Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1531.6ON31631614610.0
YCL059C (KRR1)1.6ON31631614290.0
Smik_3.151.6ON31631614220.0
Skud_3.41.6ON31631614010.0
NCAS0B091001.6ON32731213410.0
NDAI0A001501.6ON31731513300.0
SAKL0C00484g1.6ON33931213130.0
CAGL0B00352g1.6ON33731513040.0
KNAG0C002301.6ON34931112990.0
Kwal_33.130111.6ON33431112951e-180
Kpol_2002.91.6ON33831212861e-179
Ecym_10091.6ON33631212781e-178
KLLA0C00506g1.6ON33031112751e-177
TPHA0E040001.6ON31631112621e-176
KLTH0F00506g1.6ON33231112571e-175
TDEL0C069601.6ON35031212441e-172
ZYRO0F18458g1.6ON31431212311e-171
KAFR0D001501.6ON34430912341e-171
TBLA0A049401.6ON31631212231e-170
AFR744W1.6ON34331312071e-167
ZYRO0D11440g5.482ON2691681013e-04
NCAS0A119605.482ON2701931013e-04
KLTH0G02574g5.482ON2711621013e-04
SAKL0G03740g5.482ON266146995e-04
TDEL0A034605.482ON272146996e-04
Kpol_543.135.482ON268146987e-04
Suva_8.1975.482ON274148987e-04
Ecym_45525.482ON271146987e-04
Kwal_47.188645.482ON271146988e-04
Skud_15.3105.482ON276176950.002
CAGL0K09460g5.482ON261146950.002
KLLA0C06446g5.482ON274162950.002
TPHA0J028205.482ON268146940.003
YOR145C (PNO1)5.482ON274176940.003
KAFR0E036005.482ON276146930.003
Smik_15.3265.482ON274148920.004
KNAG0C046105.482ON277176920.004
NDAI0A043105.482ON274146910.006
TBLA0D018905.482ON271163870.019
AAR002W1.420ON178163810.063
Suva_2.5945.523ON63186750.76
KAFR0B030308.309ON46754721.5
AGL183C8.309ON50724702.9
Ecym_35923.86ON90045703.0
KLTH0E14014g8.798ON48699693.4
CAGL0F04983g6.73ON59593693.8
KNAG0G023508.309ON49724685.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.153
         (316 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   567   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   555   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   552   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   544   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   521   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   516   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   510   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   506   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   504   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   503   e-180
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   499   e-179
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   496   e-178
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   495   e-177
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   490   e-176
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   488   e-175
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   483   e-172
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   478   e-171
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   479   e-171
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   475   e-170
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   469   e-167
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    44   3e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    44   3e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    44   3e-04
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    43   5e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    43   6e-04
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    42   7e-04
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    42   7e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    42   7e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    42   8e-04
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    41   0.002
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    41   0.002
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    41   0.002
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    41   0.003
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    41   0.003
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    40   0.003
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    40   0.004
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    40   0.004
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    40   0.006
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    38   0.019
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    36   0.063
Suva_2.594 Chr2 (1054727..1056622) [1896 bp, 631 aa] {ON} YDR419...    33   0.76 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   1.5  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.9  
Ecym_3592 Chr3 complement(1121639..1124341) [2703 bp, 900 aa] {O...    32   3.0  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   3.4  
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...    31   3.8  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.6  

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/316 (87%), Positives = 278/316 (87%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLN                  
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 301 XNFVAPQEEAYKPNNN 316
            NFVAPQEEAYKPNNN
Sbjct: 301 KNFVAPQEEAYKPNNN 316

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/316 (85%), Positives = 276/316 (87%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDTDD+DKW IEEFKEEDNASGQPFAEESSFMTLFPKYRE+YLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLN                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 301 XNFVAPQEEAYKPNNN 316
            +F+AP+EEAYKPN N
Sbjct: 301 KDFIAPEEEAYKPNQN 316

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/316 (84%), Positives = 275/316 (87%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDTDD+DKW IEEFKEEDNASGQPFAEESSFMTLFPKYRE+YLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKL+                  
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 301 XNFVAPQEEAYKPNNN 316
            +F+AP+EE YKPN N
Sbjct: 301 KDFIAPEEETYKPNQN 316

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/316 (83%), Positives = 273/316 (86%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNR+KPWDTDD+DKW IEEFKEEDN SGQPFAEESSFMTLFPKYRE YLKTIWNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSKR+KQ+KKLN                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 301 XNFVAPQEEAYKPNNN 316
            +F AP+EE+YKP+ N
Sbjct: 301 KDFTAPEEESYKPSKN 316

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/312 (81%), Positives = 266/312 (85%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDT DVDKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK+MKKL+                  
Sbjct: 240 VRKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERN 299

Query: 301 XNFVAPQEEAYK 312
            N++AP+EE YK
Sbjct: 300 KNYIAPEEETYK 311

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/315 (79%), Positives = 267/315 (84%), Gaps = 1/315 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDT++++KW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ HN++CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK+MKKLN                  
Sbjct: 240 VKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERN 299

Query: 301 XNFVAPQEEAYKPNN 315
            ++VAP E  YK +N
Sbjct: 300 KDYVAPSEPTYKSSN 314

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/312 (78%), Positives = 263/312 (84%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           M STHN+DKPWDT ++DKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I+C LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 301 XNFVAPQEEAYK 312
            ++VAP+E  YK
Sbjct: 301 KDYVAPEEAEYK 312

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 266/315 (84%), Gaps = 1/315 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVST+N+DKPWDT+D+DKW IEEFK EDN SGQPFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMF-KKRNVARKKPSK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDL+IESGEYFLSK+EK++KKL+                  
Sbjct: 240 VKAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299

Query: 301 XNFVAPQEEAYKPNN 315
            +++AP+E+ YK ++
Sbjct: 300 KDYIAPKEDEYKSSH 314

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 261/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN+DKPWDTDD+DKW IEEFK EDNASGQPFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALD H+I+C LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFL+K+EKQ KKL                   
Sbjct: 240 IKKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299

Query: 301 XNFVAPQEEAY 311
            ++ AP+E+AY
Sbjct: 300 KDYTAPKEKAY 310

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  503 bits (1295), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/311 (77%), Positives = 259/311 (83%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           M STHN+DKPWDT D+DKW IEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+ISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRP+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPP Q PRKVDL+IESGEYFLSK+EK+ KKL+                  
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 301 XNFVAPQEEAY 311
            ++VAP E+ Y
Sbjct: 301 KDYVAPSEKEY 311

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  499 bits (1286), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/312 (77%), Positives = 261/312 (83%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN+DKPWDT+D+DKW +EEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDK +I+C LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMF-KKRNVARKKAAK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRKVDLEIESGEYFLSK+EK++K+L                   
Sbjct: 240 PKKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERS 299

Query: 301 XNFVAPQEEAYK 312
            ++VAP EE YK
Sbjct: 300 KDYVAPMEEEYK 311

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/312 (77%), Positives = 262/312 (83%), Gaps = 2/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN+DKPWDT D+DKW IEEFK EDNASG PFAEESSFMTLFPKYRE YLK+ WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+++C L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF--KKRNIARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK EK+MKKL                   
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298

Query: 301 XNFVAPQEEAYK 312
            +++AP E+ YK
Sbjct: 299 EDYIAPDEKEYK 310

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 261/311 (83%), Gaps = 2/311 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN+DKPWDTD+VDKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+LD H+I+C L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF--KKRNVARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 +YTPFPPAQLPRKVDLEIESGEYFLSKREK++KKL+                  
Sbjct: 239 KIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERA 298

Query: 301 XNFVAPQEEAY 311
            +F+AP+E  Y
Sbjct: 299 KDFIAPKETDY 309

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  490 bits (1262), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/311 (75%), Positives = 261/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN++KPWDT+D+DKW +E+FK EDNASG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDKH+++C L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKSKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPP+QLPRKVDLEIESGEYFLSK+EK++K+L+                  
Sbjct: 240 PKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299

Query: 301 XNFVAPQEEAY 311
            N++AP+EE Y
Sbjct: 300 KNYIAPKEEKY 310

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  488 bits (1257), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 259/311 (83%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           M STHN+DKPWDT D+DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRK+DL+IESGEYFL+K+EK+ KKL                   
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 301 XNFVAPQEEAY 311
            ++VAP E+ Y
Sbjct: 301 KDYVAPIEKGY 311

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/312 (75%), Positives = 258/312 (82%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDT+D+DKW +EEFK EDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ H+I+CVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRK+DLEIESGEYFLSK+EK++ KL                   
Sbjct: 240 IRAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARS 299

Query: 301 XNFVAPQEEAYK 312
            +++AP+E+ YK
Sbjct: 300 KDYIAPKEDVYK 311

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 256/312 (82%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHN+DKPWDT ++DKW  +EFKEEDNASG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K++++CVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKRELAKRPELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNF-KKRNVARKKPMK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQ PRKVDLEIESGEYFL+KREK+ KKL                   
Sbjct: 240 IRKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERR 299

Query: 301 XNFVAPQEEAYK 312
            +F+ P+EE YK
Sbjct: 300 KDFLPPKEEDYK 311

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  479 bits (1234), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 239/309 (77%), Positives = 263/309 (85%), Gaps = 1/309 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVST+N++KPWDT+D+DKW  EEFK EDNASG PFAEESSFMTLFPKYRE+YLK++W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KH+I+C+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPP QLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 240 IRKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERK 299

Query: 301 XNFVAPQEE 309
            N++AP+EE
Sbjct: 300 KNYIAPKEE 308

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  475 bits (1223), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/312 (75%), Positives = 260/312 (83%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVSTHNRDKPWDT D++KW I+EFK EDNASG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++LDK++++C LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMF-KKRNVARKKSKK 239

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIESGEYFLSK+EK++KKL                   
Sbjct: 240 PKKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERR 299

Query: 301 XNFVAPQEEAYK 312
            +F+AP E+ YK
Sbjct: 300 KDFIAPSEKEYK 311

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  469 bits (1207), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 235/313 (75%), Positives = 256/313 (81%), Gaps = 2/313 (0%)

Query: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60
           MVST N+DKPWDT DVDKW IEEF  ED+ASG PFAEESSFMTLFPKYRE YLK+IW +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+C L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF--KKRNVARKKPK 238

Query: 241 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNXXXXXXXXXXXXXXXXXX 300
                 VYTPFPPAQLPRKVDLEIE+GEYFLSK+EK+ KKL                   
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERA 298

Query: 301 XNFVAPQEEAYKP 313
            +++AP E  Y P
Sbjct: 299 KDYIAPAEPEYSP 311

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 76/168 (45%), Gaps = 5/168 (2%)

Query: 24  FKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTV 82
           F     +SG+    ES  + + P +R   L+  W  +   L +H  +   ++L   S+ +
Sbjct: 76  FGSAKKSSGERVKIESRKVGV-PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVEL 134

Query: 83  KTT-RKTYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFV 139
           ++  R+T DP  + K  D IK          ++ +L+ DD+  +  ++ +  T N +   
Sbjct: 135 RSHPRQTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLS 194

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++    +  +G F  ++  R  V
Sbjct: 195 RAIGRIAGKDGKTKFAIENATRTRIVLADAKIHILGGFTHIRMAREAV 242

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 4   THNRDKPWDTDDVDKWTIEE-----FKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWN 58
           TH+  +P    +     ++E     F   + A G     ES  + + P +R   L+  W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKI 116
            +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK          ++ +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAM 174
           L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+  I++    +  +
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPFKGLKEVRRVV 187
           G F  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 30  ASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK- 87
           ASG+   +  S     P +R   L+  W  +   L  H  +   ++L   ++ ++T  K 
Sbjct: 83  ASGEMKVKPESRKVPVPPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKH 142

Query: 88  TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRL 145
           T DP  + K  D IK          A+ +L+ DD+  +  +I +  T N +   +   R+
Sbjct: 143 TTDPGALQKGADFIKAFTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRI 202

Query: 146 VGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
            G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 203 AGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 244

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 75/176 (42%), Gaps = 5/176 (2%)

Query: 16  VDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLD 74
           VD      F     + G     ES  + + P +R   L+  W  +   L +H  +   ++
Sbjct: 75  VDDQGKPRFSSASRSQGSKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 133

Query: 75  LVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFV 132
           L   S+ ++T  K T DP  + K  D IK          ++ +L+ DD+  +  ++ +  
Sbjct: 134 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 193

Query: 133 T-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T   +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 194 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 249

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  WN +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 72/162 (44%), Gaps = 4/162 (2%)

Query: 30  ASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTT-RK 87
           +S Q   +  S     P +R   LK  W+ +   L  H  +   ++L   S+ ++T  + 
Sbjct: 86  SSAQTKVKLESRKVSVPPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKH 145

Query: 88  TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVTNKERFVKRR-QRL 145
           T DP  + K  D IK          ++ +L+ DD+  +  +I +  T +   + R   R+
Sbjct: 146 TTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRI 205

Query: 146 VGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
            G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 206 AGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W+ +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 74/176 (42%), Gaps = 5/176 (2%)

Query: 16  VDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLD 74
           VD      F       G     ES  + + P +R   L+  W  +   L +H  +   ++
Sbjct: 73  VDDQGKPRFTSASKTQGNKIKFESRKI-MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMN 131

Query: 75  LVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFV 132
           L   S+ ++T  K T DP  + K  D IK          ++ +L+ DD+  +  ++ +  
Sbjct: 132 LKTKSVELRTNPKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 191

Query: 133 T-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T   +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 192 TLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 77/176 (43%), Gaps = 5/176 (2%)

Query: 16  VDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLD 74
           +D+     F   + AS      ES  + + P +R   L+  W  +   L  H  +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMTVKTTRK-TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFV 132
           L   S+ ++T  K T DP  + K  D IK          ++ +L+ DD+  +  ++ +  
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 133 T-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T + +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 70/163 (42%), Gaps = 4/163 (2%)

Query: 29  NASGQPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKH-NISCVLDLVEGSMTVKTTRK 87
           N S Q   +  S     P +R   L+  W  +   L  H  +   ++L   S+ ++T  K
Sbjct: 82  NKSKQTKVKLESRKVAVPPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPK 141

Query: 88  -TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQR 144
            T DP  + K  D IK          ++ +L+ DD+  +  ++ +  T   +   +   R
Sbjct: 142 HTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGR 201

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           + G +G T  A+E  T+  I++  + +  +G F  ++  R  +
Sbjct: 202 IAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESI 244

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 35.8 bits (81), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 66/163 (40%), Gaps = 35/163 (21%)

Query: 54  KTIWNDVTRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           + +W +V RAL +   +    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPE 214
            + G +K L  +      CM  V  I HI ++  + + A+ P+
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ 133

>Suva_2.594 Chr2 (1054727..1056622) [1896 bp, 631 aa] {ON} YDR419W
           (REAL)
          Length = 631

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 46  PKYRENYLKTIWNDVTRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLA 105
           P++R+  L T W+DV  AL       V D ++ S+   T+        + K       LA
Sbjct: 224 PEHRD--LITDWDDVVLALGSQITKGVRDTIKDSLGYTTSCGVSSTKNVCK-------LA 274

Query: 106 RSVPFPQAVKILQDDMACDVIKIGNF 131
            +   P A  I+++D  CD +  G F
Sbjct: 275 SNYKKPDAQTIVKNDCLCDFLDCGKF 300

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLH 199

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>Ecym_3592 Chr3 complement(1121639..1124341) [2703 bp, 900 aa] {ON}
           similar to Ashbya gossypii AFR341C
          Length = 900

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 29/45 (64%)

Query: 33  QPFAEESSFMTLFPKYRENYLKTIWNDVTRALDKHNISCVLDLVE 77
           Q +  ES F  +FP +R+ + KT   ++ ++L KHNI+ + ++++
Sbjct: 848 QDYQFESFFEIIFPIFRKYHQKTTQQEIKKSLLKHNINEIENIIK 892

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {ON}
           highly similar to uniprot|Q06218 Saccharomyces
           cerevisiae YLR276c DBP9
          Length = 595

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 12/93 (12%)

Query: 1   MVSTHNRD--KPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMT--LFPKYRENYLKTI 56
           +++T + D  K +D +  D   +EE  +E N      AEES+  T  +  K + NY +  
Sbjct: 324 LIATDDADNIKEFDDEQKDDIQVEEKNDETNTV---VAEESTNSTTGIKSKTKNNYKQDK 380

Query: 57  WNDVTRALDKHNISCVLDLVEGSMTVKTTRKTY 89
              V+R +D  N++CV++       + TT K Y
Sbjct: 381 EYGVSRGVDFKNVACVVNF-----DLPTTAKAY 408

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,279,816
Number of extensions: 1201538
Number of successful extensions: 3516
Number of sequences better than 10.0: 52
Number of HSP's gapped: 3600
Number of HSP's successfully gapped: 52
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)