, 1390 aa] {ON}
           YBR081C (REAL)
          Length = 1390

 Score = 27.7 bits (60), Expect = 4.6,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 12  KSTPSTNSNENGSAVSTVLDAKWDIVLSNML 42
           KS PST   E G  +S+V+D + D V S ++
Sbjct: 73  KSLPSTQEEERGEILSSVVDIRPDDVSSQII 103

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score = 27.3 bits (59), Expect = 5.9,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 26/64 (40%)

Query: 23  GSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEG 82
           G AVS V   +W  VL   LV  AM        +   F    F   + I     RGYAE 
Sbjct: 173 GFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTSVNSDIFVAVVFIFVIIINLFGSRGYAEA 232

Query: 83  DAIF 86
           + IF
Sbjct: 233 EFIF 236

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score = 27.3 bits (59), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 23  GSAVSTVLDAKWDIVLSNMLVKTAMGF---GIGVFTSVLFFKRRAFPAWLGIGFGVGRGY 79
           G A+S +   +W IVL   LV  AM      +GV   V  F   +F   + I  G  RGY
Sbjct: 167 GFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDV--FVLASFVVVVLINLGGARGY 224

Query: 80  AEGD 83
            E +
Sbjct: 225 VEAE 228

>KLTH0E00726g Chr5 (74503..75447) [945 bp, 314 aa] {ON} weakly
           similar to uniprot|P36169 Saccharomyces cerevisiae
           YKR100C SKG1 and weakly similar to uniprot|P40451
           Saccharomyces cerevisiae YIL158w AIM20
          Length = 314

 Score = 26.9 bits (58), Expect = 8.3,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 3   EQAQAPAPAKSTPSTNSNENGSAVSTVLD 31
           ++ ++P  + ST     N+NG A STVLD
Sbjct: 131 DEQRSPTDSSSTSLDTKNQNGRAHSTVLD 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,105,295
Number of extensions: 304743
Number of successful extensions: 1356
Number of sequences better than 10.0: 38
Number of HSP's gapped: 1355
Number of HSP's successfully gapped: 38
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)