Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1521.5ON1140114052200.0
Skud_3.31.5ON1152115631570.0
Smik_3.141.5ON1113113428960.0
YCL061C (MRC1)1.5ON1096112528930.0
KAFR0D001401.5ON1041116611701e-141
NCAS0B091101.5ON10204148115e-91
SAKL0C00462g1.5ON11773967921e-87
NDAI0A001401.5ON10913957812e-86
KNAG0C002201.5ON11613557593e-83
Kpol_2002.81.5ON9854147303e-80
TPHA0E040101.5ON9653916976e-76
ZYRO0F18480g1.5ON9604896127e-65
CAGL0B00330g1.5ON11363866151e-64
TBLA0A075701.5ON12523945778e-60
TDEL0C069701.5ON9413865639e-59
KLLA0C00484g1.5ON9253845326e-55
Ecym_10081.5ON11183915322e-54
AFR745W1.5ON10183905034e-51
KLTH0F00484g1.5ON9933634552e-45
Kwal_33.130051.5ON9703904044e-39
Kpol_1024.318.560ON857135762.9
Smik_4.3788.299ON49488763.0
ZYRO0B03828g7.412ON72771736.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.152
         (1140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...  2015   0.0  
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...  1220   0.0  
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...  1120   0.0  
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...  1118   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   455   e-141
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   317   5e-91
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   309   1e-87
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   305   2e-86
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   296   3e-83
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   285   3e-80
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   273   6e-76
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   240   7e-65
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   241   1e-64
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   226   8e-60
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   221   9e-59
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   209   6e-55
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   209   2e-54
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   198   4e-51
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   179   2e-45
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   160   4e-39
Kpol_1024.31 s1024 (90996..93569) [2574 bp, 857 aa] {ON} (90996....    34   2.9  
Smik_4.378 Chr4 complement(680000..681484) [1485 bp, 494 aa] {ON...    34   3.0  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    33   6.4  

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score = 2015 bits (5220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1007/1140 (88%), Positives = 1007/1140 (88%)

Query: 1    MEKYYFEARLLNIIFKASHVTIISKTSKQTYYPISTQHHILSTMDDALNALSSLTSKKRA 60
            MEKYYFEARLLNIIFKASHVTIISKTSKQTYYPISTQHHILSTMDDALNALSSLTSKKRA
Sbjct: 1    MEKYYFEARLLNIIFKASHVTIISKTSKQTYYPISTQHHILSTMDDALNALSSLTSKKRA 60

Query: 61   TTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQD 120
            TTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQD
Sbjct: 61   TTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQD 120

Query: 121  GQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVSSFTQTQRIPVSITQQNN 180
            GQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVSSFTQTQRIPVSITQQNN
Sbjct: 121  GQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVSSFTQTQRIPVSITQQNN 180

Query: 181  EINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQI 240
            EINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQI
Sbjct: 181  EINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQI 240

Query: 241  PPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQSPSTQMNTPPPTVHDDR 300
            PPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQSPSTQMNTPPPTVHDDR
Sbjct: 241  PPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQSPSTQMNTPPPTVHDDR 300

Query: 301  TQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESF 360
            TQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESF
Sbjct: 301  TQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESF 360

Query: 361  LADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYAN 420
            LADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYAN
Sbjct: 361  LADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYAN 420

Query: 421  NLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQ 480
            NLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQ
Sbjct: 421  NLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQ 480

Query: 481  NQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVED 540
            NQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVED
Sbjct: 481  NQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVED 540

Query: 541  LLEQEILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFALSDNEIADYELSGS 600
            LLEQEILR                                   KFALSDNEIADYELSGS
Sbjct: 541  LLEQEILRNKKIRQKEKKKEELENNGFKLNSHDSDSDSGSESSKFALSDNEIADYELSGS 600

Query: 601  XXXXXXXXXXXXXXXXNITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAID 660
                            NITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAID
Sbjct: 601  ENEKGGDTDDGEEEDDNITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAID 660

Query: 661  LGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTKXXXXXXXXXXXXXXXXXXXXXXXXX 720
            LGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTK                         
Sbjct: 661  LGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTKTTEHEDDEGEEEKEETDDNDDDDDN 720

Query: 721  XXXXXXXXVSEAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVTNFFXXXXXXXXXXWH 780
                    VSEAIRRELID             ATKLKELKSKGVTNFF          WH
Sbjct: 721  DDDDNDDEVSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWH 780

Query: 781  GVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNG 840
            GVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNG
Sbjct: 781  GVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNG 840

Query: 841  GFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESM 900
            GFRNKRAKN            VLQQY              IGDDTKLVKNPKSKAFFESM
Sbjct: 841  GFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESM 900

Query: 901  VEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLII 960
            VEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLII
Sbjct: 901  VEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLII 960

Query: 961  SEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNS 1020
            SEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNS
Sbjct: 961  SEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNS 1020

Query: 1021 LSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVK 1080
            LSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVK
Sbjct: 1021 LSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVK 1080

Query: 1081 ISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140
            ISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFDS
Sbjct: 1081 ISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score = 1220 bits (3157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1156 (59%), Positives = 804/1156 (69%), Gaps = 49/1156 (4%)

Query: 9    RLLNIIFKASHVTIISKTSKQTYYPISTQHHILSTMDDALNALSSLTSKKRATTYKKVAS 68
            R+ +I+  AS  T + KTSK+  +PI T     STMD+ L  LSSLTSKKR TTYKK+AS
Sbjct: 22   RVCSIVVDASSKTNL-KTSKRVSHPILTGIIKFSTMDNVLEVLSSLTSKKRVTTYKKIAS 80

Query: 69   PILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQDGQDKENED 128
            PI D + D DG+L  + M APPALTGNGFLFGNATLNRVKNRLEG +    D Q K+NE+
Sbjct: 81   PIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNEN 140

Query: 129  EDVFSTQLIANLYDGGEELE-SKSNGDKNNQKVNVSSFTQTQRIPVSITQQNNEINVPIH 187
            ED  STQLIANLYDGGE+LE +KS GD  + K  +++FTQTQRIPVSI Q  N ++VPIH
Sbjct: 141  EDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGIAAFTQTQRIPVSI-QSENVVDVPIH 199

Query: 188  SINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSE 247
            SIN+G+  +  ++ G   T +QTQ I   TA+I    TQ +++    SQTQQ+P TKP E
Sbjct: 200  SINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRIHSRDTASQTQQVPFTKPIE 259

Query: 248  AQTQADVATANDSDTQQ-KVPMLTTETSPLFQTVPDQSPS---------------TQMNT 291
             QTQ    TANDSDTQ  ++P+LT E S LFQT PD  P+               TQ++T
Sbjct: 260  PQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDT 319

Query: 292  PPPTVHDD-RTQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIP 350
               T HD+ +TQ+DT+ QT+ D V  TLKI ELQSELALED  R+KA+N EY+K ++ IP
Sbjct: 320  MTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALEDSKREKARNVEYKKSRRNIP 379

Query: 351  IVKRFSKESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDK 410
             +  FSKESFLADFDNSSSDE T+ +LE SQ KQQQ+  E+ +   S P   +   +  K
Sbjct: 380  TMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYK 439

Query: 411  KVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATI 470
             VPLLS+YANNLKREIDSSKCI LDLDS SD D D++M  +   +DESALPIS+LSKA I
Sbjct: 440  NVPLLSSYANNLKREIDSSKCIILDLDSDSDDDGDDYMGGNMSIKDESALPISRLSKAAI 499

Query: 471  FNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLED 530
             NLKARLSKQ+Q L Q  NKNK  K DHNKL N LRKASRKQILDHQRE++ETKGFKLED
Sbjct: 500  LNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLED 559

Query: 531  MVKEKEIVEDLLEQEILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFALSDN 590
            M KEKEIVE+LLEQEILR                                   KF +SDN
Sbjct: 560  MAKEKEIVENLLEQEILR-------NRRIRQKEKEKEKLENKDSGSDSGSESSKFEMSDN 612

Query: 591  EIADYELSGSXXXXXXXXXXXXXXXXN-----ITNKKKPYRTKHILDESDSEVEDEQKME 645
            EIA+YELS S                      + NKKK Y  KH+++ESDSE+E EQKM+
Sbjct: 613  EIANYELSSSESEKNKNSDDEQEEEEEEEEDIVLNKKKSYHVKHVINESDSEIETEQKMK 672

Query: 646  VEKNVENVPKRNAIDLGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTKXXXXXXXXXX 705
            V K  +  PKRNAIDLGHYG+NID + SNSF+ A  L+TQ++  I  +T           
Sbjct: 673  VSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIKT----------- 721

Query: 706  XXXXXXXXXXXXXXXXXXXXXXXVSEAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVT 765
                                   VSEAIRRELID               +LKE KSKG+T
Sbjct: 722  ----HTIENREEEEVENDSIDEEVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGIT 777

Query: 766  NFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEM 825
            NFF          WHGVGGADGEGS+EYDSEVEKMIDDYSKN FNSHEIREMLAAENKEM
Sbjct: 778  NFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEM 837

Query: 826  DVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDT 885
            DVKMIN+ILYDIKNGGFRNKRAKN            VLQQY              IGDDT
Sbjct: 838  DVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDT 897

Query: 886  KLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNN 945
            KLVKNPKSKAFFESMVEDIMEFKNPF AE+ES QD+TSTATDLDTQDND+ + GD+T NN
Sbjct: 898  KLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNN 957

Query: 946  EHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLK 1005
            EH + V D+SKK IISEDFVQKSLSFL+SNNYDEFEMD+E ARIQH  G+  V DLFTLK
Sbjct: 958  EH-RRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLK 1016

Query: 1006 QHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASR 1065
            QHSSIKSFTNS T+SLSS+ +N++I+LE+ TE N+E EN D SLIGGFKHPS+IKSFASR
Sbjct: 1017 QHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASR 1076

Query: 1066 TDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKS-K 1124
            TDINDKFKEGNKTVKISK+YKTVGSSKASITYMGKTRKLMAPK+K + +HH NH  K+ K
Sbjct: 1077 TDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWK 1136

Query: 1125 TQKSKLFENGQDSFDS 1140
            TQKSKLFE+GQDSFDS
Sbjct: 1137 TQKSKLFESGQDSFDS 1152

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/1134 (57%), Positives = 769/1134 (67%), Gaps = 58/1134 (5%)

Query: 44   MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
            MDDALNALSSL SKKR TTYKKVA  I D+N +TDGNL  + + APPALTGNGFLF NAT
Sbjct: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 104  LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELE-SKSNGDKNNQKVNV 162
            LNRVKNRLEG     Q+  +K++EDEDV S+QLIANLY+GGE+LE +KSN +    K  +
Sbjct: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120

Query: 163  SSFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQ 222
             +FTQTQRIPVSI QQ+  ++VPIHS+NE +PTQ  K+   V    Q Q +  TT  I  
Sbjct: 121  PTFTQTQRIPVSI-QQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTT--IKP 177

Query: 223  KTTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDTQQ-KVPMLTTETSPLFQTVP 281
              TQ +++    +Q+QQ  P KP E+ +Q   AT+ND D Q  K P+LT   SPLFQ + 
Sbjct: 178  VATQRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLL 237

Query: 282  DQSPSTQMNTP------------------------------PPTVH-DDRTQMDTVAQTM 310
             + P  QM+TP                              P T H +D+TQMDT++QT+
Sbjct: 238  TRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTL 297

Query: 311  QDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSD 370
            QD VP TLKI E+Q+ELALED  R++A N EY K QKTI    +FSKESFLADFD+SSS+
Sbjct: 298  QDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357

Query: 371  EDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSK 430
            ED   K+ES+ PK   N  E+ +     P   E   K DK+VPLLS+YANNLKREIDSSK
Sbjct: 358  EDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSK 417

Query: 431  CITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNK 490
            CITLDLDSGSD D++  +D  KL +DE ALPISQLSKATI NLKARLSKQNQ ++Q   +
Sbjct: 418  CITLDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE 477

Query: 491  NKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRXX 550
             +D + DHNKL NTLRKASRKQILDHQRE++ETKGFKLEDMVKEKE+VE+LLEQEI+R  
Sbjct: 478  GRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQEIIRNK 537

Query: 551  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFALSDNEIADYELSGSXXXXXXXXXX 610
                                             KFALS NE+ DYELSGS          
Sbjct: 538  KIRQKEKRREKLENSEFKLSPHDSGSDSGSESSKFALSGNEVTDYELSGSEDEIREEPDN 597

Query: 611  XXXXXXN--ITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNI 668
                  +  +  KKK +  K ++DESDSE E   K +V+    +VPKR AI+LGHYG+NI
Sbjct: 598  EEEEEEDDIVPKKKKAHHVKRMIDESDSENEAVPKEKVDA---SVPKRIAINLGHYGDNI 654

Query: 669  DVDGSNSFQAAIVLDTQQVGEITTQTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 728
            + +  N FQ    ++TQQ  +IT +                                   
Sbjct: 655  E-EEVNKFQETNDMNTQQTDKITME-----------RNIVENKAILEDTAVVDEDNINEE 702

Query: 729  VSEAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGE 788
              EAIRRELID             A KLKELK KGVTNFF          WHG+GGADGE
Sbjct: 703  ADEAIRRELIDKEKLQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGE 762

Query: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 848
            GSDEYDS+VEKMIDDYSKN FNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK
Sbjct: 763  GSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 822

Query: 849  NXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFK 908
            N            VLQQY              IGD TKLVKNPKSKAFFESMVEDIME+K
Sbjct: 823  NSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYK 882

Query: 909  NPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKS 968
            NPF AE+ES+QD+TSTATDLDT DN++    D+T NNE    V DKSKK+IISEDFVQKS
Sbjct: 883  NPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGP-VDDKSKKIIISEDFVQKS 941

Query: 969  LSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNT 1028
            LSFLKSNNY+EFEMD+ELA++QHGN +  + DLFTLKQHSSIKSFTNSQT+S +SRT+ T
Sbjct: 942  LSFLKSNNYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTT 1001

Query: 1029 VINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTV 1088
            +I+LE+ TE  DE ENGD SL+ GFKHPS++KSFASRTDINDKFKEGNKTVKISKSYK V
Sbjct: 1002 MIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMV 1061

Query: 1089 GSSKASITYMGKTRKLMAPKRK--TEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140
            GSSKASITYMGKTRKLMAPKRK  T++NHH +  KK+KT+ SKLFE+GQ+SFDS
Sbjct: 1062 GSSKASITYMGKTRKLMAPKRKAGTDQNHHRH--KKTKTKTSKLFESGQNSFDS 1113

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1125 (57%), Positives = 770/1125 (68%), Gaps = 59/1125 (5%)

Query: 44   MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
            MDDAL+ALSSLT+KKR TTYKKVA PILDEN +T+GN P D ++ PP LTGNGFLF NAT
Sbjct: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPND-IDNPPELTGNGFLFANAT 59

Query: 104  LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVS 163
            LNRVKNRLEG+    Q+  + ++  E+   TQLI+NLYDGGEELE     D +  + NVS
Sbjct: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119

Query: 164  S-FTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQ 222
            S FTQTQRIPVSI QQ+   NVPIHS+N+G+PTQ  K  G V  TSQ    P TT +   
Sbjct: 120  SSFTQTQRIPVSI-QQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGR--P 176

Query: 223  KTTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDT-QQKVPMLTTE---TSPLFQ 278
              TQ +++ GATSQTQ   P K  E Q+Q    ++N S+    K+P++ TE   TSPLFQ
Sbjct: 177  GATQRIDSSGATSQTQ---PIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQ 233

Query: 279  TVPDQSPSTQMNTPPPTVHDD----------------RTQMDTVAQTMQDKVPPTLKIHE 322
            ++ ++ P TQM+ PP T HD+                +TQ+DTVAQT+QD+VP TLKI E
Sbjct: 234  SIQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIRE 293

Query: 323  LQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLESSQP 382
            +QSELA ED  R+KA+N EY+K QK IP  K FSKESFLADFD+SSS+ED + KLE++ P
Sbjct: 294  IQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKLENAHP 353

Query: 383  KQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDK 442
            K  QN  E+ +         ++    +K+VPLLS+YANNLKREIDSSKCITLDLDS SD+
Sbjct: 354  KPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDE 413

Query: 443  DNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLI 502
              D+ MD+ KL++DES LPISQLSKATI NLKARLSKQNQKL+Q  NK+KD K DHN L+
Sbjct: 414  YGDDDMDSIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLL 473

Query: 503  NTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRXXXXXXXXXXXXXX 562
            NTLRKASRKQILDHQ+E++ETKG KLEDM KEKEIVE+LLEQEILR              
Sbjct: 474  NTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKL 533

Query: 563  XXXXXXXXXXXXXXXXXXXXXKFALSDNEIADYELSGSXXXXXXXXXXXXXXXXNITNKK 622
                                  FALS NEIADYE SGS                 I  +K
Sbjct: 534  EENDFQLNAHDSGSDSGSESSGFALSGNEIADYESSGSENDNRRESDSEKEDDEIILKQK 593

Query: 623  KPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNIDVDGSNSFQAAIVL 682
            K +  KHI++ESDS+ E E K + EK  E++PKR AI+LGHYG+NI  D ++ FQ   VL
Sbjct: 594  KSHHVKHIINESDSDTEVEAKPK-EKADESLPKRIAINLGHYGDNIGED-TDKFQETNVL 651

Query: 683  DTQQVGEITTQTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEAIRRELIDXXX 742
            DTQ + E+  +                                     EAIRR+LID   
Sbjct: 652  DTQNIEEVMAE------------------RNTIENEVKDDVYVNEEADEAIRRQLIDKEK 693

Query: 743  XXXXXXXXXXATKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMID 802
                        K+KELK +GVTNFF          WHG+GGADGEGSD+YDS++EKMID
Sbjct: 694  LQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMID 753

Query: 803  DYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKN-XXXXXXXXXXXX 861
            DYSKN FN HEIREMLAAENKEMD+KMINKILYDIKNGGFRNKRAKN             
Sbjct: 754  DYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDD 813

Query: 862  VLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDV 921
            VLQQY              IGDD KLVKNPKS AFFESMVEDI+E+KNPFGAE+E + D+
Sbjct: 814  VLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDI 873

Query: 922  TSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFE 981
            TSTATDLDTQDN +   GDNT NNE  K V  K+KK+IISEDFVQKSLSFLKSNNY++FE
Sbjct: 874  TSTATDLDTQDN-SINVGDNTGNNEQ-KPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFE 931

Query: 982  MDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDE 1041
             D+EL+RIQHGN E  + DL+TLKQ+SSIKSFTNSQT+S +S+T+NT+I+LE+  E  DE
Sbjct: 932  TDKELSRIQHGNDEA-IEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDE 990

Query: 1042 GENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKT 1101
             ENGD SL+G FKHPS+IKSFASRTDINDKFKEGNKTVKI KSYKTVGSSKASITYMGKT
Sbjct: 991  VENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKT 1050

Query: 1102 RKLMAPKRKTEENHHPNH-------IKKSKTQKSKLFENGQDSFD 1139
            RKL+APKRKTE +H  +H         K+KT+ +KLFE+GQDSFD
Sbjct: 1051 RKLIAPKRKTEGSHRYHHDHHNKKMKMKTKTKSNKLFESGQDSFD 1095

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  455 bits (1170), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 402/1166 (34%), Positives = 568/1166 (48%), Gaps = 194/1166 (16%)

Query: 44   MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
            MD     L +L  KKR TTYKK++  +  EN  ++ N      N PPALTG GFLF N T
Sbjct: 1    MDGIFGNLQALKPKKR-TTYKKISDDL--ENDTSESN------NDPPALTGEGFLFDNPT 51

Query: 104  LNRVKNRLEGRNELGQDGQDKENEDEDV------FS-TQLIANLYDGGEELESKSNGDKN 156
            LNR+K RL+G             E++DV      FS TQLI+NLY GGE+L++     + 
Sbjct: 52   LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRE 98

Query: 157  NQKVNVSSFTQTQRIPV-----SITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQ 211
             Q+++      T++        + T+ +  IN     +   +PTQ   +       S   
Sbjct: 99   KQQLHEQQLELTKKRASKGQLHAFTKSSGNIN----DLRLMQPTQVIGSTQLAKEFSPVS 154

Query: 212  AIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQ----TQADVATANDSDTQQKVP 267
               F       ++TQ +  H AT    Q+   + ++ Q    TQ   A+       Q+  
Sbjct: 155  RTYFKYVPDVNQSTQVI--HSATQDDTQVVSAREADTQATQMTQVLSASTQGIYNTQETQ 212

Query: 268  MLTTETSPLFQTVPDQSPSTQMNTPPPTVHD--------------------DRTQMDT-- 305
             +T  T P+  +   Q   T      PT  D                    D+TQ DT  
Sbjct: 213  SITDSTQPISYSSSTQDYKTNKFNRHPTPEDTQIIPREFDDDASTLPIPEGDKTQKDTSA 272

Query: 306  VAQTMQDK----------VPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRF 355
            V +T  D           V  TLKIHE+Q EL   + ++K     EY++  +T   V  F
Sbjct: 273  VLKTQIDSTTEGTSYSATVSDTLKIHEIQREL---EESQKTKTIPEYKQHVRTPKNVIVF 329

Query: 356  SKESFLADFDN----------SSSDEDTNFKLESSQPKQQQN-GYEMIDISQSNP--QPA 402
            +KES+  +FD+          S  D      L+++ P  + N G  + D ++++P  +P 
Sbjct: 330  TKESYFDEFDSDDEEKEENLESEGDSQKVQLLKNTSPSDKSNDGKRLPDKTRTSPSFKP- 388

Query: 403  EKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPI 462
                    K+  L+ Y   LKR+++S + I L+LDS      D+    D++ E     PI
Sbjct: 389  --------KLHGLNNYELKLKRQLNSDQQIDLNLDS------DDEDGIDRMGE---KGPI 431

Query: 463  SQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVE 522
            SQ+SKAT+F++KARLSK+ + + + SN   D K+  + L N L+KASR+QI++HQ+E++E
Sbjct: 432  SQMSKATVFDIKARLSKK-RPIVKISN---DSKTTLHTLFNKLQKASRQQIIEHQKEVIE 487

Query: 523  TKGFKLEDMVKEKEIVEDLLEQEILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 582
             KG  LED+ KEK+IVE+LLEQEI R                                  
Sbjct: 488  KKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDLD-------- 539

Query: 583  XKFALSDNEIADYELSGSXXXXXXXXXXXXXXXXNITNKKKPYRTKHILDESDSEVEDEQ 642
              F  S NE+ + ELSG                      KK    K I+++SD+E+EDE+
Sbjct: 540  --FDHSANELDESELSGEESAIDSDNDYDDFSLEKTKRSKK----KVIVEDSDTEIEDEK 593

Query: 643  -----KMEVEKNVENVPKRNAIDLGHYGNNIDVDGSNSFQAAIVLDTQ-QVGEITTQTKX 696
                 ++  EK+      RNAI+LG YG+N+ +       A I + T+ Q G+       
Sbjct: 594  MSHNAQIREEKDDSLFQNRNAINLGPYGDNLSL-------APIRITTEKQSGK------- 639

Query: 697  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEAIRRELIDXXXXXXXXXXXXXATKL 756
                                            + E  R  LI+               K 
Sbjct: 640  -----------------NFKVSRESGDERDEEIPEKDRIRLIEEKKQHELERQRKQMKKR 682

Query: 757  KELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIRE 816
            KE+K+KG+TNF           WHG+GG DGE SDEYDSEVEKMIDDYSK  FN  EIR+
Sbjct: 683  KEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQ 742

Query: 817  MLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXX 876
            MLA ENKE D+KM+ KILYDIKNGGFR KR K              L+QY          
Sbjct: 743  MLADENKETDIKMVEKILYDIKNGGFR-KRRKGAMDLELSDEEDDELKQYRLKRRELMRQ 801

Query: 877  XXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNT 936
                +G+   LVKNPKSKAFFESMV+DI+E KNPF   +   Q   +  TD  TQ+N N+
Sbjct: 802  KRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEP--QRSGTITTDDGTQENANS 859

Query: 937  KPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-NYDEFEMDRELARIQHGNGE 995
              G  + N          SKK+++SE+FVQ++LSFL S+ + D+F   R +      N E
Sbjct: 860  NEGAASQN---------PSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMR--AEANDE 908

Query: 996  GDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENG-DQSLIGGFK 1054
              + DL  LK+ SSIKSF  ++  S+S          +E T+ + E ++  D  L     
Sbjct: 909  L-IEDLTALKKQSSIKSFKTTRA-SVS----------QEPTDFDKENDDSFDDLLNSRVG 956

Query: 1055 HPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEEN 1114
              S++K+F++  DINDKF+EG KTVK+SK+YK+V SSKASITYMGK RKL+AP++K   N
Sbjct: 957  TSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKV-AN 1015

Query: 1115 HHPNHIKKSKTQKSKLFENGQDSFDS 1140
               + IK + ++ SKLF    +SF+S
Sbjct: 1016 LSSSDIKNTNSRTSKLFSRQDESFES 1041

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  317 bits (811), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 197/414 (47%), Positives = 249/414 (60%), Gaps = 39/414 (9%)

Query: 729  VSEAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGE 788
            ++E  R  LI              A + KE+K KGV   F          WHG+GGADGE
Sbjct: 641  ITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEMEAEESEDEWHGIGGADGE 700

Query: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKN-GGFRNKRA 847
             SDEYDSEVEKMIDDYSK+ FN  EIR+MLA ENKEMD+ MI KILYDIKN G  + +R 
Sbjct: 701  VSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMITKILYDIKNGGFRKRRRG 760

Query: 848  KNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEF 907
                           L++Y              IGDD KL+KNPKSKAFFESMVEDI++ 
Sbjct: 761  GLDLELSDDDEDDEELREYHKRKRELMKKRMLEIGDDKKLIKNPKSKAFFESMVEDIVDE 820

Query: 908  KNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQK 967
            KN FG      + +  ++T+LDTQ+             E +   G   KK +ISE+FVQK
Sbjct: 821  KNAFG----DIESIEKSSTELDTQE-----------EKEQDVTPGVDKKKNVISEEFVQK 865

Query: 968  SLSFLKS-NNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTN-SQTNSLSSRT 1025
            +LSFL+S  + +EF ++ +LA+ QHG    +V DLF+LKQ S+IK F N SQTN++    
Sbjct: 866  TLSFLRSGRDLEEFNIEEDLAKEQHGE---NVEDLFSLKQRSTIKEFRNPSQTNTID--L 920

Query: 1026 MNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSY 1085
            +N V             EN + S +GGFK PSVIKSF+SRTDIN+KFK+GNKTV ISK Y
Sbjct: 921  INNV-------------ENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVY 967

Query: 1086 KTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139
            KTVGSSKASITY+GK+RKLM PK+        + IK +   +S LF +  +SF+
Sbjct: 968  KTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPT---RSSLFSSHDESFE 1018

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 178/534 (33%), Positives = 264/534 (49%), Gaps = 102/534 (19%)

Query: 53  SLTSKKRATTYKKV-ASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRL 111
           SL  K+R TTYKK+   P  DE   T+    +D M APP + GNGF+FGNA +++++NRL
Sbjct: 9   SLPKKQRKTTYKKIHEEPNNDEEALTEA---VDVM-APPVI-GNGFIFGNALIDKIRNRL 63

Query: 112 EGR---------------NELGQDGQDKE-----------NEDEDVFSTQLIANLYDGGE 145
           +G+               + L +D ++ E           N++++V  TQLIA   +  E
Sbjct: 64  DGKENKEDTPVPTQTQMIDNLYKDAEELEEETIEYEKEAINKEQEVVQTQLIAKEKEEIE 123

Query: 146 ELESKSNGD-KNNQKVNVSSFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSV 204
            +++ S+   +  Q +   SF       +  TQ+   IN P+  ++E +P++   NR S 
Sbjct: 124 NIKNPSDAYLQETQPIEEKSFLLGTNKELE-TQETQVIN-PV--LSESQPSE---NRSS- 175

Query: 205 ITTSQTQAIPFTTAQITQKTTQCLNNHG---ATSQTQQIPPTKPSEAQTQADVATANDSD 261
                 + IPFT  Q  Q   + + N+    + S+ + I    P+ A   +    A+   
Sbjct: 176 -----NEKIPFTFTQKIQDFVETVENYSTDLSLSKDETITINLPNHATDNSTSKRAHRIS 230

Query: 262 TQQKVPMLTTETSPLFQTVPDQSPSTQ-----MNTPPPTVHDDRTQMDTVAQTMQDKVPP 316
            + +  M   +T  +  T  D   +T      +N P  TV D               +P 
Sbjct: 231 QELQRTMTDMDTQVINNTNLDVIEATMADLPNLNEPQSTVAD---------------IPS 275

Query: 317 T-LKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVK-RFSKESFLADFDNSSSDEDTN 374
           T LKIHE+Q EL  E   R   +  EY+K  K I ++  +FSK S L  FDNSSSD++  
Sbjct: 276 TGLKIHEIQKELERE---RNSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELE 332

Query: 375 FKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITL 434
            + +             I  ++  P+ + K   K KK+  L+TY N LK+++   K I L
Sbjct: 333 VQKDMK-----------ITRTKEKPESSIKPKIKPKKLTGLNTYENKLKKKLLEKKHIQL 381

Query: 435 DLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDF 494
           D DS +D D                 PIS+ SKAT+ NLKARLSK+     +    NK  
Sbjct: 382 DSDSDNDSDIAKR------------FPISRTSKATLLNLKARLSKK-----KPVKSNKST 424

Query: 495 KSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
            +  + L   L++ASRKQILDHQRE+VE +GFKLED+ KEKEIVE+LLE+EI R
Sbjct: 425 NTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEIKR 478

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  309 bits (792), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 184/396 (46%), Positives = 240/396 (60%), Gaps = 34/396 (8%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            K KE+K KGV+  F          WHGVGGADGE SDEYDSE+EKM+DDY+K  F+  EI
Sbjct: 806  KRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEI 865

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R+MLAAE+KE D K++NKIL+DIKNGGFR +R K              LQ+Y        
Sbjct: 866  RQMLAAEDKEYDEKIVNKILHDIKNGGFR-RRGKGALDIELSDDEDDELQRYHAKRRELL 924

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPF--GAEKESDQDVTSTATDLDTQD 932
                   G+ +KLV NPKS AFFESMVED++E KNPF  G   + D    S    +D   
Sbjct: 925  RQKVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNAS 984

Query: 933  NDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNY--DEFEMDRELARIQ 990
               T+P      +   + V  + K++ IS++FVQ+SLSFL S +   +EFE+DR LA+ Q
Sbjct: 985  EHGTQP------DAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQ 1038

Query: 991  H---GNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQ 1047
            H   G+   D+ DLFTLKQ+S IK+          +RT +  ++LE   +GN        
Sbjct: 1039 HSTLGDDNDDLEDLFTLKQNSCIKTLHT------PARTSSRTVDLE--VDGN-------- 1082

Query: 1048 SLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAP 1107
            S   GFK PSVI SF+SR DIN+KFKEG KTVK+SKSYKT+G S+ASITY+GK RKL AP
Sbjct: 1083 SPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAP 1142

Query: 1108 KRKTEENHHP---NHIKKSKTQKSKLFENGQDSFDS 1140
            KRK E    P   +   ++  +++ LF +  DSF++
Sbjct: 1143 KRK-ESGRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177

 Score =  126 bits (317), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 174/577 (30%), Positives = 267/577 (46%), Gaps = 122/577 (21%)

Query: 46  DALNALSSLT-SKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATL 104
           D L+AL  L   KK+ TTY K       E Y T      D     P L+   FLFGN+T+
Sbjct: 2   DFLDALGDLKHPKKKKTTYVKDI-----EVYATQEE--NDEEKKQPQLSSASFLFGNSTI 54

Query: 105 -NRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELES---------KSNGD 154
            ++VK+RL G +    DG+      + +  TQ+I N YDG E+LE          + +  
Sbjct: 55  VDKVKSRLNGVSNEETDGE----RGDALPQTQVIPNYYDG-EDLEQDFVSPPKPRRVSNT 109

Query: 155 KNNQKVNVSSFTQTQRIPVSITQQNNEINVPI-----------HSINEGE------PTQK 197
            + Q  +  S  QTQ +P   T       VP+            SIN+G        T K
Sbjct: 110 GHGQDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQVSETIPVSINDGLLGESLFKTSK 169

Query: 198 AKNRGSVITTSQTQAIP-FTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQTQADVAT 256
            + +G+   T++  A P +   QI   + Q  N+     +TQ+   T+  +   +   AT
Sbjct: 170 DEVKGNGGNTTRNLAEPCYGLTQII-PSPQYKNSQQMQLETQEAGETQEVDKTQRILEAT 228

Query: 257 ANDSDTQQKVPMLTTETSPLFQTVPDQSPS--TQMNTPPPTVHDDRTQMDTVAQTMQDKV 314
           A D       P L+ E   +  TV D S +  TQ++T  P    D + +  V  T  D+ 
Sbjct: 229 ARD-------PTLSEEDF-VAATVADGSEAVTTQLDTCVP----DTSALGDVQPTAPDQS 276

Query: 315 P----PTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSD 370
                  L IHE++ +L  E+   K+   TE +     + + K+F KE+FL +FD SSS+
Sbjct: 277 AHRNSQRLLIHEIEKDLDAEEEREKRI--TEAKPHDVVLVVKKKFDKEAFLNNFDCSSSE 334

Query: 371 EDTNFK--------LESSQPKQQQNGYEMIDISQSNPQPAE------------------- 403
            +   +        LES    +++  +  +  +  + + +E                   
Sbjct: 335 GEEQEQEEQEEQTHLESEPASKRRKLFTSVPGNPLDSKDSEAGGSGNFASAIAATIGTTT 394

Query: 404 ---KENKKDKK----VPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNED 456
              +  +KDK+    VPL ++Y N LK  +DS + I  DLDS SD             ED
Sbjct: 395 DEGRSTRKDKEEAGWVPL-NSYKNQLKARLDSKEHI--DLDSSSD-------------ED 438

Query: 457 ESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHN-----KLINTLRKASRK 511
           E+++P S++SKA +  +KAR SK+     QG  K +   S        +L ++L+KA++K
Sbjct: 439 ENSVPASKMSKAAVLEIKARTSKR-----QGIKKTRQQPSTPRAPSLKELFSSLKKANKK 493

Query: 512 QILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
           QILDH+REI E +G  LED+ +EK+ VE+LLEQEI R
Sbjct: 494 QILDHRREITEKRGLNLEDIEREKKEVENLLEQEIER 530

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  305 bits (781), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 193/395 (48%), Positives = 238/395 (60%), Gaps = 30/395 (7%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            K KE+  KGVT FF          WHG+GG DGE SDEYDS+VEKMIDDYSK  F+ +EI
Sbjct: 716  KEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEI 775

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            REMLAAENKEMD+ MINKILYDIKNGGFR ++                L++Y        
Sbjct: 776  REMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELM 835

Query: 875  XXXXXXIGDD-TKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDN 933
                  +GDD  KLVKNPKSKAFFESMVEDI + KN F     +D+ +  T+T       
Sbjct: 836  RKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAF-----NDEPLGETSTQEINNTQ 890

Query: 934  DNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYD-EFEMDRELARIQHG 992
            D+ K  D     E+      K KK IISE+FVQ++LSFLKS+  D EF M+  LA+ QHG
Sbjct: 891  DDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHG 950

Query: 993  NGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGG 1052
                 V +L +LKQ SSIK F +   NS      + VI L++      + ++ + S I  
Sbjct: 951  TK---VENLLSLKQQSSIKVFQSPSNNS------SKVIKLDDINN---DDDDDEDSPIAL 998

Query: 1053 FKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTE 1112
            FK PS++KSF S+TDIN+KF++GNKTV ISKSY+TVGSSKASITY+GK+RKLMAP   T 
Sbjct: 999  FKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAP---TH 1055

Query: 1113 ENHHP--------NHIKKSKTQKSKLFENGQDSFD 1139
                P        N I K +     LF  G DSF+
Sbjct: 1056 SKMKPLRSRVTDNNKITKGERNIGSLFSTGDDSFE 1090

 Score =  144 bits (364), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 171/551 (31%), Positives = 260/551 (47%), Gaps = 67/551 (12%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLP--IDGMNAPPALTGNGFLFGN 101
           MD  ++ L  +T  ++ T  KK   P ++E  + DG L     G N  P + G GFLF N
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQ-EEDGILTDVTSGGNVTPTILGTGFLFKN 59

Query: 102 ATLNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELES---KSNGDKNNQ 158
           +T+++V+ RL G+N + Q+     + +++   TQ+I NLY  GE+LE    K       Q
Sbjct: 60  STIDKVRARLSGKNYIEQEKTPLASSEQE---TQIITNLYTNGEDLEKDLIKHIPVSQTQ 116

Query: 159 KV-NVSSFTQT-QRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFT 216
            + N    TQ  Q I V+I   +NE+  P   I   E   +   R + I    TQ IP  
Sbjct: 117 PITNTGERTQLEQEIKVTIDNDSNEM--PTQVIGSTERDDETAER-TQIGEVATQLIPGD 173

Query: 217 TAQIT---QKTTQCL-----------NNHGATSQTQQ----IPPTKPSEAQT-QADVATA 257
           T   T   QKT + L           +NH  T+   +    +P T   + +  + ++   
Sbjct: 174 TYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQKIKNFETNITNE 233

Query: 258 NDSDT---QQKVPMLTTETSPLFQTVPDQSPST-QMNTPPPTVHDDRTQMDTVAQTMQD- 312
           ND  T   + +  +++T    +     D S S  Q      TV DD      +  T+ D 
Sbjct: 234 NDDFTNGSKSQTVLISTNVDNVRAEYVDASSSLLQATAIAATVRDDGPSSTALVGTVADD 293

Query: 313 --KVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPI-VKRFSKESFLADFDNSSS 369
                  L IH+ Q EL  E+     ++  EY+ + K I   + +F+K+SFL  FDNSSS
Sbjct: 294 KLSSGSNLAIHKFQKELEEEEQLANNSKYKEYKGISKPILTNIVKFTKDSFLQGFDNSSS 353

Query: 370 DEDTNF--KLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDK----------KVPLLST 417
                   K++ ++   ++N       +++N   A  +    K          K+  LS 
Sbjct: 354 SSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIKSPKKFSKLNTLSR 413

Query: 418 YANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARL 477
           Y N LK  ++S   + L  D  S  D +N            +LP+S+ SKATI  +KARL
Sbjct: 414 YENKLKTVLNSKNQLQLGSDDESSDDTEN------------SLPVSRTSKATILTIKARL 461

Query: 478 SKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEI 537
           SKQ  K  +   K+    ++ NKL   L+K+SRKQIL++QRE++E KG   ED+  EKE+
Sbjct: 462 SKQKSK--KNVQKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKEL 519

Query: 538 VEDLLEQEILR 548
           VE+LLEQEI R
Sbjct: 520 VENLLEQEIKR 530

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  296 bits (759), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/355 (48%), Positives = 224/355 (63%), Gaps = 25/355 (7%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            K  ELK KGV+NFF          WHG+GG DGE SDEYDSEVEKMIDDYS+   +  EI
Sbjct: 801  KRAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEI 860

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R++L +ENKEMDVKM+NKIL+DIKNG FR KR ++             L+QY        
Sbjct: 861  RKLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTLELELSDEEDDDLRQYRQKRNELM 919

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDND 934
                  +GDD KLVKN K+KAFF+S+VEDI+E KNPFG   +++   T   T +DTQ  +
Sbjct: 920  KQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRE 979

Query: 935  NTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-NYDEFEMDRELARIQHGN 993
            +        +N+  K   +K KK ++SE+FVQ+SLSFL SN N  EFE +++LAR+QH  
Sbjct: 980  SV-------SNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQH-- 1030

Query: 994  GEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGF 1053
             + DV DL+TLK+ SS+KSF      S+ S+  N +IN+    + ND    G       F
Sbjct: 1031 -DDDVSDLYTLKKQSSVKSF-----KSVGSK--NEIINV----DANDNS--GTAVATATF 1076

Query: 1054 KHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPK 1108
            + PS+IKSF S+ +++DKF+ G KTVK  KSYK VG SK S+TYM K RKL APK
Sbjct: 1077 RPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131

 Score =  105 bits (261), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 185/373 (49%), Gaps = 58/373 (15%)

Query: 207 TSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQI--PPTKPSEAQTQADVATANDSDTQQ 264
           T  TQ I    AQI    TQ        +Q  QI  P T+P++      +  +++S+ + 
Sbjct: 285 TQPTQLIDAQPAQIIDAETQPTQIIDTNAQPTQIIDPDTQPTQL-----INYSHESNGKH 339

Query: 265 KVP-------MLTTETSPLFQTVPDQSPSTQMNTPPPTVHDDRTQM--DTVAQTMQDKVP 315
            +P       +L+T TS L   +P    +T   T  P   +D   +  D +A TM+D++ 
Sbjct: 340 -IPTLPAPDALLSTGTSLLGLNIPLHRYATAGTTSNPKHKNDSQHIIEDNIA-TMRDRLE 397

Query: 316 P----------------TLKIHELQSELALEDFNRKKAQNTEYRKLQKTIP--IVKRFSK 357
                            TLKIHE+Q+++  E  N    +  E+RK  + +P  +  RF+K
Sbjct: 398 TQEFQPTVADDVKSGGNTLKIHEIQTQIDEETRNMLN-RGVEHRK-SRGVPSRVEVRFTK 455

Query: 358 ESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEK--ENKKDKKVPLL 415
           ESF+ADF+ S S  D    +ES   +      E      S+   A K  E  K K+V  L
Sbjct: 456 ESFMADFEESDSASD----MESDSDQINDTTPETGSSQNSDSNKARKPTEAPKTKRVTGL 511

Query: 416 STYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKA 475
           S+Y   L+ +++  +C    LD GSD    +  + DK ++      +SQ SKA + N+KA
Sbjct: 512 SSYETILRNKVNDDEC----LDLGSDDTYSSEEEYDKESK------VSQASKAAVLNIKA 561

Query: 476 RLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEK 535
           +  K+     + +N NK   +  + L + L+K +R+QIL HQ EI+ TKG   +D+ +EK
Sbjct: 562 KALKKKAI-VKAANTNK---TTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLEREK 617

Query: 536 EIVEDLLEQEILR 548
           EIVEDLLEQEILR
Sbjct: 618 EIVEDLLEQEILR 630

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (56%), Gaps = 11/109 (10%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
           MDD L   +S+  K+R TTYKKV     DE    D  +P        +L GNGFLFGNAT
Sbjct: 1   MDDLLERFNSVKVKRR-TTYKKVQQNSTDEAAGDDDCVPT-------SLAGNGFLFGNAT 52

Query: 104 LNRVKNRLEGRNELGQDGQDKENEDED---VFSTQLIANLYDGGEELES 149
           ++++KNRL   +         ++  ED   V  +QL++ LYDGGE+LES
Sbjct: 53  VDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLES 101

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  285 bits (730), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 186/414 (44%), Positives = 237/414 (57%), Gaps = 42/414 (10%)

Query: 731  EAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGS 790
            E + +E++                KL+ELK KG+T+ F          WHG+GG DGE S
Sbjct: 608  EELYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELS 667

Query: 791  DEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNX 850
            DEYDSEVEKMIDDYSK  FN+ EIRE LAAENK+MD+KM+N+IL DIKNGGFR +R  N 
Sbjct: 668  DEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKRR--NA 725

Query: 851  XXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNP 910
                        L+ Y                 + KL+ N KS AF ESMV+DI+E KNP
Sbjct: 726  LEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNP 785

Query: 911  FGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLS 970
            F    E D ++     + D +       GD  SN      + +K KK I+SE FVQKSLS
Sbjct: 786  FD---ERDDNIMDDTPETDAE-------GDVNSN-----ELLNKKKKFILSEAFVQKSLS 830

Query: 971  FLKSN-NYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTN---SQTNSLSSRTM 1026
            FL S+ N +EFEM+  LA+ QH +      D+F LK H SIKS  +   S  NS+SS+  
Sbjct: 831  FLSSSRNLEEFEMNNNLAKEQHSHA---ATDMFALKSHCSIKSLESLPGSHNNSISSK-- 885

Query: 1027 NTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYK 1086
               ++L          E    +   G K  SVIKSF+S  DI+ KFK+GNKTVK+SKSY+
Sbjct: 886  ---LDLLH--------EEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYR 934

Query: 1087 TVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKSKT-QKSKLFENGQDSFD 1139
            TVGS+KASITY+GK RKL+ PK+K     H  H  KSKT   S+LF+   +SF+
Sbjct: 935  TVGSAKASITYLGKARKLVPPKKK----EHKPHSHKSKTASASRLFDEQDNSFE 984

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 169/528 (32%), Positives = 253/528 (47%), Gaps = 112/528 (21%)

Query: 44  MDDALNALSSLTSKKRATTYKKVA-SPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNA 102
           MD   + L +L  KKR TTYKKV    + DE   ++ N+ + G+       G   LF N+
Sbjct: 1   MDFVFDGLDALKGKKR-TTYKKVTDGDVEDEPKISEFNIELPGL-------GQSILFNNS 52

Query: 103 TLNRVKNRLEGRNELGQDGQDKEN-----EDEDVFSTQLIANLYDGGEELESKSNGDKNN 157
            L +++NRLEG N       D EN     E + +  TQ+I+NLY+GGE+LE K       
Sbjct: 53  KLKQIRNRLEGNN------NDSENDSSQAETQVIADTQIISNLYEGGEDLEEKEE----- 101

Query: 158 QKVNVSSFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTT 217
                  F Q  +I    TQ                          +I  S T +     
Sbjct: 102 -----RRFLQRTQIVEDHTQ--------------------------IIDASVTYSSKTIE 130

Query: 218 AQITQKTTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPL- 276
           +     T + +N   + S+  QI  +K  +      +   ++ D+Q+KV   T ET  L 
Sbjct: 131 SNKMDNTQKYIN--ASDSEPTQIQISKVDKL-----LKITDNLDSQKKVLDTTLETQELE 183

Query: 277 -----FQTVPDQSPSTQMNTP---PPTVHDDRTQMDTVA-QTMQDKVPPT--LKIHELQS 325
                 Q    Q   TQ++     P  V DD  +  + A QT+ D       LKI+E++ 
Sbjct: 184 TQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIER 243

Query: 326 ELALED-FNRKKAQNTEYRKLQKTIPIVK--RFSKESFLADFDNSSSDEDTN--FKLESS 380
           +L  ED   ++K+  TEY++     P++   +FSK  FL  FD+SSS+ED     KL S+
Sbjct: 244 QLDEEDQILKEKSMGTEYKR--NIAPVMSKVKFSKNDFLEHFDSSSSEEDEEGVVKLSST 301

Query: 381 QPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGS 440
           +P+        +++  S PQ +     K+ K   LS Y N LK++I+   CI        
Sbjct: 302 EPETA-----AMNLENSLPQFS-----KESKFIGLSNYENILKKDINKQNCIEF------ 345

Query: 441 DKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNK 500
                    +D  +E E    +S+ SKATI ++KA LS+   K AQ S  NK+   +   
Sbjct: 346 ---------SDSEDETEVTSKVSRASKATILSIKANLSR--HKPAQSSINNKNALGN--- 391

Query: 501 LINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
           L + L+KA++ QILDH++EI+E KG+K+E++ KEKEIVE+LLEQEI R
Sbjct: 392 LFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIER 439

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  273 bits (697), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 171/391 (43%), Positives = 226/391 (57%), Gaps = 34/391 (8%)

Query: 753  ATKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSH 812
            A +LKE+K+ GV+  F          WHG+GG D + SD YDSEVEKMIDDYS+  FN  
Sbjct: 605  AKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPS 664

Query: 813  EIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXX 872
            EIREMLA ENKE D+ ++NKILYDIKNGGFR ++ ++             L+ Y      
Sbjct: 665  EIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDD-LKAYRAKRRA 723

Query: 873  XXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQD 932
                    I  D K+VKNPKSKAFFES+V+DI+E KNPF     S + +    T     D
Sbjct: 724  LMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDID 783

Query: 933  NDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKS-NNYDEFEMDRELARIQH 991
            ND  K   N         V  K KK++ISE+FVQ+SLSFL S    DEFE++      QH
Sbjct: 784  NDE-KLATN---------VTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINN-----QH 828

Query: 992  GNGE--GDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSL 1049
              GE      DL+TLK++SSIK+  +  ++  SS   N           N++      SL
Sbjct: 829  NGGEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNL----------NEQPSQSSGSL 878

Query: 1050 IGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKR 1109
                +  SV+ SF+S  DIN KFKEG K+VK+S +YKTVGS++ASITYMG +R+L+APK+
Sbjct: 879  FNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938

Query: 1110 -KTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139
             +   +   N    S+T  S+LF+N + SF+
Sbjct: 939  SRLTTSSKAN----SRTTPSRLFDNQEGSFE 965

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 188/675 (27%), Positives = 289/675 (42%), Gaps = 161/675 (23%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
           MD   + L+    KK+ TTY K+   +L+E  +++  L          L G G LFGN+ 
Sbjct: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSI 57

Query: 104 LNRVKNRLEGRNELGQD----------GQDKENEDEDVF-STQLIANLYDGGEELESKSN 152
           L +++NRL   +   +D           +D E +   +F  TQ+I NLYDGGE+LE++  
Sbjct: 58  LGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENE-- 115

Query: 153 GDKNNQKVNVSSFTQTQRIPVSITQQNNEIN-------VPIHSINE---GEPTQKAKNRG 202
                  +  +SF +TQ I  +I  + N  +         + +INE    +P     N  
Sbjct: 116 -------IFHNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDVVNNTQ 168

Query: 203 SVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQTQADVAT-ANDSD 261
           +V+    TQ +P      ++  TQ +N   +      +P T+P    TQ  VAT AN+  
Sbjct: 169 TVLVIENTQPLP------SEIKTQVVNEVNSA-----LPVTQP----TQTIVATQANE-- 211

Query: 262 TQQKVPMLTTETSPLFQTVPDQSPSTQMNTPPPTVHDDRTQMDTVAQTMQDKVPPTLKIH 321
                  +T +T  L                 PTV D    M +            LKI 
Sbjct: 212 -------VTYDTQELM----------------PTVDD--VAMRSTG----------LKIT 236

Query: 322 ELQSELALEDFNRKKAQ-NTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLESS 380
           +++ EL  E    K+ +  TE++  +    I K+FSKE FL  FD+SSS ED   K E  
Sbjct: 237 DIEKELEEEQRLAKETEFGTEFKFKESESKISKKFSKEDFLNHFDDSSSSEDETSKNEKG 296

Query: 381 QPKQQQNGYEMIDISQS-NPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSG 439
            P         +D S+  +P    K   K K +  L  Y +NL+R+ ++ + I     S 
Sbjct: 297 -PN--------VDKSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNEQIIEF---SE 344

Query: 440 SDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHN 499
           SD+D+D ++              S  SKA I N++A  SKQ  K++Q        KSD  
Sbjct: 345 SDEDSDTNISP------------SYASKAVILNIRANKSKQQPKVSQ--------KSDQT 384

Query: 500 KLI---NTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRXXXXXXXX 556
            L+   N L++AS++QI+ +Q+E++E KG  LE++ KE EIVE+LLEQEI R        
Sbjct: 385 TLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIAR-------- 436

Query: 557 XXXXXXXXXXXXXXXXXXXXXXXXXXXKFALSDNEIADYELSGSXXXXXXXXXXXXXXXX 616
                                      +F LS NE+ D ++ GS                
Sbjct: 437 --NQKIRQREKQKQKKENQDDLNSNPEEFDLSANELEDSDIPGSDFAESNNNSEKDDEEE 494

Query: 617 NITNK-----------------------KKPYRTKHILDESDSEVEDEQKMEVEKNVENV 653
               +                       K+ ++   I+D+SDSE+E +       + + +
Sbjct: 495 ENDEEEEDEQEDAPKSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIEAQI-----VDSKEI 549

Query: 654 PKRNAIDLGHYGNNI 668
              N IDLGHYG+NI
Sbjct: 550 ITANTIDLGHYGDNI 564

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  240 bits (612), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 177/489 (36%), Positives = 241/489 (49%), Gaps = 88/489 (17%)

Query: 656  RNAIDLGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTKXXXXXXXXXXXXXXXXXXXX 715
            RN IDLG YGNN+ V+     +   + D+ ++                            
Sbjct: 556  RNIIDLGPYGNNLQVNHEEDMENLPLSDSAEI---------------------------- 587

Query: 716  XXXXXXXXXXXXXVSEAIRRELIDXXXXXXXXXXXXXATKLKELKSKGVTNFFXXXXXXX 775
                           E    ELI                +LK++K+KG+           
Sbjct: 588  -----------DAAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEES 636

Query: 776  XXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILY 835
               W GVGG DG+ SDE+DS++E+MIDD++K+  N  ++R++LA ENKE+D KM+NKILY
Sbjct: 637  EDEWKGVGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILY 696

Query: 836  DIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKA 895
            DIKNGGFR KR +N             L+ Y                D  K  +N KSKA
Sbjct: 697  DIKNGGFR-KRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKA 755

Query: 896  FFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKS 955
            F ESMV+DI E KNPFG   + + DV    TD+DTQ+ND  K      N E N       
Sbjct: 756  FLESMVDDIDESKNPFG---DPEMDVEDN-TDVDTQENDYPK------NKEKN------- 798

Query: 956  KKLIISEDFVQKSLSFLKSNNYD-EFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFT 1014
                +S++FVQ+SLSFL +NN   EFE+  +   I  G+ E DV    +LK++SSI +  
Sbjct: 799  ---TLSQEFVQRSLSFLSNNNSSREFELGEQ---ITLGDEEQDVS---SLKRNSSIHALH 849

Query: 1015 NSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIG--GFKHPSVIKSFASRTDINDKF 1072
            NS +                  + + E EN D+  I    FK PS+IKS A   D N+KF
Sbjct: 850  NSSS----------------PIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKF 893

Query: 1073 KEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPK-RKTEENHHPNHIKKSKTQKSKLF 1131
            + G KTV +SKSY+ VG S++SITY GK RKL+ PK R +  +  P     SK    KL+
Sbjct: 894  QSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPA--SKPTMGKLW 951

Query: 1132 ENGQDSFDS 1140
            E+ Q+SFD+
Sbjct: 952  ESQQNSFDT 960

 Score =  181 bits (460), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 176/532 (33%), Positives = 265/532 (49%), Gaps = 117/532 (21%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
           MD  L  L  L+SK+R TTYKKV  P  +E      N P      PP + GNGFLF N+T
Sbjct: 1   MDSLLEKLDPLSSKRR-TTYKKVFEPQEEEETQQISNSP------PPPILGNGFLFQNST 53

Query: 104 LNRVKNRLEGRNELGQDGQDK---------ENEDEDVFSTQLIANLYDGGEELESKSNGD 154
           +++V+NRL  RN   +DG +K         + ++  +  TQ+IA+LY+G EELE     +
Sbjct: 54  IDKVRNRL--RN--AEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELE-----E 104

Query: 155 KNNQKVNV------SSFTQ--TQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVIT 206
           +N ++V +      SS +Q  TQ IP + T +  E NV                +G+ I 
Sbjct: 105 QNKERVRLPLSKKTSSASQEKTQVIPWAPTVEGVENNV---------------EQGTDIH 149

Query: 207 TSQTQAIP--FTTAQITQKTTQCLNNHGATSQTQQIPPTKPSEAQTQADV----ATANDS 260
             +TQ +P   +  Q TQ   Q          TQ+I     SE +   DV    AT+ D 
Sbjct: 150 EEKTQQVPNEISYDQKTQ-AIQSFQQTEVEPLTQRI-----SEPERTLDVPTYAATSEDQ 203

Query: 261 -DTQQKVPM--LTTETSPLFQTVPDQSPSTQMNTPPPTVHDDRTQMDTVAQTMQDKVPP- 316
            DTQ++ P+  L    S LFQ      P                           K PP 
Sbjct: 204 LDTQEQNPITQLDISNSLLFQATDSDIP---------------------------KSPPQ 236

Query: 317 TLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFK 376
            LK+H+++ EL  +   R   +N EYR  +K + + + FSKE+FL +FD  SS ED   +
Sbjct: 237 RLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFDEESSSEDELIE 296

Query: 377 LESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDL 436
           L S   +++         ++ +    E   +  ++  + S Y   LK E+DS +CI L  
Sbjct: 297 LRSRDIEKKH--------TEKDKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQL-- 346

Query: 437 DSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKS 496
                       D +  ++++  +P+S++SKAT+ ++KAR SKQ     +  +K K  K+
Sbjct: 347 -----------DDDEDESDEDVEVPLSRVSKATVLDIKARRSKQ-----EPLSKIKQKKT 390

Query: 497 DHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
             N LI TL+KAS+KQI DHQ E+++++G+KLED+ K+KE +E+LLEQEI R
Sbjct: 391 TLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIAR 442

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  241 bits (615), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 218/386 (56%), Gaps = 44/386 (11%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            KL+EL +KGV  +F          W G+GG DG+   EYDSEVEKMIDDYSK + +   +
Sbjct: 794  KLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSL 853

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R+ +  ENKEMD+K++NKILYDIKNGGFR KR +N             LQ++        
Sbjct: 854  RQKIMDENKEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAELQEFRRKRRELM 912

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDND 934
                    D  KL KNPKSKAFFESM+ D++E KN F  +  SDQ +     ++  +DN+
Sbjct: 913  KQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF--DDLSDQ-IELKEENITQEDNE 969

Query: 935  NTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-NYDEFEMDRELARIQHGN 993
                       E+N+   +K  K+ ISEDFVQK+LSFL ++ +  EF+    +++     
Sbjct: 970  ----------KEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSK----- 1014

Query: 994  GEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGF 1053
             E  + D+  LK +SS+ SF +  +      T   +IN EE      E           F
Sbjct: 1015 -EKGIGDMNALKSNSSL-SFCSKLS------TSRKIINDEEDVIEEFE----------SF 1056

Query: 1054 KHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEE 1113
            K PS+I+SF+S+  I+DKFK+GNK+VK+S SYKTVG SKASITY+GKTRKL+ PK     
Sbjct: 1057 KRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK----- 1111

Query: 1114 NHHPNHIKKSKTQKSKLFENGQDSFD 1139
             + P   K++    S+LF    D FD
Sbjct: 1112 -NGPTVRKRNSNNTSRLFNIQNDPFD 1136

 Score = 82.4 bits (202), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 170/357 (47%), Gaps = 79/357 (22%)

Query: 237 TQQIP-PTKPSEAQTQAD-----VATANDSDTQQKVPMLTTETSPLFQ--TVPDQSPSTQ 288
           TQ +P  T+ S  QT  D     V ++ D  T    P   T   PLF+  +  +    TQ
Sbjct: 291 TQHVPIETQNSYLQTIKDHEDKTVGSSKDLHTPNFNP--NTSILPLFKNNSSEEAQSETQ 348

Query: 289 MNTPPPTVH---DDRTQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKA---QNTEY 342
           ++     VH   ++ TQMD        ++   L I +++ EL     N ++A   + TEY
Sbjct: 349 IDVVHEEVHKTKENDTQMDDT------QITEVLAITKIEQELE----NDERAITDKQTEY 398

Query: 343 --RKLQKTIPIVKRFSKESFLADFDNSSSDE----------DTNFK----LE-------- 378
             ++    +P   +F+KE  L +FD+SSSDE          D N      LE        
Sbjct: 399 IPKRSPNVLPAKSQFTKEKLLQNFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQ 458

Query: 379 --SSQPKQQQNGYE-----MIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKC 431
             S  P  + NG +      I +  S   P  K   K   + +L  Y NNLK+++++ K 
Sbjct: 459 KTSVTPSSEYNGSDNEHSASISLRSS---PISKPRWKSSSM-ILPAYVNNLKQKVENKK- 513

Query: 432 ITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKN 491
             L L S SD + D+ +             +S  SKAT+ NLK RLSK+  K  +  +  
Sbjct: 514 --LQLSSDSDDEVDSAV----------IYKLSNKSKATLLNLKVRLSKK--KPVKKVHNE 559

Query: 492 KDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
           KD     N L N LRKA+++QI+ H++E++E++G   ED+ K+K +VEDLLE+EI R
Sbjct: 560 KD---STNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIER 613

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  226 bits (577), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 164/394 (41%), Positives = 205/394 (52%), Gaps = 21/394 (5%)

Query: 757  KELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIRE 816
            +ELK  G +  F          W G+GGADGE SDEYDSEVEK+IDDYS+  FN  EIR 
Sbjct: 866  RELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRN 925

Query: 817  MLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXX 876
             L  ENKEMD+KM+N+ILYDIKNGGFR KR +N             L++Y          
Sbjct: 926  KLMNENKEMDIKMVNRILYDIKNGGFR-KRNRNNIDLELSDDEDDELREYRIKRREIMKK 984

Query: 877  XXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNT 936
                + +  K++K  KSKAFF SMV+DI+E  NPF   + SD D      D  +  N   
Sbjct: 985  KRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKD 1044

Query: 937  KPGDNTS-----NNEHNKHVGDKSKKLIISEDFVQKSLSFL-KSNNYDEFEMDRELARIQ 990
                         ++H +      KK ++SEDFV K+LSFL KS   +EF+   E  + Q
Sbjct: 1045 ANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQ 1104

Query: 991  HGNGEGDVVDLFTLKQHSSIK-----SFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENG 1045
             G     + D+ +LKQ SSIK     S  +  TN     +     ++  H    D     
Sbjct: 1105 IGT----INDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNS--F 1158

Query: 1046 DQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLM 1105
            D  L    K PS+IK F S  DINDKFK+GNKTV IS SYKTVG  K SIT  G+ RKL+
Sbjct: 1159 DDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLV 1217

Query: 1106 APKRKTEENHHPNH-IKKSKTQKSKLFENGQDSF 1138
            AP  KT  N + N       +  SKLF N   SF
Sbjct: 1218 AP-VKTHNNFNKNRISNIKSSSNSKLFRNQDKSF 1250

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 137/455 (30%), Positives = 208/455 (45%), Gaps = 76/455 (16%)

Query: 239 QIPPTKPSEAQTQADVATANDSDTQQKVPMLTT---ETSPLFQTVPDQSPSTQMNTPPPT 295
           QI P+ P +A       TA+D     K P++T      + L  TVP+Q+ +  +N  P T
Sbjct: 403 QIVPSSPGKA-------TADDP---PKGPLMTLPEKTQADLLNTVPNQNDA--LNEIPQT 450

Query: 296 VHDDRTQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKR- 354
             DD  Q  +V   + DK    L+IHE+Q  L  E   ++K + TE+  +Q +  + K  
Sbjct: 451 ARDDIFQT-SVKDGILDK---KLRIHEIQDALLQE--VKEKEKQTEHH-IQDSDSLTKTK 503

Query: 355 --FSKESFLAD---------FDNSSSD--EDTNFKLESSQPKQQQNG----YEMIDISQS 397
             F+KE FLAD         + N  +D  ED + +  +S  K +       ++ I++  +
Sbjct: 504 FTFTKEDFLADLDDDDSDAVYANGENDKNEDKSERANTSHAKLKAMPVTIPHQQIEVQFN 563

Query: 398 NPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDE 457
             Q      K  +KV +LS Y N LK  +  +  I L  DS  +  +D            
Sbjct: 564 KVQLKNVIAKPKRKV-ILSQYENRLKENLLYNNSIDLYSDSEENTQSD------------ 610

Query: 458 SALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQ 517
             +  S  SKA I +++ +LSK+  ++ + +      +++ ++L N L+KAS+KQI DHQ
Sbjct: 611 --ILFSTASKAQILDIRHKLSKKKPQVKKKT-----IQTNLDQLFNKLKKASKKQIFDHQ 663

Query: 518 REIVETKGFKLEDMVKEKEIVEDLLEQEILRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 577
           +  +E+KG KLED+ KEKEIVE+LLEQEI R                             
Sbjct: 664 KNAIESKGLKLEDLKKEKEIVENLLEQEIERNRKIRAKERKRENKKNKVDDKSVQSASDE 723

Query: 578 XXXXXXKFALSDNEIAD--YELSGSXXXXXXXXXXXXXXXXNITNKKKPYRTKHILDESD 635
                  F  S NE+ D  Y  S                  NI   KK    K + +ESD
Sbjct: 724 DD-----FDHSANELEDSFYNDSDENKEIIEPEEEDSEDDINIFRHKKGL--KLVTEESD 776

Query: 636 SEVEDEQKMEVEKNVENVP-KRNAIDLGHYGNNID 669
           S  E++  +E EK    +P   N I+LGHYG+N+D
Sbjct: 777 S--ENDNPLESEK----IPINPNIINLGHYGDNLD 805

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 10/71 (14%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPI---LDENYDTDGNLPIDGMNAPPALTGNGFLFG 100
           MD   ++L  L  KKR TTYKKV   +   LD+   T  N P+   N        GFLF 
Sbjct: 3   MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTISN-PVPSFNL-----SEGFLFA 55

Query: 101 NATLNRVKNRL 111
           N  L ++KNRL
Sbjct: 56  NDKLEKIKNRL 66

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  221 bits (563), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 149/386 (38%), Positives = 202/386 (52%), Gaps = 44/386 (11%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            +LK++K  GVTN F          W GVGG DGE  D+YDS++EKMIDD+S    N+ +I
Sbjct: 598  RLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQI 657

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R++L AENKE D+K +NKIL+DIKNGGFR +R  N            +L           
Sbjct: 658  RQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMR 717

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDND 934
                    DD KL+KN +SKAFFESMVEDI++ K+PF  + E             T + D
Sbjct: 718  KRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQAE-------------TSEKD 764

Query: 935  NTKPGDNTSNNEHNKHVGDKSKKLIISEDFV-QKSLSFLKSNNYDEFEMDRELARIQHGN 993
                G   ++N+          K  IS +FV Q       S ++ EF    E+AR+    
Sbjct: 765  KKSEGLVDASNKQ---------KDTISHEFVQQSLSFLSSSRDFSEF----EVARVSQ-E 810

Query: 994  GEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGF 1053
            GE +  DL +LKQ S++K             T+    N+   +E  D  E  +  L    
Sbjct: 811  GERN-TDLNSLKQDSTVK-------------TLYAPSNIISESERADHEEFDNSVLPVES 856

Query: 1054 KHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEE 1113
             + SV+KSF    + NDK KEG KTV +SKSY+TVG +KASITY+GK RKL+APK+   E
Sbjct: 857  SYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKKSNAE 916

Query: 1114 NHHPNHIKKSKTQKSKLFENGQDSFD 1139
                + +  S    SK+F N + SF+
Sbjct: 917  VRTTSKL--STLGNSKIFRNFESSFE 940

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 158/514 (30%), Positives = 246/514 (47%), Gaps = 90/514 (17%)

Query: 44  MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103
           MD    +  +   K+RAT  K V +   D+ Y  D   P+     PPA+ GNGFLF ++T
Sbjct: 1   MDKLFESFDNAIKKRRATYQKAVQNE--DDEYTED---PL----VPPAVLGNGFLFNSST 51

Query: 104 LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELESKSNGDKNNQKVNVS 163
           L++VKNRL    E G    D         +TQ+++NLY+ GE+LE +           V 
Sbjct: 52  LDKVKNRLNKDQEQGTQAID---------TTQVLSNLYEDGEDLEKE-----------VP 91

Query: 164 SFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQK 223
           S  Q++  P+          + I SI E E  ++  N     T          T  I + 
Sbjct: 92  SILQSKSKPIP--------TILIPSI-EREILKQPFNENHNFTG--------VTVPIAKS 134

Query: 224 TTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDTQQKVPMLTTETSPLFQTVPDQ 283
           +    N      ++ +IP T+P    + +DV T      Q +V   T+ET+    TV   
Sbjct: 135 SAITKNLDREDLESPEIPETQPIPDFSASDVPT------QTQVLKTTSETAADTGTVATA 188

Query: 284 SPS-----TQMNTPPPTVHDDR-TQMDTVAQTMQDKVPPT-LKIHELQSELALEDFNRKK 336
           + +     TQ+     T  D R +Q D + QT  D VP T LKIHE++   + E     K
Sbjct: 189 AIAYEESLTQVEVSEQTYPDQRNSQEDIIQQTAADAVPITRLKIHEIEEMWSREVQTETK 248

Query: 337 AQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNF--KLESSQPKQQQNGYEMIDI 394
               +YR  +   P+ K F+KE+F+ DFD SS  +   F  +++++ P  + N       
Sbjct: 249 EHKVKYRAPR---PL-KVFTKEAFMQDFDKSSDSDSDVFDQEIKATSPIGRNND------ 298

Query: 395 SQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLN 454
           S S    ++ +  KDK    L+ Y   LK + + +K + L  +S               +
Sbjct: 299 SISEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSESD--------------D 344

Query: 455 EDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQIL 514
           E++ A+  S  +KAT+  LKARLSK+   +     +++  K+  + L+  LR ++++QIL
Sbjct: 345 EEDLAVSTSHEAKATVLKLKARLSKRRPPV-----ESQHGKASLSALMKNLRNSTKRQIL 399

Query: 515 DHQREIVETKGFKLEDMVKEKEIVEDLLEQEILR 548
           D Q+E +E +G K ED+ KEKEIVE+LLEQEI R
Sbjct: 400 DRQKEGIERQGLKFEDVEKEKEIVENLLEQEIAR 433

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  209 bits (532), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 201/384 (52%), Gaps = 73/384 (19%)

Query: 759  LKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREML 818
            LKS G+              WHGVGGADGE SD+YDS+++ MIDD+SK+KF++  IRE L
Sbjct: 610  LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERL 669

Query: 819  AAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXX 878
            A ENKEMD +MINKIL+DI  GGFR KR +             +L+Q+            
Sbjct: 670  ALENKEMDERMINKILHDINTGGFR-KRGRGALDLELSDDEDELLRQFREKRREIMKQKL 728

Query: 879  XXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKP 938
                D   +V N KSKAFF+SMVEDI     P          VTS +         NT+ 
Sbjct: 729  LENVDG--VVNNSKSKAFFDSMVEDITRKSIPA---------VTSFS---------NTR- 767

Query: 939  GDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFL--KSNNYDEFEMDRELARIQHGNGEG 996
                  +E  K      KK++ISE+FVQ SLSFL  K ++ +EF    E+    H   E 
Sbjct: 768  ------DEMGK------KKIVISEEFVQSSLSFLSAKDDDINEF----EVTEAAHDATE- 810

Query: 997  DVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHP 1056
               DL +LKQ S+IKS  + Q N  +S   + V           +G + D      FK P
Sbjct: 811  ---DLESLKQRSNIKSLDSPQRNR-NSAFFDDV-----------DGTSLD------FKLP 849

Query: 1057 SVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAP--KRKTEEN 1114
            S++KSF+S +D+NDKFK G KTV ISKSY+    S+++IT++GK RKL AP  ++ T   
Sbjct: 850  SIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLV 909

Query: 1115 HHPNHIKKSKTQKSKLFENGQDSF 1138
              P          S LF++  DSF
Sbjct: 910  RKPT---------SSLFDSNSDSF 924

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 463 SQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVE 522
           SQ SKA +  +KA+ S+   K  +  N +        +L  +L+  +R QIL+ +REI  
Sbjct: 336 SQSSKAALLLIKAKRSRN--KATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREISG 393

Query: 523 TKGFKLEDMVKEKEIVEDLLEQEILR 548
            KG  LE +  EK  VE LLEQE+ R
Sbjct: 394 KKGISLEAIEDEKIQVEKLLEQELER 419

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  209 bits (532), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 142/391 (36%), Positives = 207/391 (52%), Gaps = 50/391 (12%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            K KE++  GV              WHGVGG D E SDEYDS+++KMIDDY+KN+F+  EI
Sbjct: 773  KQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEI 832

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R++LA+E+ + D  M+NKIL+DIK GGFR KR +             +LQ Y        
Sbjct: 833  RKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGELDLELSEDEDGILQSYRAKRWNEQ 891

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDND 934
                     +T +  NPKS  FFESMV+   EF  P                 L T D  
Sbjct: 892  KQKMLDSEHNTSVKSNPKSLPFFESMVD---EFTIP-------------VERALGTPD-- 933

Query: 935  NTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNG 994
             + P  +T+  E  ++     +K++ISE FV+++LSFL S+  +     R    ++  N 
Sbjct: 934  -SPPAQSTNVLELKQNT---KQKIVISEHFVKQTLSFLTSD--ENMTNMRSEINVEKPNN 987

Query: 995  EGDVV-----DLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSL 1049
            + D+      DL+TLK+ S+IK         L++ +   ++N         E E+G +  
Sbjct: 988  DNDIYSSEVEDLYTLKETSTIK--------VLNTYSGKPIVN---------EDEDGAE-- 1028

Query: 1050 IGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKR 1109
              GFK PSV+++F SR D+NDKFK+G K+VKIS  YKT+GSS+A+IT++GK RKL+ PKR
Sbjct: 1029 -FGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKR 1087

Query: 1110 KTEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140
             ++      H       K + F    D+F++
Sbjct: 1088 SSKSPRDSAHRSIKNRLKHQAFLENTDTFEA 1118

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 125/248 (50%), Gaps = 46/248 (18%)

Query: 318 LKIHELQSELA-LEDFNRKKAQNT--EYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTN 374
           L IH+ Q +L   ED N K  ++    Y  LQ  I     F+KE+FL DF+ S  + D  
Sbjct: 304 LAIHKFQRDLGEAEDENNKVTEHILPSYVALQNHI-----FTKEAFLDDFELSGQEVD-- 356

Query: 375 FKLESSQPKQQQNGYEMIDISQSN--------------PQPAEKENKKDKKVPLLSTYAN 420
           +   +++ K+  +     D+S +                + A  E  K   +PL S   N
Sbjct: 357 YSSTATRVKETVSNDISSDVSSNTNAVYDNLTDNFGTITRDAYAEEAKPPLLPLQS-MKN 415

Query: 421 NLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQ 480
            + ++I         LDS SD+++ ++               S + KA + N+KA++SK 
Sbjct: 416 TVGQDII--------LDSSSDEEHASNQ-----------FATSTMVKAALLNIKAKISK- 455

Query: 481 NQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVED 540
           N  L++ + ++ +  +   +L  +L+KA++KQILDH+REI E +G  LE + +E+E VED
Sbjct: 456 NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVED 514

Query: 541 LLEQEILR 548
           LLEQ+I R
Sbjct: 515 LLEQKIKR 522

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  198 bits (503), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 202/390 (51%), Gaps = 52/390 (13%)

Query: 755  KLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEI 814
            + +E+K KG+T             WHG+GG+D E S++YDSEVEKMIDDYS +  N+  +
Sbjct: 677  RRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHL 736

Query: 815  REMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXX 874
            R +LA   ++ D  ++NKIL+DI  GGFR +R K              LQQ+        
Sbjct: 737  RAILAKNERQHDENIVNKILHDISTGGFR-RRGKGALDLEMSENEDQELQQFRQKRRELL 795

Query: 875  XXXXXXIGDDTKLVKNPKSKAFFESMVEDIME--FKNPFGAEKESDQDVTSTATDLDTQD 932
                   GD +KLV NPKS AFF++MV+D+ E  F N F A  +   D ++         
Sbjct: 796  KQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDPSAAG------- 848

Query: 933  NDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHG 992
                                   +K++ISE FV+++LSFL S + D  E+  E   I   
Sbjct: 849  -----------------------RKIVISEQFVKETLSFLSSKSGDS-EIPAETKSISSS 884

Query: 993  NGEG-DVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIG 1051
              E  ++ DL TLKQ+S+IK    S         +     + E + G DEG+ G    + 
Sbjct: 885  TVEREEIQDLHTLKQNSNIKHLKGS---------LELPAQMAELSSG-DEGDYGFS--LD 932

Query: 1052 GFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKT 1111
             F+  S  KSF + T+++DKFK G K V+I K+ KT+G SKA+IT++G+ R+L+ PK   
Sbjct: 933  RFR--SAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDY 990

Query: 1112 EENHHPNHIKKSKTQKSKLFENGQD-SFDS 1140
            +++     +  SK  +S+LF  G + SFD+
Sbjct: 991  KDSEP--KLNSSKRARSQLFSEGNNRSFDT 1018

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 134/529 (25%), Positives = 221/529 (41%), Gaps = 111/529 (20%)

Query: 54  LTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEG 113
             S ++ TTYKKV   I +++ D   +      N P A+      F ++ L+RV+ RL  
Sbjct: 8   CVSARKKTTYKKVRLGIAEQSKDEPSS------NKPAAV------FRSSLLDRVRTRL-- 53

Query: 114 RNELGQDGQDKENEDEDVFSTQ--LIANLYDGGEELE-SKSNGDKNNQKVNVSSFTQTQR 170
                 + +D      D    +  L  ++YDG E LE S   GD  +             
Sbjct: 54  ------NVEDGHAPSSDALEPESGLTDDVYDG-ENLEVSFDVGDAEDDC----------- 95

Query: 171 IPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPF--TTAQITQKTTQCL 228
           +P     +  +I V + +  E EP  + K             IP   +   I   +TQ  
Sbjct: 96  LPTQADGKPEQIEVNVGTAPE-EPFSRIK-------------IPLKLSDGGIFSPSTQVD 141

Query: 229 NNHGATSQ-TQQIPPTKPS--------EAQTQADVATAND---SDTQQKVPMLTTETSPL 276
           +      Q TQ++PP  P+        E Q + +   A D   S +Q +V +  T   P 
Sbjct: 142 DEMAMQLQPTQKLPPESPALQAVDTHTELQDELETGVAVDGRISLSQTQVIVSGTNYGPT 201

Query: 277 FQTVPDQSPSTQ---MNTPPPTVHDDRTQMDTVAQTMQDKVPPT----------LKIHEL 323
              V D+  +TQ   M T      D +T    +A   Q  +P            L IH++
Sbjct: 202 --RVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPDAQTLATARHEKLFIHQI 259

Query: 324 QSELAL----EDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLES 379
           + E+A     E     +A+   Y   QK +     F+K++FL  FD+ S  E  +  L+ 
Sbjct: 260 EEEIATKTQKELPMMTQAKEAPYIPKQKLV-----FTKDNFLDSFDDDSETE-IHGGLDG 313

Query: 380 SQPKQQQNGYEMIDISQSNPQPAEKENKKDKKV--PLLSTYANNLKREIDSSKCITLDLD 437
           S  +   N  E  +    + QPA  E + D +V  P L + +   K   ++ + I   LD
Sbjct: 314 SDRQVSYNDREHTETGPQSSQPATGEGQ-DTQVLYPALQSLSITSKSYQEARQII---LD 369

Query: 438 SGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDFKSD 497
             S+ D D ++              S +SKA +  +KAR    N K       ++   S 
Sbjct: 370 ESSEDDTDVNLS-------------SAVSKAAVLAIKAR----NSKFITPQKIDETKSSK 412

Query: 498 HNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEI 546
            N+L   LRKA+R+Q+L+ +R  +E +G  ++++ +E+E + +LLEQE+
Sbjct: 413 SNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQEL 461

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/363 (35%), Positives = 180/363 (49%), Gaps = 46/363 (12%)

Query: 754  TKLKELKSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHE 813
             KL++L     +             WHG+GG DGE  D++DS++EKMIDDYS ++F+S E
Sbjct: 641  AKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSE 700

Query: 814  IREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXX 873
            +R+    E    D  M+NKIL+DI+ GGFR KR +N             L +Y       
Sbjct: 701  VRKRQIEEEISEDKSMVNKILHDIETGGFR-KRGRNALDLELSDDDDEELLKYHSRRKEL 759

Query: 874  XXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVT--STATDLDTQ 931
                    G+   L +NPKSKAFFE++VEDI   ++    E E    V   S+    + +
Sbjct: 760  LRQKVSAQGEAKLLAENPKSKAFFETIVEDI---RSKGALEDEGPPPVRGFSSVNAPEEK 816

Query: 932  DNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFE-----MDREL 986
            ++D+ K G                KK ++SE FVQ++LSFL S    E +     +    
Sbjct: 817  NSDSDKKG----------------KKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLP 860

Query: 987  ARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGD 1046
              +   N E +  D+F LKQ+SSIKS +    NS      N +I+ +E            
Sbjct: 861  THVPSFNTE-ETQDIFALKQNSSIKSLSAPTRNS-----SNMLIDDQE------------ 902

Query: 1047 QSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMA 1106
              L+   +  S    F  R D N+KF+EG KTV+   SYK  GSSKASITY+GK RKL A
Sbjct: 903  -DLLSRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNA 961

Query: 1107 PKR 1109
            PK+
Sbjct: 962  PKK 964

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 53/82 (64%)

Query: 467 KATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGF 526
           KA I +LKARLSK++Q L    +K     S H  L  +LRKA++ QILD+++E  ++KG 
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 527 KLEDMVKEKEIVEDLLEQEILR 548
             + + +EK  +E LLE+E+ R
Sbjct: 420 DYDKITEEKNSIESLLERELAR 441

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 67/132 (50%), Gaps = 28/132 (21%)

Query: 85  GMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQDGQDK---ENEDEDVFSTQLIANLY 141
           G ++ P +TG GFLFGN+ L RVK+RL G +E  +    K   +N   D+  TQ++   Y
Sbjct: 24  GCDSLPLVTGTGFLFGNSVLRRVKSRL-GDDENHEADSTKSPIDNGCCDLSQTQVVGLAY 82

Query: 142 DGGEELE-------------------SKSNGDKNNQKVNVSSFTQTQRIPVS---ITQQN 179
           D GE+LE                   +K N  K+ ++V+ ++ T  +RIP S    T+ N
Sbjct: 83  D-GEDLEQDFADSTARIEGKSWAGPTNKPNYPKDKRRVSSNNSTVERRIPRSELESTEVN 141

Query: 180 NEINVPIHSINE 191
            ++  P H + E
Sbjct: 142 TQLISP-HQVKE 152

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  160 bits (404), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 132/390 (33%), Positives = 182/390 (46%), Gaps = 56/390 (14%)

Query: 754  TKLKEL---KSKGVTNFFXXXXXXXXXXWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFN 810
             K+KEL   K+ G+ +F           W GVGGADGE SD YDSE+++MIDDYS  K +
Sbjct: 625  AKMKELNRSKANGMIDF---EAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSD 681

Query: 811  SHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXX 870
               +R+ L  E K  D  M+++IL+DI+NGGFR KR +              L +Y    
Sbjct: 682  PEFLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGRYAMDLTLSDDEDDDLLRYHARR 740

Query: 871  XXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDT 930
                        + + L  NPKSKAFF+S+ ED  + K      KE      S A+ L  
Sbjct: 741  KELLNERKSGNQEISVLATNPKSKAFFDSIFED--DLKGGIANLKE----YQSHASPLKA 794

Query: 931  QDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARI- 989
                     D  S     +          ISE FVQK+LSFLKS   DE + D E   + 
Sbjct: 795  -------AKDEISGKRETR----------ISEQFVQKTLSFLKSKE-DE-QGDAEFVSVA 835

Query: 990  ---QHGNGE-GDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENG 1045
               +  +G+  +  D + LKQ S IKSF+    +S+  +  N                  
Sbjct: 836  DTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNK----------------- 878

Query: 1046 DQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLM 1105
               ++ G  + ++++ F    D N+KF+EG KTVK   SYK  GSS+ASIT++GK R L 
Sbjct: 879  -DGVLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLK 937

Query: 1106 APKRKTEENHHPNHIKKSKTQKSKLFENGQ 1135
            A KR       P H +K  T       +GQ
Sbjct: 938  ARKRGPHARSAP-HGQKIMTSHQFFASDGQ 966

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%)

Query: 466 SKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKG 525
           SKA I +LKAR+SK+ Q LA  S+K     +    L ++LRKA+R Q+++H+  ++  +G
Sbjct: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397

Query: 526 FKLEDMVKEKEIVEDLLEQEILR 548
             L ++ KEKE VE LLE+E+ R
Sbjct: 398 VDLAEIAKEKESVESLLERELAR 420

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 90  PALTGNGFLFGNATLNRVKNRLEGR--NELGQDGQDKENED--EDVFSTQLIANLYDGGE 145
           P + G GFLF N+  N+VK R++    NE+  +     + +  +D   TQ I   YD GE
Sbjct: 30  PTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQAIERPYD-GE 88

Query: 146 ELES 149
           ELE+
Sbjct: 89  ELET 92

>Kpol_1024.31 s1024 (90996..93569) [2574 bp, 857 aa] {ON}
           (90996..93569) [2574 nt, 858 aa]
          Length = 857

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 16/135 (11%)

Query: 193 EPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQI---------PPT 243
           E  + A +  S+ TTS ++ + F  +   QK    L N   +S  Q +         PP 
Sbjct: 664 ERLRDAMSNFSIFTTSISKGLQFYES--LQKMVSHLQNISKSSTKQNVFSSPTIDSPPPL 721

Query: 244 KPSEAQTQADVATANDSDTQQKVPMLT--TETSPLFQTVPDQSPSTQM-NTPPPTVHDDR 300
           +P  ++  + +   N S      PM    T  +P+  ++P  +P++   N PPP  ++  
Sbjct: 722 QPRPSELVSGMRDLNISSNANAQPMTVPITAQAPVSMSIPVPAPASSYSNAPPP--YNVT 779

Query: 301 TQMDTVAQTMQDKVP 315
            Q  +++Q    ++P
Sbjct: 780 NQHSSLSQRPAPQIP 794

>Smik_4.378 Chr4 complement(680000..681484) [1485 bp, 494 aa] {ON}
           YDR132C (REAL)
          Length = 494

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 36/88 (40%), Gaps = 15/88 (17%)

Query: 348 TIPIVKRFSKESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEK--- 404
           T P +  FS  SFL + +  S+DE     L   QP           I +  P  AEK   
Sbjct: 266 TFPAISTFSTSSFLEE-NFCSADECGTSSLPCDQPV----------IKKIKPNIAEKYKD 314

Query: 405 -ENKKDKKVPLLSTYANNLKREIDSSKC 431
             N    K P L  YA  L  +IDS+ C
Sbjct: 315 SWNMLCYKRPFLDDYARELLFQIDSTDC 342

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 174 SITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGA 233
           S+  QN  +  P  +  +G+PT    N+ +V+ ++   + PFTT Q T  +   +NN G 
Sbjct: 280 SMHPQNTPLAPPHTTTAKGQPTNSLLNKANVVVSTLGFS-PFTTKQPTASSVGKVNNRGK 338

Query: 234 TSQTQQIPPTK 244
              T   PP+K
Sbjct: 339 VLST---PPSK 346

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,672,546
Number of extensions: 5666283
Number of successful extensions: 38468
Number of sequences better than 10.0: 1006
Number of HSP's gapped: 39736
Number of HSP's successfully gapped: 1209
Length of query: 1140
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1019
Effective length of database: 39,606,813
Effective search space: 40359342447
Effective search space used: 40359342447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)