Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1541.7ON1131134654e-61
Skud_3.51.7ON1131133665e-46
YCL058W-A (ADF1)1.7ON1131133527e-44
Smik_3.161.7ON1131133381e-41
KAFR0D001601.7ON111871843e-18
CAGL0B00374g1.7ON121891695e-16
NCAS0B090901.7ON119901503e-13
SAKL0C00506g1.7ON105901485e-13
TBLA0A049501.7ON113871433e-12
KNAG0C002401.7ON126951382e-11
NDAI0A001601.7ON123981331e-10
Kpol_2002.101.7ON111911303e-10
TPHA0E039901.7ON116911242e-09
TDEL0C069501.7ON111891233e-09
Kwal_YGOB_YCL058W-A1.7ON105831138e-08
Kwal_33.13015singletonOFF105831138e-08
KLTH0F00528g1.7ON104821112e-07
ZYRO0F18436g1.7ON112881042e-06
AFR743CA1.7ON10187954e-05
KLLA0C00528g1.7ON11677621.9
KLTH0C01584g5.94ON91352632.9
Suva_9.395.702ON168247607.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.154
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...   183   4e-61
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)   145   5e-46
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...   140   7e-44
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...   134   1e-41
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    75   3e-18
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    70   5e-16
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    62   3e-13
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    62   5e-13
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    60   3e-12
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    58   2e-11
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    56   1e-10
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    55   3e-10
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    52   2e-09
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    52   3e-09
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    48   8e-08
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    48   8e-08
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    47   2e-07
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    45   2e-06
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    41   4e-05
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    28   1.9  
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    29   2.9  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    28   7.3  

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  183 bits (465), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 96/113 (84%), Positives = 96/113 (84%)

Query: 1   MGKSSMRXXXXXXXXXXXXXXXXXRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60
           MGKSSMR                 RPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ
Sbjct: 1   MGKSSMRKKTQGKNGGVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60

Query: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL
Sbjct: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score =  145 bits (366), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (76%)

Query: 1   MGKSSMRXXXXXXXXXXXXXXXXXRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60
           MGKSS+R                 RPISTAE KRTKLQVE+LNKSSE MIPTLL+E + Q
Sbjct: 1   MGKSSLRMKTQGKNGGVGKKVQKKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60

Query: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           +  KK+ +STL+AEELVKDQA+D KVRE I+TEKSKTNDSML+QIEMISGFSL
Sbjct: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score =  140 bits (352), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 84/113 (74%)

Query: 1   MGKSSMRXXXXXXXXXXXXXXXXXRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60
           MGK SM+                 R ISTAE KRTKLQVE+LNKSSETMIPTLL+EAS Q
Sbjct: 1   MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60

Query: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           +  K K  +TL+AEEL+KDQ +DSKVRE I TEKSKTNDSMLKQIEMISGFSL
Sbjct: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 72/113 (63%), Positives = 83/113 (73%)

Query: 1   MGKSSMRXXXXXXXXXXXXXXXXXRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60
           MGK+SMR                 R ISTA  KRTKLQVE+LNKSSE MIPTLL+E   Q
Sbjct: 1   MGKNSMRRKSVGKNVGVGKKVQKRRSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60

Query: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           +  K+KT STL+A +L+KDQ +DSKVREHI+ EKSKTND+MLKQIEMISGFSL
Sbjct: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 75.5 bits (184), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDSKV 86
           IS +E K+ KL VE+ N+ + T +  L K+  K      KT++ LE ++L+ DQARD +V
Sbjct: 25  ISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLHDQARDHEV 84

Query: 87  REHIETEKSKTNDSMLKQIEMISGFSL 113
           +++IET+  +T DSMLKQIEMISGFSL
Sbjct: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 69.7 bits (169), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 59/89 (66%), Gaps = 2/89 (2%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDL--DKKKTRSTLEAEELVKDQARDS 84
           IS +E K++K+   RLNK ++     +++E +   +  + KK ++ L+   LVKDQ RD 
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92

Query: 85  KVREHIETEKSKTNDSMLKQIEMISGFSL 113
           KVREHIE   S+TN  MLKQ+E++SGFSL
Sbjct: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 62.4 bits (150), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 58/90 (64%), Gaps = 4/90 (4%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIP-TLLKEASKQDLDKKK--TRSTLEAEELVKDQARD 83
           IS ++ K+ K QVE+LNK  E ++P  +L    K++L KK    +S L A  L++DQ +D
Sbjct: 31  ISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKD 89

Query: 84  SKVREHIETEKSKTNDSMLKQIEMISGFSL 113
            ++R  I  E+  T+DS+ KQIEMISGF+ 
Sbjct: 90  KEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 61.6 bits (148), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 8/90 (8%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTR---STLEAEELVKDQARD 83
           I  ++ KRT++QVE+LNK        LL + +  +    KT+    TL+A+ L +DQ +D
Sbjct: 21  IKKSQKKRTRIQVEQLNKQE-----FLLSDLNMTNAGSTKTKEKPKTLQAKALAQDQKKD 75

Query: 84  SKVREHIETEKSKTNDSMLKQIEMISGFSL 113
            + R+ +E ++  TND+ML Q+EMISGFSL
Sbjct: 76  KETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 59.7 bits (143), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDSKV 86
           IS  + KR KLQVE++NK    +   +      ++L   K  +TL +++L KDQ +D  +
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKEL--AKNVNTLSSKQLKKDQEKDRLL 86

Query: 87  REHIETEKSKTNDSMLKQIEMISGFSL 113
              I+ +K +TND ++ QIEMISGFSL
Sbjct: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 57.8 bits (138), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 57/95 (60%), Gaps = 8/95 (8%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPT----LLKEASKQDLD----KKKTRSTLEAEELVK 78
           I  +E KR KLQVE+LN+ +  MI      +  E  K + +     +    +L+ E+L +
Sbjct: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91

Query: 79  DQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           D+++D  ++E +  ++ +T+ SML QIEMISGFSL
Sbjct: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 52/98 (53%), Gaps = 17/98 (17%)

Query: 27  ISTAEMKRTKLQVERLNK-----------SSETMIPTLLKEASKQDLDKKKTRSTLEAEE 75
           I  ++ K+ K++V   NK           +S++M P       KQ  D  +  S+L A +
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPI------KQKQDSLRKGSSLSAHD 85

Query: 76  LVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           L+ DQ +D +    I+TEK + ND ML+QIEMISGF  
Sbjct: 86  LLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 54.7 bits (130), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 58/91 (63%), Gaps = 7/91 (7%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPT----LLKEASKQDLDKKKTRSTLEAEELVKDQAR 82
           IS +E KR K+++E++NK  E ++P+    L  E      +  K R+ LE+++L +D  +
Sbjct: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERA-LESQKLQQDNVK 80

Query: 83  DSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           D +    IE  K +T+DSMLKQIE+++GFSL
Sbjct: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 56/91 (61%), Gaps = 8/91 (8%)

Query: 27  ISTAEMKRTKLQVERLNK----SSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQAR 82
           +S+   K TK +VE+LNK    SS+ +         K++    K  S LEA+ L KD  +
Sbjct: 30  LSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKRE----KQTSVLEAKTLAKDNLK 85

Query: 83  DSKVREHIETEKSKTNDSMLKQIEMISGFSL 113
           D ++ E IE++K +TN S+L+QIEM+SGFSL
Sbjct: 86  DRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%)

Query: 25  RPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDS 84
           + IS  ++K+TK +VE LN+ + ++   +   AS       +  +TLE   L KD  +D 
Sbjct: 23  KAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQ 82

Query: 85  KVREHIETEKSKTNDSMLKQIEMISGFSL 113
           K+RE  + EK +  +++ KQIE ISGFSL
Sbjct: 83  KIREKSKAEKEEMANNLEKQIEDISGFSL 111

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 54/83 (65%), Gaps = 9/83 (10%)

Query: 34  RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEA---EELVKDQARDSKVREHI 90
           RTKL+VE+ NK        L+ E +K++ D K+  S LE+     LVKD  +D   ++ +
Sbjct: 29  RTKLKVEQANKEV-----FLISELNKRE-DTKRQSSPLESLKPSRLVKDIKKDQNAQKQL 82

Query: 91  ETEKSKTNDSMLKQIEMISGFSL 113
           E+++  T++++L+Q+E+ISGFSL
Sbjct: 83  ESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 54/83 (65%), Gaps = 9/83 (10%)

Query: 34  RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEA---EELVKDQARDSKVREHI 90
           RTKL+VE+ NK        L+ E +K++ D K+  S LE+     LVKD  +D   ++ +
Sbjct: 29  RTKLKVEQANKEV-----FLISELNKRE-DTKRQSSPLESLKPSRLVKDIKKDQNAQKQL 82

Query: 91  ETEKSKTNDSMLKQIEMISGFSL 113
           E+++  T++++L+Q+E+ISGFSL
Sbjct: 83  ESQRKATDENVLRQLELISGFSL 105

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 58/82 (70%), Gaps = 7/82 (8%)

Query: 34  RTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRS--TLEAEELVKDQARDSKVREHIE 91
           RTKL+VE+ NK S      L+ E ++++ + K+T +  +L+  +L++D+ +D  +++ +E
Sbjct: 28  RTKLKVEQANKES-----FLISELNEREHNTKRTPALESLKVSDLIEDREKDKSMQKKME 82

Query: 92  TEKSKTNDSMLKQIEMISGFSL 113
            +K  T++++++Q+E+ISGFSL
Sbjct: 83  EQKQSTDNNIIEQLELISGFSL 104

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 53/88 (60%), Gaps = 3/88 (3%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPT-LLKEASKQDLDKKKTRSTLEAEELVKDQARDSK 85
           IS ++ KRTK +VE+L+  ++ ++P+ + K             S+L A  L +D+  D  
Sbjct: 27  ISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQDRKMDQD 84

Query: 86  VREHIETEKSKTNDSMLKQIEMISGFSL 113
            R+    +K +T++++L+QIEMISGFSL
Sbjct: 85  TRDKANAKKKETDNNILQQIEMISGFSL 112

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 7/87 (8%)

Query: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDSKV 86
           IS A+ KR KLQVE+L+K        +L           KT   L+A  L +DQ  D++ 
Sbjct: 22  ISKADKKRAKLQVEKLDKRG------VLLAELTAAAPAAKT-GVLQAASLAQDQRSDAQA 74

Query: 87  REHIETEKSKTNDSMLKQIEMISGFSL 113
           ++    E+S  +  +++Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 37  LQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSK 96
           +QV +L+K   ++   +  +A K    K ++ ++LE +++ +    D +V +  + EK  
Sbjct: 44  MQVRQLDKLDLSIADIVPNKAQK----KPRSSASLEGQKVREHYKEDKEVVKKHDKEKKA 99

Query: 97  TNDSMLKQIEMISGFSL 113
           T   +  Q+E+ISGFSL
Sbjct: 100 TEKKIEDQLELISGFSL 116

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  QDLDKKKTRSTL--EAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMIS 109
           Q+L +KK RS L  E ++L K +    KVREH+ET   +     +K  ++I+
Sbjct: 645 QNLKRKKNRSLLPEEIQKLNKLKEVGEKVREHLETVAGRPKGKSMKPYDIIA 696

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score = 27.7 bits (60), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 31  EMKRTKLQVERLNKSSE--TMIPTLLKEASKQDLDKKKTRSTLEAEE 75
           E+++TKLQ + LN SS+  T+   L KE  +  +D K   S +EA E
Sbjct: 854 ELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.119    0.292 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,977,233
Number of extensions: 271040
Number of successful extensions: 2287
Number of sequences better than 10.0: 187
Number of HSP's gapped: 2270
Number of HSP's successfully gapped: 191
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 59 (27.3 bits)