Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1511.4ON42142121460.0
YCL063W (VAC17)1.4ON42342316720.0
Skud_3.21.4ON42642616680.0
Smik_3.131.4ON42542616490.0
TDEL0C069801.4ON4264475671e-67
ZYRO0F18502g1.4ON4503525105e-59
Kpol_2002.71.4ON4744884582e-51
KNAG0C001901.4ON4424734283e-47
CAGL0B00308g1.4ON4304534231e-46
SAKL0C00440g1.4ON4623614172e-45
NDAI0A001301.4ON4784994172e-45
TPHA0E040201.4ON5405363922e-41
NCAS0B091201.4ON4334503662e-38
TBLA0A075801.4ON5133212944e-28
KLLA0C00462g1.4ON4603752759e-26
Kwal_33.130031.4ON4492462298e-20
KAFR0D001201.4ON3994672154e-18
KLTH0F00462g1.4ON4512442013e-16
CAGL0D01672g3.340ON1014156713.5
Suva_5.1507.217ON39138678.0
NCAS0F014802.444ON625124688.3
Smik_6.1703.425ON93480679.9
NOTE: 2 genes in the same pillar as Suva_3.151 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.151
         (421 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   831   0.0  
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   648   0.0  
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      647   0.0  
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   639   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   223   1e-67
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   201   5e-59
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   181   2e-51
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   169   3e-47
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   167   1e-46
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   165   2e-45
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   165   2e-45
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   155   2e-41
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   145   2e-38
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   117   4e-28
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   110   9e-26
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    93   8e-20
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    87   4e-18
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    82   3e-16
CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa] ...    32   3.5  
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    30   8.0  
NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {O...    31   8.3  
Smik_6.170 Chr6 (280902..283706) [2805 bp, 934 aa] {ON} YGR089W ...    30   9.9  

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/421 (96%), Positives = 408/421 (96%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60
           MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180
           QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180

Query: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFF             T
Sbjct: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFPFFKPSNPTFG 300
           IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFPFFKPSNPTFG
Sbjct: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFPFFKPSNPTFG 300

Query: 301 TSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSFLD 360
           TSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSFLD
Sbjct: 301 TSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSFLD 360

Query: 361 KFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTELL 420
           KFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTELL
Sbjct: 361 KFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTELL 420

Query: 421 L 421
           L
Sbjct: 421 L 421

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/423 (76%), Positives = 364/423 (86%), Gaps = 2/423 (0%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60
           MATQALEDITERLL RS+EAILQLDLWIQRQQRSS+C+ +D++SLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLV EFQDIT+RLN+LATVPN+A NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180
           QSQSTRSSL SFQPRPLKIIERQRLC+VTPSKPPKKSV FNPIN+V+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180

Query: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           KQP +  TLRAAKSHDTGLNKSKKPSS+D YESFFKN+QRLSLTFF             T
Sbjct: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSF--PFFKPSNPT 298
           IILPNISTP H+ +  KGAEFEPLRRYNSHESILSNKPAP+ SL+LGSF   FF+PSNPT
Sbjct: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300

Query: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358
           FGTS+SNVQVN  P +AA+M P RNG R  +SKALLSSFIA+ D   VK+ +TNLKH SF
Sbjct: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360

Query: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTE 418
           +DKFNSSLSTISESFQ+K+G+K+  +N++RI  H + +   N MD+ VSIEELQDALNTE
Sbjct: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNTE 420

Query: 419 LLL 421
           LL 
Sbjct: 421 LLF 423

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/426 (79%), Positives = 363/426 (85%), Gaps = 5/426 (1%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60
           MATQALEDITERLL RS+EAILQLDLWIQRQQRSSVC+ SD++SLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLVHEFQDIT RLN+LATVP+  SNDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180
           QSQSTRSS  SFQPRPLKIIERQR+C+VTPSKPPKKSV FNPINDV+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           K P K  TLRAAKSHDTGLNKSKK SSTDAYESFFKNKQRLSLTFF             T
Sbjct: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFP--FFKPSNPT 298
           IILPNISTP HM++  KGAEFEPLRRYNSHESILSNKPAP MSLSLG FP  F+KPS+PT
Sbjct: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300

Query: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358
           FGTS SNVQV+  P +  SM  +RNG  AP+SKALLSSFIA+PDRI  KQ  TNLKHTSF
Sbjct: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360

Query: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIP--PHIMP-EHNNNLMDMGVSIEELQDAL 415
           LDKFNSSLSTISESFQNKKGKK+ D+ND RI    HI   E   N+MDM VSIEELQDAL
Sbjct: 361 LDKFNSSLSTISESFQNKKGKKNKDVNDGRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420

Query: 416 NTELLL 421
           NTELL 
Sbjct: 421 NTELLF 426

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/426 (77%), Positives = 366/426 (85%), Gaps = 6/426 (1%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60
           M TQALEDITERLL RS+EAILQLDLWIQRQQRSSVC+ +D++ LDK+S+QYNQYMSQLN
Sbjct: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLV EFQDIT+RLN+LAT PN+ +NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180
           QSQSTRSSL+SFQPRPLKIIERQRLC+VTPSKPPKKSV FNPINDV+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           KQP K HTLRAAKSHDTGLNKSKKPSS DAYESFFKN+QRLSLTFF             T
Sbjct: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFP--FFKPSNPT 298
           +ILPNISTP H+++  KGAEFEPLRRYNSHESILSNKPAP MS SLGSFP  FFKPSNPT
Sbjct: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300

Query: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358
           FGTS+SNVQ N  P + A+M P+RNG  AP+SKALLSSFI + +R +VKQ + NLKH S 
Sbjct: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360

Query: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIPP--HIMP-EHNNNLMDMGVSIEELQDAL 415
           LDKFNSSL+TISESFQ+KK KK+ DLND+RI    HI   + NN +MDM VSIEELQDAL
Sbjct: 361 LDKFNSSLTTISESFQSKK-KKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419

Query: 416 NTELLL 421
           NTELLL
Sbjct: 420 NTELLL 425

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  223 bits (567), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 178/447 (39%), Positives = 244/447 (54%), Gaps = 58/447 (12%)

Query: 6   LEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYVR 65
           LED++ERLLTRS+EAILQL+LWIQRQQ     E S   S+DKL  QYN Y++QLNSL VR
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS---SIDKLGNQYNVYIAQLNSLCVR 59

Query: 66  SESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQST 125
           SE VRDKL+KE+ RR++   N+ K IEDLV EFQDITV+LN+LA   +++ + +P S+ST
Sbjct: 60  SEYVRDKLNKERERRMSI-INDRKYIEDLVFEFQDITVKLNELAQ--SQSIDSTPSSKST 116

Query: 126 RSSLDSFQPRPLKIIERQRLCVVTPSKPP------KKSVVFNPINDV--ECPSKTNSLPC 177
           RSSL SFQPRPLK+ ER    V    + P       KSV F+ ++D   E  SK  SLP 
Sbjct: 117 RSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176

Query: 178 SPKKQPGKAHTLRAAKSHDTGLNK--SKKPSSTDAYE--SFFKNKQRLSLTFFXXXXXXX 233
           SP +  G   ++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T F       
Sbjct: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDA 236

Query: 234 XXXXXXTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFPFFK 293
                   ++  +       +        PLRR+NSHESILS K  P  SL L S  F  
Sbjct: 237 DSTSDQDTVISLVPADDGKGL--------PLRRFNSHESILSTKVQPISSLPLFS-SFLL 287

Query: 294 PSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNL 353
           PS+     S+ +V+V+  P  + +  P        +S+ LLS+F+ +P +      +T +
Sbjct: 288 PSSNR--PSMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFVTRPGK---ASNATGI 335

Query: 354 KHTSFLD-----KFNSSLSTISESFQNKKGKKS-----SDLNDDR-------IPPHIMPE 396
           K  + L       F    S+ S   +  K K S     S+  D R        P    P 
Sbjct: 336 KQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFSPR 395

Query: 397 H--NNNLMDMGVSIEELQDALNTELLL 421
                 + D  +S E+L++AL+TE++L
Sbjct: 396 SPVKAPVFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  201 bits (510), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 149/352 (42%), Positives = 196/352 (55%), Gaps = 31/352 (8%)

Query: 5   ALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYV 64
           +L+DI+ERL  RS+EA+LQL+LWI+RQQ  S  E     + DK++ QYN YM+QLNSL V
Sbjct: 3   SLDDISERLFIRSQEAVLQLELWIRRQQHLSEIE--HEHARDKIADQYNLYMAQLNSLCV 60

Query: 65  RSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQS 124
           RSE VRDKL+     R     NE   IEDLV+EFQDITV+LN+LA   N+    +P S+ 
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118

Query: 125 TRSSLDSFQPRPLKIIERQRLCV-VTPSKPPKKSVVFNPINDVE-------CPSKTNSLP 176
           +  S++SFQPRPLKI ER R  +  T   P + +     +N VE       CPSK  SLP
Sbjct: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178

Query: 177 CSPKKQ--PGKA--HTLRAAKSHDTGLNKSKKPSSTDAYE----SFFKNKQRLSLTFFXX 228
            SP K   P +     LR AKS+DTGLN + +       E    S FK  QRLS+TF   
Sbjct: 179 GSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238

Query: 229 -XXXXXXXXXXXTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLG 287
                       T+I  +   PSH       +E  PLRRYNSH+S+LS K  P  S    
Sbjct: 239 IDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298

Query: 288 SFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIA 339
           +F     +N     S+ +V V+  P ++++      G +A +SK LLSSFI+
Sbjct: 299 TFLTIPTAN---RPSMKSVTVSSAPIISST------GGKA-SSKDLLSSFIS 340

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  181 bits (458), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 180/488 (36%), Positives = 246/488 (50%), Gaps = 82/488 (16%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPS-DRDSLDKLSQQYNQYMSQL 59
           M    ++D++ERLL RS+EAILQLDLWIQRQQ+ +  + + D + L+K++  YN YMSQL
Sbjct: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60

Query: 60  NSLYVRSESVRDKLSKEQWRRLNT---------EENEHKRIEDLVHEFQDITVRLNDLAT 110
           NSLY+RS++VRDKL+ ++  R NT           N    IEDL+ EFQDIT +LN LA+
Sbjct: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAS 120

Query: 111 VPNKASNDSPQSQSTRSSLDSFQPRPLKI-IERQRLCVVTPSKPPKKSVVFNPINDVECP 169
              + S+ S  S S  SS+ SFQP+PLKI ++R +    +  +  KK+V F    DVE  
Sbjct: 121 SRRRCSS-SKSSSSRSSSIGSFQPKPLKISLKRNK----SLKEQNKKTVTF----DVEEV 171

Query: 170 SKTN-----SLPCSP----KKQPGKAHTLRAAKSHDTGLN-----KSKKPSSTDAYESFF 215
           +  N     SLP SP    +  P   H LR AKS+DTGLN     K KK      Y+S F
Sbjct: 172 TDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTF 231

Query: 216 KNKQRLSLTFF---XXXXXXXXXXXXXTIILPNISTPSHMD-----MATKGAEFEPLRRY 267
           KN QRLS++ F                T+I    S+   MD     +  +    +PLRRY
Sbjct: 232 KNTQRLSISLFDIDTNENDITNISDQETVIS---SSSLTMDEPLEIIDDQKNNLKPLRRY 288

Query: 268 NSHESILSNKPAP-AMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSR 326
           NSHESILS K  P ++S      PF   S  T  T+      N   K  A    K N S 
Sbjct: 289 NSHESILSTKIRPISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVK--ADDFYKPNLSN 346

Query: 327 APTSKALLSSFIAQPD-------RIVVKQKSTNLKHTSFLDKFN---------------S 364
           + TSK +LS +  + D        I+  +K +N   TSF +K+N                
Sbjct: 347 STTSKDILSMYSIKNDVQNSNRGNIINNKKESN-SSTSFFNKWNIFNFPLIASSEVGSKQ 405

Query: 365 SLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLM-----------DMGVSIEELQD 413
             +T ++ F +++ K+ S L+ ++     M    N  M              VS +EL D
Sbjct: 406 ENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHD 465

Query: 414 ALNTELLL 421
           ALNTEL L
Sbjct: 466 ALNTELDL 473

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  169 bits (428), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 158/473 (33%), Positives = 232/473 (49%), Gaps = 89/473 (18%)

Query: 5   ALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPS--DRDSLDKLSQQYNQYMSQLNSL 62
            LED+T+RLL RS++AILQL+LW+Q+Q++  + + +  DR   + ++QQ N ++SQLNSL
Sbjct: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62

Query: 63  YVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQS 122
            +RS  +++KL+ E+    +  +     IE+LV+EFQDI + LN+L+    K  N SP S
Sbjct: 63  CLRSRYIKEKLASER-NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSPVS 119

Query: 123 QSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKT---------- 172
           Q+T +S DSF+P+PL+I+ERQR C      P K++      N ++ P +T          
Sbjct: 120 QATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNS-----NHIKIPRETEKSDFTENVA 172

Query: 173 ----NSLPCSP-KKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFX 227
               +SLP SP +   G   T+R  KS+   LN  +KP+S     + F  K RLSL  F 
Sbjct: 173 DCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFD 231

Query: 228 XXXXXXXX------XXXXTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS-NKPAP 280
                             T++    ++P    + +KGA FEPLRRYNSHESILS  K AP
Sbjct: 232 NIDEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAP 284

Query: 281 AMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQ 340
             S S     F+ PS     TS  +V V+ +P     +      S    SK LLSS    
Sbjct: 285 IHS-SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPL------SVQSRSKDLLSS---- 332

Query: 341 PDRIVVKQKSTNLKHTSFLDKFNSSLSTISESFQNKKG------KKSSDLNDDR------ 388
              I   + S + K TS  + +N    + + +  ++ G      KK S +  +R      
Sbjct: 333 ---IAHAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGD 389

Query: 389 -----------------IPPHIMPEHNN---NLMDMGVSIEELQDALNTELLL 421
                              PH    H +    ++D  V   EL +AL TELLL
Sbjct: 390 TLVISTSNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALETELLL 442

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  167 bits (423), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 152/453 (33%), Positives = 241/453 (53%), Gaps = 61/453 (13%)

Query: 5   ALEDITERLLTRSEEAILQLDLWI--QRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      S  DS+++L  +Y +++ +LNSL
Sbjct: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62

Query: 63  YVRSESVRDKLSKEQWRRLNTEENE--HKRIEDLVHEFQDITVRLNDLATVPNKASND-- 118
           Y+RS+ ++DK+  E+  +    ++E    RI++L+ EF++IT+ LN++A   ++ ++   
Sbjct: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122

Query: 119 SPQSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKK-SVVFNPINDVECPSKTNSLPC 177
           SP S ST+SSL+SF P+PLKI+ R  +     + PPKK ++ F PI++    ++  SLP 
Sbjct: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYESLPS 182

Query: 178 SPKKQ---PGKAHTLRAAKSHDTGL--NKSKKPSSTDAYESFFKNKQRLSLTFFXXXXXX 232
           SP +      +   L  A+S  TGL   K++KP   +  + +FK+KQRLSLT F      
Sbjct: 183 SPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDK-NQLDKYFKDKQRLSLTLFGSADAD 241

Query: 233 XXX-------XXXXTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS--NKPAPAMS 283
                         T+I    ++ S+++      + +P+RR NSHES+LS  NK  P  +
Sbjct: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298

Query: 284 LSLGSFPFFKPSNPTFGT---------SVSNVQVNYRPKMAA-SMIPKRNGSR--APTSK 331
            +L      +P      T         S+ N+QV+    ++  S    R  ++  + TSK
Sbjct: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358

Query: 332 ALLSSFI-AQPDRIVVKQKSTNLKHTSFLDKFNS--SLSTISESFQNKKGKKSSDLNDDR 388
            LL+S + A P   +  Q++  L   +F DKFNS  + STISE     + K + + N   
Sbjct: 359 DLLTSVMTATP---ITTQRNNKL---TFFDKFNSMFNFSTISE-----EQKTTVEKNRSA 407

Query: 389 IPPHIMPEHNNNLMDMGVSIEELQDALNTELLL 421
             P       N+     VSIEEL +AL T +++
Sbjct: 408 ESPR------NDF----VSIEELNEALTTNMVM 430

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  165 bits (417), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/361 (36%), Positives = 191/361 (52%), Gaps = 39/361 (10%)

Query: 4   QALEDITERLLTRSEEAILQLDLWIQRQQR---SSVCEPSDRDSLDKLSQQYNQYMSQLN 60
           + L +I+++LL RS+EAILQLDL+IQRQQR       +  D   L KL Q+Y   ++QLN
Sbjct: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SL++RSE +RD+++    R       +   I  LV EFQ IT +LN+LA   ++A   SP
Sbjct: 61  SLHIRSEHLRDRIASTDHR----ASQDGDSIGHLVTEFQKITTKLNELAATQDRAYQ-SP 115

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLC--------VVTPSK---PPKKSVVFNPINDVECP 169
            SQST+ S+ SF+P+PLKI+ER +L         V TP K   P +K+  F+        
Sbjct: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 170 SKTNSLPCSPKKQPGKAHTL------RAAKSHDTGLNK-SKKPSSTDAYESFFKNKQRLS 222
           SK+ SLP SP        ++      R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234

Query: 223 LTFFXXXXXXXXXXXXXTIILPNISTPSHMDMATKG-AEFEPLRRYNSHESILSNK---P 278
           ++FF               + P  +T      + KG  + EPLRRYNSHES+LS K   P
Sbjct: 235 ISFFDDEIDYSSDEDTVISVSPPETT------SFKGFPKAEPLRRYNSHESVLSRKEVLP 288

Query: 279 APAMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFI 338
           A A+    G F  +   N        +V +N +P  + + + + +     TSK LL+ F+
Sbjct: 289 A-ALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQFV 347

Query: 339 A 339
           +
Sbjct: 348 S 348

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  165 bits (417), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 242/499 (48%), Gaps = 99/499 (19%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQR---QQRSSVCEPSDRDSLDKL-SQQYNQYM 56
           M+T  L+DITERLL RS+EAILQLDLWIQR   QQ  S    S+  + D + +QQYN Y+
Sbjct: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59

Query: 57  SQLNSLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNK-- 114
           +QLNSL VR + +RDK       +L++ ++E K IE+LV+EF+ IT++LNDL+   NK  
Sbjct: 60  AQLNSLIVRVQYIRDKF-LHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSK-KNKTT 117

Query: 115 -ASNDSPQSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDV----ECP 169
            +S +S ++ S++SS++SF+P+PLKII+R +          K S   N  +D+    E  
Sbjct: 118 SSSENSSKTASSKSSMESFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENL 170

Query: 170 SKTNSLPCSPKKQPGKA------HTLRAAKSHD--TGLNKSKKPS-------STDAYESF 214
            + NSLP SP ++            LR  KS D  T  N S+  +         D    F
Sbjct: 171 QRPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQF 230

Query: 215 FKNKQRLSLTFFXXXXXXXXXXXXXTI--ILPNISTPSHMDMAT---KGA------EFEP 263
           FK++QRLS+  F             T   I     T ++ D AT   +G       +F P
Sbjct: 231 FKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTP 290

Query: 264 LRRYNSHESILSNKPAPAMSLSLGSFPFFKPSNPTFGT----SVSNVQVNYRPKMAASMI 319
           LRRYNSHESILS K +    +   +   F    P + +    S+ ++ V   P  A S  
Sbjct: 291 LRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTSNPIFARS-- 348

Query: 320 PKRNGSRAPTSKALLSSFIA-------------------------QPDRIVVKQKSTN-- 352
                S+  TSK LLSSF+                          Q     + Q ST+  
Sbjct: 349 -----SQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTSTSSF 403

Query: 353 LKHTSFLDKFNSSLSTISESFQNKKG----------KKSSDLNDDRIPPHIMPEHNNNLM 402
             + +FL++FN   S  + +   K+             + D+ND      I       + 
Sbjct: 404 FGNWNFLNRFNMITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISIKEP----VY 459

Query: 403 DMGVSIEELQDALNTELLL 421
           D  +S+++L+DALNTELLL
Sbjct: 460 DNTISLDDLEDALNTELLL 478

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  155 bits (392), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 169/536 (31%), Positives = 236/536 (44%), Gaps = 125/536 (23%)

Query: 6   LEDITERLLTRSEEAILQLDLWIQRQQR-------SSVCEPSDR-----DSLDKLSQQYN 53
           LE+++E+LL RS+EAILQLDLWI RQQ+        +  +  ++     ++L+ L   Y+
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 54  QYMSQLNSLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPN 113
            YMSQLNSLYVRSE +RDKL+ E+   +N    +H+ IE+LV EFQ+I  +LN LA   +
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEK-NNVNKFNLDHRNIEELVFEFQNIREKLNQLA-ASS 125

Query: 114 KASNDSPQSQSTR-SSLDSFQPRPLKIIER--QRLCVVTPSKPPKKSVVFNPINDVECPS 170
           K    SP   STR SS++S   +PLK++ +  +R+      K  +KSV F    +     
Sbjct: 126 KLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGK--ETRISL 183

Query: 171 KTNSLP----------CSPKKQPGKAHTLRAAKSHDTGLN---KSKKPSSTD-------A 210
            TN +            SP+    K   LR A S+DTGLN   KS K S+ +       A
Sbjct: 184 TTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDAA 243

Query: 211 YESFFKNKQRLSLTFFXXXXXXXXXXX----------------------XXTII----LP 244
           Y+S FKNKQR S++ F                                   T+I    LP
Sbjct: 244 YDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVISSSHLP 303

Query: 245 NI----------STPSHMDMATKGAEFEP----LRRYNSHESILSNKPAPAMSLSLGS-- 288
            I          S    +D        E     LRR NSHESILS K       ++GS  
Sbjct: 304 CITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKNVGSNF 363

Query: 289 ---FPFFKPSNPTFGTSVSNVQVNYRPKMAAS---------MIPKRNGSRAPTSKALLSS 336
              F F     PT   SVS    N  P ++            +P  + +R  TS+ LLS 
Sbjct: 364 YDRFIFSSFYRPTVA-SVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGVTSRELLSK 422

Query: 337 FIAQPDRIVVKQKSTNLKHTSFLDKF---------------NSSLSTISESFQNKK---- 377
           F  +P+++     S +     F + +               N+S S I  S   KK    
Sbjct: 423 FADKPEQLKAPTTSNSNSSKYFFENWGLFSSMSSSSTFHRKNTSGSNIISSEVGKKLCDR 482

Query: 378 --GKKSSDLNDD--------RIPPHIMPEHN--NNLMDMGVSIEELQDALNTELLL 421
             G K + +N          R   H + + N  N ++   VS  EL DALNTE+ L
Sbjct: 483 STGIKVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEIKL 538

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 219/450 (48%), Gaps = 54/450 (12%)

Query: 6   LEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSD---------------RDSLDKLSQ 50
           L+DI+ERLL RS+EAILQLD+WIQRQ+R       +               R +L +  +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQWRRLNTEENEHKRIEDLVHEFQDITV 103
           QYN YM+QLNSL VR E +RD L        + Q    N   +E K I+DLVHEFQDIT 
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123

Query: 104 RLNDLATVPNKASNDSPQSQSTRSSLDSFQPRPLKIIERQRL-CVVTPSKPPKKSVVFNP 162
           +L++L+TV N ++  S +S ST+SS++SF+P+PL+II R      +       K V FN 
Sbjct: 124 KLSELSTVRNPSTASS-RSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182

Query: 163 INDVECPSKTNSLPCSPKKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLS 222
                  S + S+    +     + +LR  KS D  L +S   + +D +     ++QRLS
Sbjct: 183 DESNSSISHSRSMESLHE----NSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236

Query: 223 LTFFXXXXXXXXXXXXXTIILPNISTPSHMDMAT--KGAEFEPLRRYNSHESILSNKPAP 280
           +  F                  +    + +   T  +GA+   LRRYNSHESILS +   
Sbjct: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGADTPLLRRYNSHESILSFRKPT 296

Query: 281 AMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIA- 339
                    P+     P    S+ +V VN  P + + M P        TSK LLSSFI  
Sbjct: 297 QSRQPNQILPYSSVRQP----SMQSVAVNSNP-IFSRMRPN------ATSKDLLSSFINK 345

Query: 340 -QPDRIVVKQKSTN----LKHTSFLDKFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIM 394
            QP+R+  ++   N        +F +KFNS  S I  +        SS  N  +  P+ +
Sbjct: 346 PQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLYPTNSSMSN--KFNPNDI 403

Query: 395 PEH---NNNLMDMGVSIEELQDALNTELLL 421
           P        + D  + +E+L DALNTELLL
Sbjct: 404 PSSASIREPVFDDSLHLEDLNDALNTELLL 433

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  117 bits (294), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 101/321 (31%), Positives = 151/321 (47%), Gaps = 59/321 (18%)

Query: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQ---RSSVCEPSDRDSLDKLSQQYNQYMS 57
           MA Q  E+++ RLLT+++EA+LQLDLWI+ QQ          S  +SL++  + YN+YM 
Sbjct: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMF 58

Query: 58  QLNSLYVRSESVRDKLSKEQWRRL------NTEENEHKRIEDLVHEFQDITVRLNDLATV 111
           QLNSLY+R++ +RDK+ K+    L        + N H  ++ LV EF  +++++N+L+ +
Sbjct: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118

Query: 112 PNKASNDSP----QSQSTRSSL----DSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPI 163
               +N S     +S  +  SL    D FQPRPLKI++RQ+      + P          
Sbjct: 119 QENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQP-------- 170

Query: 164 NDVECP------SKTNSLPCSPKKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYE----- 212
            D+E P      S  N L  S KK+        + KS +  L     P    ++E     
Sbjct: 171 -DLESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFS 229

Query: 213 ---------------SFFKNKQRLSLTFFXXXXXXXXXXXXXTIILPN---ISTPSHMDM 254
                          S FK   RLS+ F               I   +   +STP  +  
Sbjct: 230 VANTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPK-IAS 288

Query: 255 ATKGAEFEPLRRYNSHESILS 275
           + K    EPLR++NSHESILS
Sbjct: 289 SIKNTS-EPLRKFNSHESILS 308

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  110 bits (275), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 114/375 (30%), Positives = 181/375 (48%), Gaps = 67/375 (17%)

Query: 9   ITERLLTRSEEAILQLDLWIQRQQRSSVCE--PSDRDSLDKLSQQYNQYMSQLNSLYVRS 66
           + ERL+ R  EA++QL+L IQR+    +CE  P++     ++ Q+Y  ++++L+SL +R+
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQV-QEYYSFLARLSSLKLRA 61

Query: 67  ESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSPQSQSTR 126
           E V++ L + Q +  N    E++ +E L++EFQDIT+ LN++A      +  +    S  
Sbjct: 62  EHVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKSARSGSSKE 120

Query: 127 SSLDSFQPRPLKIIERQR--LCVVTPSK---------------PPKKSVVF-----NPIN 164
           SS+     + LKIIER R  L   +P K               P K++V F     + ++
Sbjct: 121 SSVIPL--KTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILH 178

Query: 165 DVECPSKTNSLPCSP-------KKQPGKAH-TLRAAKSHDTGLNKSKKPSSTDAYESFFK 216
            +    + NSLP SP        +   + H TLR AKS+D GLN   K    +A   FFK
Sbjct: 179 HLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KNADWEFFK 235

Query: 217 NKQRLSLTFF-XXXXXXXXXXXXXTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS 275
           NK RLSL+ F              ++  PNIS   ++         + +RR NSHESILS
Sbjct: 236 NKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESILS 293

Query: 276 NK---PAPAMSLSLGSFPFFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPT--- 329
            K   P+   +L +          PT+ +      +  +P ++ S     N + +PT   
Sbjct: 294 RKILSPSTPANLIM---------RPTYQSVWQKKAIVTKPTISCST---SNSTASPTIGS 341

Query: 330 ---SKALLSSFIAQP 341
              SK +LS F+  P
Sbjct: 342 PHLSKDMLSQFVTAP 356

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 123/246 (50%), Gaps = 36/246 (14%)

Query: 4   QALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQ---QYNQYMSQLN 60
           + L  I +  L RSEEA+++L+  + +Q+R    E SD+   ++ S    QY  Y+ QLN
Sbjct: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
            LY++++S++D +        N+ +   + IE L H+++ +    N+L  +  K   DSP
Sbjct: 62  CLYIKAQSLKDMMGNRCGHLPNSTQ---EAIERLEHDYKALCNHANELG-IREKNLEDSP 117

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPS---------- 170
              S  +S+ SFQP+PLKIIER+   +   +  P K      +    C S          
Sbjct: 118 SCLSP-ASVSSFQPKPLKIIERR---LAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIP 173

Query: 171 ----KTNSL----PCS--PKKQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQR 220
               KTNS     PC+   KK+P     +R  KS  TGLNK   P       SFF+++QR
Sbjct: 174 DEIGKTNSCNTNSPCTNEAKKEP---KFIRVVKSCGTGLNKHSNPHENRL--SFFRDRQR 228

Query: 221 LSLTFF 226
           LS++F 
Sbjct: 229 LSISFI 234

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 126/467 (26%), Positives = 202/467 (43%), Gaps = 128/467 (27%)

Query: 9   ITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSLYVRSES 68
           +++ LL RSEEA+ QL+ W+++Q              ++L Q   +Y  QLNSL  +S+ 
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQ--------------EQLHQTTAEY-KQLNSLCAKSKY 49

Query: 69  VRDKLSKEQWRRLNTEENEHKR----IEDLVHEFQDITVRLNDLATVPNKASNDSPQSQS 124
           + + L K+    +  +  E K     +E L+HEF +I+ +LN++ T      + SPQ   
Sbjct: 50  ISNLL-KDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVT------HTSPQ--- 99

Query: 125 TRSSLDSFQPRPLKIIERQRLCV-------VTPSKPPKK-SVVFNPINDVECPSKTNSLP 176
             S++DSF+P+PL ++ + ++         VT  +  +K S+   P+      +K NS+P
Sbjct: 100 --STIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPM---HTTTKCNSVP 154

Query: 177 CSPKKQPGKA---HTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFXXXXX-- 231
            SPK +        TLR  KS+  GLN          Y + FK   RLS++FF       
Sbjct: 155 TSPKCKSTSTLNQRTLRNIKSYHYGLNGD--------YINPFKENNRLSISFFNGDNTFN 206

Query: 232 ------XXXXXXXXTIIL--PNISTPSHMDMATKGAEFEPLRRYNSHESILSNKP---AP 280
                         T+++  P ++ P            + L+R NS +S+  N+     P
Sbjct: 207 DNNSDSESDIDDDDTVLVTSPFLTNPK-----------QKLKRSNSQDSVFWNENYLRKP 255

Query: 281 AMSLSLGSFP--FFKPSNPTFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFI 338
           +    L  FP    KP+       +S+ QV            K  G    +SKALL+SF+
Sbjct: 256 SFQKQLNLFPSTLTKPT-----AELSSTQV----------FLKNTGRLGSSSKALLTSFV 300

Query: 339 AQPDRIVVKQKSTNLKHTSFLDKFNSSLSTISES-------------------------F 373
              D +  +Q++ N   +SF + FNS  S I +S                          
Sbjct: 301 K--DNLQQQQRTHNA--SSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLI 356

Query: 374 QNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNTELL 420
            +KK + +   + D I P   P  NN+     V   +L DALNTE L
Sbjct: 357 TSKKSRFNRFSSVDNISPTKKPIINND-----VQYSDLNDALNTEFL 398

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 130/244 (53%), Gaps = 31/244 (12%)

Query: 4   QALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLS---QQYNQYMSQLN 60
           + L++I +  L  S+ A+ +LD  ++RQ+R       D+   DK S    QY +Y+ QL 
Sbjct: 2   EQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLY 61

Query: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120
           SLY +++ + D +     + L++   + + IE+L+ EFQ+I     +  +   +   +SP
Sbjct: 62  SLYTKAQKLSDTVILSDSKSLSSV--QQRAIENLIQEFQEIAKNDENFISYSMR---ESP 116

Query: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSK---PPKKSVVFNPINDVECPSKTNS--- 174
            S S + S+ SFQP+PLKI++R++  + +P+K    P  S++ N  ++    + ++    
Sbjct: 117 NSMSVQ-SICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQE 175

Query: 175 --LPCSPKK----QPGKAHT------LRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLS 222
             L  SP      +P  +HT      +R+AKS D GLN+   P       +FFK++QRLS
Sbjct: 176 RLLGSSPSSIHFFRP--SHTNADTLFIRSAKSCDAGLNRRSNPHENRL--NFFKDRQRLS 231

Query: 223 LTFF 226
           ++F 
Sbjct: 232 ISFI 235

>CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa]
           {ON} similar to uniprot|P32855 Saccharomyces cerevisiae
           YPR055w SEC8 transport protein
          Length = 1014

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 66/156 (42%), Gaps = 30/156 (19%)

Query: 14  LTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSL----------- 62
           +T+S++ IL+L   ++      V + SD + L+  S +YNQ +  LNS+           
Sbjct: 115 ITKSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDLNSIEKLIQYPDIIE 174

Query: 63  -YVRSESVRD-KLSKEQWRRL-----------------NTEENEHKRIEDLVHEFQDITV 103
            ++R ++ RD ++  E+   L                   E  EH     ++ E  +I  
Sbjct: 175 EHIRGKNYRDARILLEKGFLLAGSQTLKDVSAIKPLVQQLELQEHVLFNTIIEEIHNILY 234

Query: 104 RLNDLATVPNKASNDSPQSQSTRSSLDSFQPRPLKI 139
             ND + V N+       +Q+  S+L+++    + I
Sbjct: 235 SKNDDSFVTNEIGRMVGTAQTNFSTLENYVYNVVNI 270

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLND 107
           +D+LSKEQ ++L   E E KR ED++ +  ++ V+LN+
Sbjct: 154 KDRLSKEQRKKLL--EMERKRREDMMKQVDELAVKLNE 189

>NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {ON}
           Anc_2.444 YMR106C
          Length = 625

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 10/124 (8%)

Query: 298 TFGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTS 357
           TFG  V +V +N R    A  +PK N         L+  F+A  D+    +   N   T 
Sbjct: 377 TFGVLV-DVLLNNRKVAVARYVPKANSEVQMC--VLVPLFVAHHDQSFSGEGEENFVRTL 433

Query: 358 FLDKFNSSLSTISESFQNKKGKKSSDLNDDRIPPHIMPEHNNNLMDMGVSIEELQDALNT 417
            L++   +       F     ++S+           +PE  N + ++ V +EE  D+++T
Sbjct: 434 VLNRLPFAEDERVSDFPRLTNRRST-------SGRTLPEDKNEIDELDVLMEEFVDSMDT 486

Query: 418 ELLL 421
           + LL
Sbjct: 487 DNLL 490

>Smik_6.170 Chr6 (280902..283706) [2805 bp, 934 aa] {ON} YGR089W
           (REAL)
          Length = 934

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 7/80 (8%)

Query: 5   ALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPS-------DRDSLDKLSQQYNQYMS 57
            L+ +TE+ L   EE + + DL ++ Q   S  E S            +K+SQ+ +Q  S
Sbjct: 794 GLKTLTEKELDLEEEYLRKKDLHLKNQLEFSKLEESLSKDLKSSESKFNKVSQELSQLAS 853

Query: 58  QLNSLYVRSESVRDKLSKEQ 77
           +L+ L  R+E +R ++ + +
Sbjct: 854 KLDKLKARNEKLRKEVDQNE 873

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,635,774
Number of extensions: 1980052
Number of successful extensions: 8104
Number of sequences better than 10.0: 142
Number of HSP's gapped: 8475
Number of HSP's successfully gapped: 146
Length of query: 421
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 309
Effective length of database: 40,638,807
Effective search space: 12557391363
Effective search space used: 12557391363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)