Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1501.3ON36136117620.0
Skud_3.11.3ON36036115520.0
YCL064C (CHA1)1.3ON36035215130.0
Smik_3.121.3ON36036115020.0
NCAS0B091301.3ON36734312831e-177
KNAG0C001801.3ON35934012401e-171
KAFR0D001101.3ON36535412071e-166
NDAI0A001201.3ON37734712021e-165
TPHA0E040401.3ON35733611831e-162
Kpol_2002.61.3ON35034811551e-158
CAGL0B00286g1.3ON36033611181e-152
TBLA0A049201.3ON36033510861e-148
KAFR0I00130singletonON34434210631e-144
ZYRO0F15774gsingletonON41036010491e-141
KAFR0F04430singletonON34334010351e-140
NCAS0A15330singletonON3473409781e-131
SAKL0C00418g1.3ON3643449591e-128
NDAI0K02950singletonON3343289211e-123
ZYRO0F18524g1.3ON3353378661e-114
KLTH0F00440g1.3ON3413318371e-110
KNAG0D05380singletonON3343278251e-108
AFR747W1.3ON4263348221e-107
Ecym_10061.3ON3643408111e-106
KLLA0C00440g1.3ON3773298111e-106
SAKL0C13904gsingletonON3393338071e-105
Smik_9.2na 1ON3383238001e-104
Scer_YGOB_SDL1 (SDL1)na 1ON3373237971e-104
Skud_9.2na 1ON3393267801e-101
TDEL0D06540singletonON3373247331e-94
KLLA0E01805gsingletonON3223216902e-88
KNAG0A01150singletonON2312215632e-70
YIL167W (SDL1)singletonOFF2101895334e-66
YIL168WsingletonOFF1271202764e-29
SAKL0F11858g7.367ON5622541773e-13
KAFR0K017007.367ON5792501561e-10
Suva_5.1997.367ON5762501507e-10
KLLA0E19779g7.367ON5672501471e-09
Skud_5.2057.367ON5762501462e-09
YER086W (ILV1)7.367ON5762501462e-09
ZYRO0B02772g7.367ON5692501462e-09
TDEL0C018007.367ON5692641452e-09
CAGL0I05126g7.367ON5712501453e-09
Smik_5.2257.367ON5762501443e-09
SAKL0A10626gsingletonON3203141423e-09
TBLA0C050707.367ON5752721434e-09
NDAI0A018107.367ON5702501426e-09
NCAS0A142307.367ON5692641426e-09
Kpol_530.167.367ON5662501417e-09
TPHA0F031307.367ON5682501401e-08
Ecym_47087.367ON5702861382e-08
YKL218C (SRY1)na 2ON3263401352e-08
ACR232C7.367ON5602501354e-08
KNAG0C036907.367ON5772641222e-06
Kwal_33.148227.367ON5622641213e-06
KLTH0B04884g7.367ON5732501185e-06
Skud_11.2na 2ON3262861131e-05
KLLA0A11814g5.157ON30235741.1
Skud_9.967.274ON94344731.8
SAKL0D06688g1.329ON31184712.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.150
         (361 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   683   0.0  
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   602   0.0  
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   587   0.0  
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   583   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    498   e-177
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   482   e-171
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   469   e-166
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   467   e-165
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   460   e-162
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   449   e-158
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   435   e-152
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   422   e-148
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   414   e-144
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   408   e-141
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              403   e-140
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            381   e-131
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   374   e-128
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             359   e-123
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   338   e-114
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   327   e-110
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   322   e-108
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   321   e-107
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   317   e-106
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   317   e-106
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   315   e-105
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      312   e-104
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   311   e-104
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      305   e-101
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            286   1e-94
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   270   2e-88
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   221   2e-70
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   209   4e-66
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   110   4e-29
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    73   3e-13
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    65   1e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    62   7e-10
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    61   1e-09
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    61   2e-09
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    61   2e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    61   2e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   2e-09
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    60   3e-09
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    60   3e-09
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    59   3e-09
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    60   4e-09
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    59   6e-09
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    59   6e-09
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    59   7e-09
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    59   1e-08
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    58   2e-08
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    57   2e-08
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    57   4e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    52   2e-06
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    51   3e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    50   5e-06
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    48   1e-05
KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highl...    33   1.1  
Skud_9.96 Chr9 complement(188745..191576) [2832 bp, 943 aa] {ON}...    33   1.8  
SAKL0D06688g Chr4 complement(552575..553510) [936 bp, 311 aa] {O...    32   2.1  

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/361 (92%), Positives = 333/361 (92%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
           QV               CQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
           NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360
           LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360

Query: 361 A 361
           A
Sbjct: 361 A 361

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/361 (81%), Positives = 312/361 (86%), Gaps = 1/361 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MSIVYNKTPLLRQFFP KS AQF+LKYECLQPSGSFKSRGIGNLILKNAIRIQK+G+RSP
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
           QV               CQRLSLPCTVVVPTATK+RMVEKIRNTGAQVIVNGA+WKEADT
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LK N+MN ID Q VEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQR+ M KVKGIVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ER+ LADKIPIVGVET GCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
            ISNQTFEYA KYNTKSVV+EDKDVIETCLKY+HQ NMV EPACGAALHLGYHT+ILE A
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360
           L +KLAADDIV+IIACGGSSNTVQDLEETL  +KK+G+PAIE ADNFIF EK +STILKS
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEK-TSTILKS 359

Query: 361 A 361
           A
Sbjct: 360 A 360

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/352 (78%), Positives = 306/352 (86%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MSIVYNKTPLLRQFFPGK+ AQF+LKYECLQPSGSFKSRGIGNLI+K+AIRIQK+GKRSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
           QV               CQRLSLPCTVVVPTATK+RMV+KIRNTGAQVIV+GA+WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LKTNVMN ID Q +EPIYVHPFDNPDIWEGHSSM+DEIVQDLKSQ + + KVKGIVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ER+GLAD+IPIVGVET GCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
            ISNQTFEYARKYNT+SVV+EDKDVIETCLKY+HQFNMV EPACGAALHLGY+T ILE A
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEK 352
           L +KLAADDIV+IIACGGSSNT++DLEE L SM+K+  P IE+ADNFIFPEK
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEK 352

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/361 (77%), Positives = 308/361 (85%), Gaps = 1/361 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MSIVYNKTPLLRQFFPGKS AQF+LKYECLQPSGSFKSRGIGNLI+K+AIRIQK+GK+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
           Q+               CQRLSLPCTVVVPTATK+RMVEKIRNTGAQVIV+GA+WKEADT
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LK +VM  ID Q VEPIYVHPFDNPDIWEGHSSMVDE+VQDL+ QR+ M KVKGIVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ER+GLADKIPIVGVET GCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
            ISNQTF+YARKYNT+SVV+EDKDVI+TCLKY+HQFNMV EPACGAALHLGY+T+ILE A
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360
           L +KLAADDIV+IIACGGSSNT+QDLEE L    K   PAIE+ DNFIFPEK ++T LKS
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTAT-LKS 359

Query: 361 A 361
           A
Sbjct: 360 A 360

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  498 bits (1283), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/343 (69%), Positives = 275/343 (80%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MSIVYNKTPLLRQFFP        S+ QF+LKYECLQPSGSFKSRGIGNLI+KNAIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  NGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114
           +G +SPQV                QRLSLPCTVVVPTATK+RMVEKIR TGA VI+NGA 
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174
           WKEADTYLK++VMN ID    EPIYVHPFDNPDIWEGHS+MVDEIV  L  Q + + K+K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSV             E+H LADKIPIVGVETKGCHVFNTSL++G+ ++F KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294
           TSLGTA+IS+QTFEYA+KY+T+SVVVED DVIETCLKY+  FNMV EPACGA+LHL Y+T
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEG 337
           +ILE AL  KL++DDI+L+IACGGSSNTVQDLEETL  ++++ 
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  482 bits (1240), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/340 (66%), Positives = 269/340 (79%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MS+VYNKTPLLRQFFPGK+L Q +LKYECLQPSGSFKSRGIGNLILKNA+RIQK G+R  
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
            V               CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIVNGA WKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LK  VM+ ID +  EPIYVHPFDNPDIWEGH+++VDEI++ L SQ++  E VKGIVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E+HGLA+KIPIVGVET+GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
           +IS QTFE A+KYNT+SVVV+D  VIETCLKY+  FNMV EPACGAALHL Y+ DILE A
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPA 340
           L   L  +D++L+IACGGSSNT++DLE+TL ++  + +P+
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  469 bits (1207), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 271/354 (76%), Gaps = 6/354 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MS+VYNKTPLLRQFFPG       SL QF+LKYECLQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  NGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114
            G + P+V               CQRLSLPCTVVVPTATK+RM+EKI++TGA VI++GAF
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174
           WKEAD YLK +VMN I+   ++PIYVHPFDNP IWEGHSS+VDEI+  L+ Q+V    +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSV             ERH L DKIP+VGVET+GCHVFNTSL++G+ V+F+KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294
           TSL TA+IS +TFE A KY T+SV+V+D DVIETCLKY+  +NMVTEPACGA++HL Y+ 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFI 348
           DILE AL TKL  DD V++IACGGSSNT+QD+EETL  ++ E   A+ L + F+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFL 354

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  467 bits (1202), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/347 (64%), Positives = 267/347 (76%), Gaps = 11/347 (3%)

Query: 1   MSIVYNKTPLLRQFFP---GKSLA--------QFYLKYECLQPSGSFKSRGIGNLILKNA 49
           MS+VYNKTPLLRQFF     KS A        QF++KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  IRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVI 109
           + I K G+++PQV               CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVP 169
           +NGA WKEAD +LK ++MN ID   +EPIYVHPFDNP IWEGH++MVDEI+  L  Q +P
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 MEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKK 229
           + KVKGIVCSV             +++ LADKIPIVGVETKGCHVFNTSL++ + ++F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ITSIATSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALH 289
           ITSIATSLGTANIS +TFEYA+KY T+SVV+EDK+VIETCLKY+  +NMV EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LGYHTDILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           L YHTDILE +L  KL +DDI+L+IACGGSSNT  DLE  L +MK +
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKAD 347

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  460 bits (1183), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/336 (65%), Positives = 258/336 (76%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MS VYNKTPLLR  FPGK+L Q +LKYEC QPSGSFKSRGIGNLI   ++ IQKN K+SP
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
           +V                + LSLPCTVVVPTATK RMVEKI+ TGA VIV G  WKEADT
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           YLKTNV++ ID + +EPIYVHPFDN  IWEGH++M+DEIV+    Q +P+EKVK IVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E+H LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
           NISNQTFEYA+KYNTKS+VV+D  V+ETCLK++   NMV EPACGAALH+GY+ DILE +
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           L  KLA DDIVLIIACGGSSNTVQ+LE +L  +K +
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  449 bits (1155), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 225/348 (64%), Positives = 266/348 (76%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           MS+VYNKTPLL+ FFPGK+L QFYLKYE LQPSGSFKSRGIGNLILKNAIRI+K   + P
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
            V                QRLSLPCTVVVPTATKERMV+KIR TGA VI+ G  WKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LK N+MN I+   +EPIYVHPFDNP IWEGHS+MVDEI++    Q+  ++ +K IVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E++ LADKIP+VGVET+GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
           NISNQ F+YA+KYNTKSVVVEDKDV+ETCLK++H  NMV EPACGAA+HLGYHTD+LETA
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFI 348
           L TKL  DD VLI+ACGGSSNTV++LE  L  +  +   A     +FI
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  435 bits (1118), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 256/336 (76%), Gaps = 5/336 (1%)

Query: 4   VYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNG-KRSPQV 62
           VYNKTPL+RQ FP  S+ Q YLK+EC QPSGSFKSRGIG+LI K + RI  NG  + P V
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYL 122
                           + L+LPCTVV+PTATK+RM +KIR TGA VIV+G FWKEAD YL
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KTNVMNLID--HQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           K N+++ ++  H+ VEPIYVHPFDNPDIWEGH+SMVDEIV+D K++ +P+ K+K IVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E++ LADKIPIVGVETKGCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
           +IS + F+YA++Y TKSVV+ D+DV++TCL+Y+H FNMV EPACGAA+HL YHT+ILE  
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           L TKL ADDIVL++ACGGSSNTV+D+E  L  +  E
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  422 bits (1086), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 203/335 (60%), Positives = 248/335 (74%), Gaps = 1/335 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK-NGKRS 59
           MSIVYNKTPLLRQFF G  + QF+LKYEC+QPSGSFKSRGIGNLILK+  +I   N  + 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEAD 119
           PQV                +RLS+PCTVVVPTATKERMV KI++TGA+VIVNG  W EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 TYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCS 179
            YL+ +V+N ID   +EPIYVHPFDNP IWEGHS+M+DEI++ L  Q + +  VK I CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           +             E++ LA KIPI+GVET GC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILET 299
           + IS +TFE A KYNTKSVVV++ DVI+TCL+Y++ FN V EPACGAALHL Y+T ++E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALDTKLAADDIVLIIACGGSSNTVQDLEETLASMK 334
           ALDT L  DDI+++IACGGSSNTVQ+LEE L   K
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  414 bits (1063), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/342 (57%), Positives = 254/342 (74%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           M IVYNKTPL+ Q FPG       SL Q  +KYE LQPSGSFKSRGIGNL+ + A++IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  NGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114
           N  ++P+V                Q+LSLPCTVVVP ATK+RM+EKIR+TGA+V ++G F
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174
           WK AD Y+K +V+N I+ + VEPIYVHP D+P IWEG+S +VDE+++ L+ Q++   KVK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234
            IVCSV             ER+ LADKIPIVGVET G HVFNT L+ G+ ++F+KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294
           TSLG+A+I+ +TFEYA KY  + V+V+D +V+ETCL+Y+  +NM+TEPACGAA+HL YH 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           DILE ALDT+L  DD+V+IIACGGSSN++ D+EETL  MK E
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSE 342

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/360 (52%), Positives = 260/360 (72%), Gaps = 9/360 (2%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           M  +YNKTPLL+Q F   + AQ ++KYECLQPSGSFKSRGIG+LI K A  IQ +G++SP
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
            V                Q+L+LPCTVV+PT TK+RM +KIR  GA V+V G+ WKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           +LK  + N ++   +EPIYVHPFDNP IWEGH+S+VDEI+  LK++   + +VKGIVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E++ LA+KIP++ VETKGCHV NTSL++GQ V+F K+ S+ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
            IS++T +Y +KY +KS+V+EDK+V++TCLKY+  FNM+TEPACGA+LHLGYH  ++E A
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLA--------SMKKEGVPAIELADNFIFPEK 352
           L   L  DD++++IACGGSSNT+ DLEE+LA        S+++   P++E  +N I+P++
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATPSLE-HENIIYPKR 405

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  403 bits (1035), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/340 (55%), Positives = 250/340 (73%), Gaps = 6/340 (1%)

Query: 1   MSIVYNKTPLLRQFF------PGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           M  VYNKTPLLR +F         S  Q + KYE  QP  SFKSRGIGNLILKNA ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  NGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114
            G ++ +V               C+ LS+PCTVVVP++TK RMVEKIR+TGAQVIV+G F
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVK 174
           WKEAD YL+ +V+N +D   VEP+YVHPFD+P IWEGHS+++DEIV+ L  + V   KVK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIA 234
           G+VCS+             ERH LADKIP++ VET+GCHVFNT L +G+ V+F+KI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHT 294
           TSLG+ +IS +TFEYA+KY++K VV++D DV+ETCL+YS   NM+ EPAC A++HL Y+ 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 DILETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMK 334
           DILE AL+ KL+ DD+++IIACGGS+ T+QD++++LA +K
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLK 340

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/340 (53%), Positives = 241/340 (70%), Gaps = 5/340 (1%)

Query: 1   MSIVYNKTPLLRQFFPGK----SLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNG 56
           MS+VYNKTPLLR+ FP      S  Q Y+KYE LQPSGSFKSRGIG+LI+KNA+R+Q+ G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  KRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWK 116
            +S  V                Q L LPCTVVVPT+TK RMVEKIRN G +VIV G+ WK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGI 176
           EAD++LK +V+  +D +  EPIYVHPFD+PD+WEGHS+MVDEIV   +SQ V + KVK I
Sbjct: 121 EADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATS 236
           VCSV             E++ LADKIP++ +ET GC+ FN  L+  + V+  KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDI 296
           LG   ++ + FE  ++Y + SVV++D DV+ TCLKY++ FN++TEPACGA+LH+ Y+T +
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           +E AL  KL +DDI++IIACGGS+NT++DL+ +   +  E
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAE 339

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  374 bits (959), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 181/344 (52%), Positives = 229/344 (66%), Gaps = 3/344 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLA---QFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGK 57
           M+  Y+KTPLLR+ FP   L+   QF +KYE  QPSGSFKSRGIG+LI ++A RI+  G 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  RSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKE 117
           ++  V               C+  SLPCTVVVPT T  RMV KIR TGA VIV+G  W +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIV 177
           AD YL  +VM  ID    EP+Y HPFDNP IWEGHS++VDEIV+ L+ QR+P  +VKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSL 237
           CS+             E+H LA  IPI+GVETKGC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDIL 297
           GTA I  +T E A KYNTKSVV+ D DV+ TCL ++   N+V EPACGA+LH GY+  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 ETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAI 341
           E  L   L  +DI+++IACGGSS TVQDL++    + +   P+ 
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSF 344

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  359 bits (921), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/328 (52%), Positives = 230/328 (70%), Gaps = 2/328 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLA-QFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRS 59
           MS +YNKTPLLRQ F    +  + +LKYE LQPSGSFKSRGIG LIL++  +++++G ++
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEAD 119
             V                + L +PCTVVVP +TKERMV KIR TGA V++ G  WKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 TYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCS 179
            +L+ + M  +D+   +PIYVHPFD+P IWEGHS+++DEIVQ L+++++ +EKVKGI+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           V             ERH LA  IP++ VETKGC V N SL+ G PVQ  KITS+ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILET 299
             IS+  FE A KYN++S+ + DKDV+ETCLKY+  F+M  EPACGA++HL Y+  I+E+
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALDTKLAADDIVLIIACGGSSNTVQDLE 327
           AL T L+  DIV+++ CGGSS T+ DLE
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  338 bits (866), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 225/337 (66%), Gaps = 13/337 (3%)

Query: 1   MSIVYNKTPLLRQFFPGKS---LAQFYLKYECLQPSGSFKSRGIGNLI-LKNAIRIQKNG 56
           M+  Y KTPLLRQ    K+   L Q ++KYE LQP GSFKSRGIGNLI LK+     +NG
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55

Query: 57  KRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWK 116
                V                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G+ WK
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 117 EADTYLKTN-VMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175
           EAD YL+ N + +  +    +P+YVHPFD+P +WEGHS+MV EI+ +L+ Q + +E V+G
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 176 IVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV             E HGLADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295
           SLG+  I    FE A +Y  KS+V+EDKDVIETCL+Y   F  + EPACGA+LH+GYH +
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDLEETLAS 332
           +LE  L    + DDI++IIACGGS+ T +DL  T+AS
Sbjct: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDL--TIAS 329

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  327 bits (837), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 219/331 (66%), Gaps = 5/331 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKS-----LAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKN 55
           M   + KTPLL  +F   S       QF LK E LQPSGSFKSRGIG +I K AI+I+  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  GKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFW 115
           G + P V                + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175
           KEAD +LK ++++  +    + IY HPFD+P IWEGHSS+VDEI+  LK Q++ ++ +K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV              RH L  KIPI+GVE+KGC VFN+SL++G+  +F+ ITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295
           S+GT +IS +T E A +Y+TKSVV+ D+++I TCL+++ + N++ EPACGAALHLGY+ D
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDL 326
           IL  AL++    +D++++I CGGS+ +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 205/327 (62%), Gaps = 2/327 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60
           M  +YNKTPLL +   G     F  KYE +QP GSFK RG+ +LI K   +I+  GK+ P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  QVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120
            V               C  LS+PCTVVVPT TK RMVEKIR   A+VIV G+ WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180
           YL+  V  +  + AV+PIYV+PFD+P +WEGHS+M+DEI+  L  + + ++ VKGIVCSV
Sbjct: 121 YLRGTV--IASNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 XXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E H LA  IP+V VETKGC V   SL   +PV+  KI SIATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300
            +S Q F+ A K+ ++SVV+ D DV+ TC +Y   FN + EPACGA +H  YH  ILE A
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LDTKLAADDIVLIIACGGSSNTVQDLE 327
           L  KL   DI++II CGGS  T+QDLE
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLE 325

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  321 bits (822), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 163/334 (48%), Positives = 218/334 (65%), Gaps = 7/334 (2%)

Query: 1   MSIVYNKTPLLRQFFPGKSL-----AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKN 55
           M+  Y KTPL+R  F  +++      +  LKYE  QPSGSFKSRGIGNLI K   +I++N
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  GKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFW 115
               P V                ++L LPCTVVVP  T+ RMVE+IR+TGA VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKG 175
           KE+D YL++ +M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q V +E VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV             E+HGLAD IP+V VET+GC V + SL +G+ V      S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTD 295
           SL T+ +++ T  YA+KY TKSVV++   V++TCL ++ + N+VTEPACGAALHLGYH +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILETALDTKLAADDIVLIIACGGSSNTVQDLEET 329
           ILE  L   L   D+V++IACGGS+  + DL+E+
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKES 400

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  317 bits (811), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 224/340 (65%), Gaps = 16/340 (4%)

Query: 1   MSIVYNKTPLLRQFFPGK------SLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MS +Y KTPLLR+ F GK       + QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 55  NGKRSPQVXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAF 114
           +  + P V                QR+ +PCTVVVPT+T++R++EKI  TGA +I  G +
Sbjct: 60  DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119

Query: 115 WKEADTYLKTNVM------NLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRV 168
           + EAD+YLK ++M      N  D + V PIYVHPF++P IW GHS +V+EI++ L+++ +
Sbjct: 120 FAEADSYLK-DLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENI 177

Query: 169 PMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFK 228
           P  +VKGIVCSV             ERH LA+ IPI+GVET+GC V + SL  G+ + FK
Sbjct: 178 PYSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFK 237

Query: 229 KITSIATSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAAL 288
           K  S+ATSL    I+ +T  YA+KY TKS+V+ + +V++TCL+++ + N+VTEPACGA L
Sbjct: 238 KALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATL 297

Query: 289 HLGYHTDILETALDTKLAADDIVLIIACGGSSNTVQDLEE 328
           HLGYH  IL   L   L+++DIV++IACGGS+ T+ DL E
Sbjct: 298 HLGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRE 336

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  317 bits (811), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 217/329 (65%), Gaps = 7/329 (2%)

Query: 4   VYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQ-- 61
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI   + ++++  K SP+  
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEKI 80

Query: 62  --VXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEAD 119
             V                  L++PCTVVV  AT+ R++EKIR+ GA V+V+G  WKEAD
Sbjct: 81  GHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEAD 140

Query: 120 TYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCS 179
           +++K ++M  +D    EPIY HPFDNP IWEGHS MVDEI+  L S ++P+ K+KGIVCS
Sbjct: 141 SFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCS 200

Query: 180 VXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
                         +R+ LADKIPIV VETKG  V + SLR+G PV+F+KI+S ATSLGT
Sbjct: 201 FGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGT 260

Query: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILET 299
           A IS   ++  +++ +KS V+ D +VI TCL++S+  N+V EP CGA L+ GY+ D L+ 
Sbjct: 261 ATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQN 320

Query: 300 ALDTKLAADDIVLIIACGGSSNTVQDLEE 328
            L + +  DD V++I CGGSS +++DL+E
Sbjct: 321 ILGSDIKDDDYVILIGCGGSSTSLEDLKE 349

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  315 bits (807), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 212/333 (63%), Gaps = 5/333 (1%)

Query: 5   YNKTPLL-RQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           YNKTPLL R         +F+LKYE LQP GSFKSRGIG L+ K+  + +++G +S  V 
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                          Q  S+ CTVVVP  TK RMVEKIR TGA+V+V G  W  AD YL+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 TNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXX 183
             VM  +D   V P+YVHPFDNP IW+GHS++VDE+V  LK + V ++KVK IVCSV   
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 XXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANIS 243
                     E H LAD+IPI+ +ETKGC V N SL  G PV  + +TS+A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDT 303
            + FE ARKY +KS++++D  VIETCL ++    +V EPACGA+L+  YH ++L   +  
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336
           +L  DD++++IACGGS+ T +DLE     MKKE
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLE----YMKKE 336

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  312 bits (800), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 207/323 (64%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLRQFFP-GKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           Y KTPL+RQ F  GK+   FY+K++ LQP GSFKSRGIG+LI K        G     V 
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                         C+ ++L CTVVVP  TK RMV+KI++ GA+VI++G  W EAD YLK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 TNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXX 183
             VM        + +YVHPFD+  IWEGHS++VDEI+Q L+ + +   +VKG+VCSV   
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 XXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANIS 243
                     ER+ LA KIPIV VET GC V N SL+ G PV  +++TS+ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDT 303
              FE    Y  KSVV+ D+DV++TCL+Y+  +N + EPACGA+LHL YH +ILE AL  
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLAADDIVLIIACGGSSNTVQDL 326
           KL+ DD+V+IIACGGS  T +DL
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDL 328

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  311 bits (797), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 209/323 (64%), Gaps = 2/323 (0%)

Query: 5   YNKTPLLRQFFP-GKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           Y KTPL+RQF   GK+ + FY+K+E LQP GSFKSRGIG+LI K+       G     V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GA+VI++G  W EAD YL+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 TNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXX 183
             +     H + + +YVHPFDN  IWEGHS++VDEI++ LK   + + +VK +VCSV   
Sbjct: 126 HEMAQESQHGS-KTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 XXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANIS 243
                     +R+ LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDT 303
           +  FE   KY  KSVV+ D+DV+ TCL+Y+  +N + EPACGA+LHL YH +ILE  L+ 
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLAADDIVLIIACGGSSNTVQDL 326
           K+  DDIV+IIACGGS  T +DL
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  305 bits (780), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 208/326 (63%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLRQFFP-GKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           Y +TPL+ Q F  G++  + Y+K+E LQP GSFKSRGIG+LI ++      +G     V 
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                         C  ++L CTVVVP  TK RM++KI+N GA+VI++G+ W EAD YL+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 TNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXX 183
             +M        + +YVHPFD+  IWEGHS++VDE++Q L+ + + + ++K +VCSV   
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 XXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANIS 243
                     ER+ LA KI ++ VET GC V N SL  G P+  ++++SIATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDT 303
              FE    Y  KSVV+ D+DV+ TCL+Y+  +N + EPACGA+LHL YH +ILE AL+ 
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLAADDIVLIIACGGSSNTVQDLEET 329
           KL+ DDIV+IIACGGS  T +DL ET
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDLVET 331

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  286 bits (733), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 197/324 (60%), Gaps = 3/324 (0%)

Query: 6   NKTPLLRQFF--PGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           +K+PLL + F    K   QF+LKYE LQPSGSFKSRGIG LI   A   +        V 
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                          + L+L CTVVVP  TK  M+++I+N G+QVIV+G  W  ADTYLK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 TNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXX 183
             VM  +    VEP+YVHPFD+P +WEGHS M+DEIV+ L+ Q   M  VKGI+CSV   
Sbjct: 125 EVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 XXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANIS 243
                     ERHG A KIPI+ VET G      SL  G+PV+  ++TSIA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDT 303
             +FE A +Y T+S V  D++ + T L++  + N++ EPAC A++ L YH D L   L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLAADDIVLIIACGGSSNTVQDLE 327
           KL++ DIV++I CGGS+ T+ DLE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  270 bits (690), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 143/321 (44%), Positives = 195/321 (60%), Gaps = 8/321 (2%)

Query: 7   KTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXX 66
           KTPLL    P      F LKYE LQP GSFKSRGI +LI K  +    + +    V    
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSS 65

Query: 67  XXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNV 126
                      C  L +PCTV+VP +TK RM++KI + GA+V++ G  WKEADTYL+  V
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXX 186
           M    +     +YVHPFDNP IW+GHS+M+DEI++ L      +  VKGIVCSV      
Sbjct: 126 MRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 XXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQT 246
                  ERHGLA  IP+  +ET GC V + SL  G+PV   +I+SIATSLG+  I   +
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDTKLA 306
           F+ A K+++KS+V++DK+V++TCL++  + +++ EPACGA+LH  Y  ++L       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLG 298

Query: 307 ADDIVLIIACGGSSNTVQDLE 327
            DDIV++I CGGS NT  DL+
Sbjct: 299 PDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  221 bits (563), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 148/221 (66%), Gaps = 2/221 (0%)

Query: 107 QVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQ 166
           +V V+ A  KEAD YL+  V++L  ++ V+PIYV+PFD+P IWEGHS+++DEI+  L  +
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDL--YKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 167 RVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQ 226
            + +  VKGI+CS              E++ LA  IP+V VETKGC V N SL   +PVQ
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 227 FKKITSIATSLGTANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGA 286
              ITSIA SLG++ +S + F+   KY++KS+V+ D D ++TC KY   F  V EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 287 ALHLGYHTDILETALDTKLAADDIVLIIACGGSSNTVQDLE 327
           ++H  YH ++LE ALD KL  DD+++IIACGGS  T QDLE
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLE 222

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  209 bits (533), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 131/189 (69%)

Query: 138 IYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHG 197
           +YVHPFDN  IWEGHS++VDEI++ LK   + + +VK +VCSV             +R+ 
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKYNTKS 257
           LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I++  FE   KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 VVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDTKLAADDIVLIIACG 317
           VV+ D+DV+ TCL+Y+  +N + EPACGA+LHL YH +ILE  L+ K+  DDIV+IIACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTVQDL 326
           GS  T +DL
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  110 bits (276), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 5   YNKTPLLRQFFP-GKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVX 63
           Y KTPL+RQF   GK+ + FY+K+E LQP GSFKSRGIG+LI K+       G     V 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GA+VI++G  W EAD YL+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 106/254 (41%), Gaps = 24/254 (9%)

Query: 21  AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQR 80
           A   LK E L P  SFK RG  N+I K         +++  V                + 
Sbjct: 79  ANVQLKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYASKH 133

Query: 81  LSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYV 140
           L++P T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I  
Sbjct: 134 LNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLTEERGLTNI-- 187

Query: 141 HPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLAD 200
            PFD+P +  G  ++  EI++ + +      K+K + C+V             +R  +A 
Sbjct: 188 PPFDHPYVIAGQGTIAMEILRQVHNA----SKIKAVFCAVGGGGLITGVGAYLKR--IAP 241

Query: 201 KIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------Y 253
            I ++GVET      +TSL+ G+ V    + + A       I  +TF  A+         
Sbjct: 242 HIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLV 301

Query: 254 NTKSVVVEDKDVIE 267
           NT  +    KD+ E
Sbjct: 302 NTDEICAAVKDIFE 315

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K    ++  G     V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLSEERGLTNI--PPFD 208

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I +
Sbjct: 209 HPYVIAGQGTVAMEILRQVHN----ANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      +TSL+ G+  +  K+ + A       I  +TF  A++        NT  
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVNTDE 322

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 323 LCAAIKDVFE 332

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 101/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEA----KAECTKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++    + K+  +   V             +R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKV 259

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      + SL+  Q      + + A       I  +TF  A++        NT  
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 320 ICAAVKDVFE 329

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K     QKN      V                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAK-LDETQKNAG----VIACSAGNHAQGVAFSSNHMNIP 142

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   GAQV++ G  + EA    K     L + + +  I   PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEA----KLECARLAEERGMTDI--PPFD 196

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++       +  + C+V             +R  +A  I +
Sbjct: 197 HPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      + SL+ G+      + + A       I  +TF   +         NT  
Sbjct: 251 IGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDE 310

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 311 ICAAVKDVFE 320

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++      K+  +   V             +R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      + SL+  Q      + S A       I  +TF  A++        NT  
Sbjct: 260 IGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 320 ICAAVKDVFE 329

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++      K+  +   V             +R  +A  I I
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKI 259

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      + SL+  Q      + + A       I  +TF  A++        NT  
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 320 ICAAVKDIFE 329

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 105/250 (42%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K    + +N +++  V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK----LDEN-QKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNSL----KIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           VGVET      + S++ G+    K + S A       I  +TF  +++        NT  
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 313 ICAAVKDIFE 322

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +++  V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTRLSEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++      K+  +                 +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKYNTKSVVVEDKD 264
           +GVET      +TSL+ G+      + + A       I  +TF  A+    + V+V   +
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 265 VIETCLKYSHQFNMVTEPACGAAL 288
           +             + EP+   A+
Sbjct: 313 ICAAIKDIFEDTRGIVEPSGALAV 336

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 200

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +   I I
Sbjct: 201 HPYVIAGQGTVAMEILRQVYNS----NKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      +TSL+  +      + + A       I  +TF  AR+        NT  
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 315 ICAAVKDVFE 324

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 100/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +++      K+  +   V             +R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      + SL+  Q      + + A       I  +TF  A++        NT  
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 320 ICAAVKDIFE 329

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/314 (21%), Positives = 124/314 (39%), Gaps = 30/314 (9%)

Query: 6   NKTPLLRQFFPGKSL-AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXX 64
           NKTP+L        L A+ Y K E  Q  G+FK RG  N +LK         +R+  V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLK-----LTQEQRAAGVVA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKT 124
                         + L +P T+V+P       V      GA ++    + ++ +   + 
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDREQIGRA 135

Query: 125 NVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXX 184
               L + + +    V P+D+PD+  G  +   E+++++        ++  +   +    
Sbjct: 136 ----LAEEKGL--TLVPPYDHPDVIAGQGTAAKELIEEVG-------ELDLLFVPLGGGG 182

Query: 185 XXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISN 244
                    +R  L+ +  I+GVE +  +    SLR G  V      +IA    T ++  
Sbjct: 183 LLSGSALAAKR--LSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQ 240

Query: 245 QTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEP-ACGAALHLGYHTDILETALDT 303
            TFE         +   D +++++   ++ +  +V EP  C     LG+       A   
Sbjct: 241 YTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC-----LGFAA---ARAQKA 292

Query: 304 KLAADDIVLIIACG 317
           KLA   + +I++ G
Sbjct: 293 KLAGKRVGIIVSGG 306

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 110/272 (40%), Gaps = 25/272 (9%)

Query: 4   VYNKTPLLRQF-FPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQV 62
           V N++P+ +      K  +Q  LK E L P  SFK RG  N++ K     +K G     V
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG-----V 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYL 122
                           + L +P T+V+P +T     E +   G+QV++ G  +  +    
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSS---- 179

Query: 123 KTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXX 182
           K     L + + +  + + PFD+P +  G  ++  EI++ +K+      K+  +   V  
Sbjct: 180 KGECERLCEERGL--VNIPPFDHPYVIAGQGTVAMEILRQVKNS----AKIGAVFVPVGG 233

Query: 183 XXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANI 242
                      +R  +A  I IVGVET       TSL  G+  +   + + A       I
Sbjct: 234 GGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMI 291

Query: 243 SNQTFEYARK-------YNTKSVVVEDKDVIE 267
             +TF  ++         NT  +    KD+ E
Sbjct: 292 GEETFRVSKDVVDEIVLVNTDELCAAVKDIFE 323

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 101/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 199

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET       TSL+ G+      +   A       I  +TF  A++        NT  
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 314 ICAAVKDVFE 323

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 106/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +R+  V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKYNTKSVVVEDKD 264
           +GVET      +TSL+  +      + + A       I  +TF  A++   + V+V   +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 VIETCLKYSHQFNMVTEPACGAAL 288
           +             + EP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 102/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       + +++  V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 195

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +        K+  +   V             +R  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVHKA----NKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET   +   TSL+ G+ V    + + A       I  +TF   ++        NT  
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 258 VVVEDKDVIE 267
           +    KDV E
Sbjct: 310 ICAAVKDVFE 319

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 101/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK + L P  SFK RG  N++ K       + +++  V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L + + +  I   PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 197

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +        K+  +   V             +R  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET       TSL+ G+    + + S A       +  +TF  A++        NT  
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 312 ICAGIKDIFE 321

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 114/286 (39%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLR-QFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQV 62
           + N++P+ R +F   +      LK E L P  SFK RG  N+I       +K G     V
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISHLDDVQKKCG-----V 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYL 122
                           + L +P T+V+P +T     + +   GA+V++ G  +  A    
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAA---- 179

Query: 123 KTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXX 182
           K     L + + +  I   PFD+P +  G  ++  EI++ +++      K+  + C+V  
Sbjct: 180 KVECSRLSEEKGLYDI--PPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCAVGG 233

Query: 183 XXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANI 242
                      +R   A  I ++GVET      +TS++        ++   A       I
Sbjct: 234 GGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLI 291

Query: 243 SNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAAL 288
             ++F  AR+   + ++V   ++             V EP+   A+
Sbjct: 292 GEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 131/340 (38%), Gaps = 45/340 (13%)

Query: 6   NKTPLLRQFFPGKSL-AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXX 64
           NKTP+L        L AQ Y K E  Q  G+FK RG       NA+    + KRS  V  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGA-----MNAVSKLSDEKRSKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKT 124
                         + L++P T+V+P       V      GA +I    + ++ +     
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDREQ---- 131

Query: 125 NVMNLIDHQ-AVEPIY--VHPFDNPDIWEGHSSMVDEIVQD---LKSQRVPMEKVKGIVC 178
                I  Q A E  +  + P+D+PD+  G  +   E++++   L +  VP+        
Sbjct: 132 -----IGRQLAAEHGFALIPPYDHPDVIAGQGTSAKELLEEVGQLDALFVPLGGGG---- 182

Query: 179 SVXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLG 238
                              L+    I GVE +  +    S R G  V      +IA    
Sbjct: 183 --------LLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQ 234

Query: 239 TANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEP-ACGAALHLGYHTDIL 297
           T ++   TF   R+     + V D+++++     + +  +V EP AC     LG+   +L
Sbjct: 235 TQHLGEYTFAIIRENVDDILTVSDQELVKCMHFLAERMKVVVEPTAC-----LGFAGALL 289

Query: 298 ETALDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEG 337
           +     +L    + +I++ G   N       TL S K++G
Sbjct: 290 KK---EELVGKKVGIILSGG---NVDMKRYATLISGKEDG 323

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 96/250 (38%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I  N    QK    S  V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI-SNLDEYQK----SAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
             +V+PT+T       +   GA+V++ G  + EA    K     L     +  I   PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARLAQLHKLTDI--PPFD 190

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      ++  + C V             +R  +A  I I
Sbjct: 191 HPYVIAGQGTIATEILRQVHNA----SQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARK-------YNTKS 257
           +GVET      +T+L+ G+      +   A       +  +TF  AR         NT  
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 305 LCAAIKDIFE 314

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 103/264 (39%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       + +++  V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    K     L   + +  I   PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLSKERGLTNI--PPFD 206

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ +        K+  +   V             +R  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEILRQVHI----ANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKYNTKSVVVEDKD 264
           +GVET       TSL+ G+      + + A       I  +TF  ++    + V+V   +
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 265 VIETCLKYSHQFNMVTEPACGAAL 288
           +             + EP+   A+
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 100/264 (37%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K A      G+ +  V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLA-----EGQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G  + EA    K     + + + +  I   PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----KIECARISEERGLTNI--PPFD 191

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 192 HPYVIAGQGTVAMEILRQVHNA----SKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 245

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKYNTKSVVVEDKD 264
           VGVET       TSL  G       + + A       I  +TF     +  + V+V   +
Sbjct: 246 VGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDE 305

Query: 265 VIETCLKYSHQFNMVTEPACGAAL 288
           +             + EP+   A+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALAV 329

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 96/250 (38%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K +   QKN      V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLS-EAQKN----QGVIACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKTNVMNLIDHQAVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G  + EA    KT    + + + +  I   PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----KTECTRISEERGLTNI--PPFD 202

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSVXXXXXXXXXXXXXERHGLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 203 HPYVIAGQGTVAMEILRQVHN----AAKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 256

Query: 205 VGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYARKY-------NTKS 257
           +GVET       TSL  G       + + A       I  +TF   +         NT  
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDE 316

Query: 258 VVVEDKDVIE 267
           +    KD+ E
Sbjct: 317 ICAAVKDIFE 326

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 109/286 (38%), Gaps = 32/286 (11%)

Query: 6   NKTPLLRQFFPGKSL-AQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSPQVXX 64
           NKTP+L        L A+ Y K E  Q  G+FK RG  N + K + + +K G     V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG-----VIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYLKT 124
                         +  ++P T+++P       V      GA +I    + ++ +     
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTEDRE----- 130

Query: 125 NVMNLIDHQAVEPIYV--HPFDNPDIWEGHSSMVDEI---VQDLKSQRVPMEKVKGIVCS 179
              ++    A +  YV   P+D+PD+  G  +   E+   V +L +  VP+         
Sbjct: 131 ---HIGRQLAAKHGYVLIPPYDHPDVIAGQGTSAKELFEEVGELDALFVPLGGGG----- 182

Query: 180 VXXXXXXXXXXXXXERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
                             L+    + GVE +  +    S + G  V     ++IA    T
Sbjct: 183 -------LLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQT 235

Query: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEP-AC 284
            ++   T+   R+     + V D++++E     + +  +V EP AC
Sbjct: 236 QHLGEYTYAVIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC 281

>KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highly
           similar to uniprot|P20459 Saccharomyces cerevisiae
           YJR007W SUI2 Alpha subunit of the translation initiation
           factor eIF2 involved in the identification of the start
           codon phosphorylation of Ser51 is required for
           regulation of translation by inhibiting the exchange of
           GDP for GTP
          Length = 302

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 7/35 (20%)

Query: 139 YVHPFD-------NPDIWEGHSSMVDEIVQDLKSQ 166
           Y H +D       +P++W+G  S+ DEI Q+LK Q
Sbjct: 138 YGHAYDAYKMSIVDPNVWDGIESISDEIFQELKGQ 172

>Skud_9.96 Chr9 complement(188745..191576) [2832 bp, 943 aa] {ON}
           YIL075C (REAL)
          Length = 943

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 265 VIETCLKYSHQFNMVTEPACGAALHLGYHTDILETALDTKLAAD 308
           +IE CLK S       + A G AL  GY  DI+E+AL  KLA D
Sbjct: 140 MIEKCLKASE-----LKLALGIALE-GYRLDIIESALKNKLAND 177

>SAKL0D06688g Chr4 complement(552575..553510) [936 bp, 311 aa] {ON}
           highly similar to uniprot|P40335 Saccharomyces
           cerevisiae YJL053W PEP8 vacuolar protein sorting protein
           that forms part of the multimeric membrane-associated
           retromer complex
          Length = 311

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 204 IVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTANISNQTFEYAR-KYNTKSVVVED 262
           IV ++   C+++N+      P    ++  +   +G  N  +  FEY++ +Y  K V+V  
Sbjct: 150 IVKLKKFWCYLYNSVPPAQIPSAHDEVKPVKLDIGIENCLHIEFEYSKSQYALKDVIVGR 209

Query: 263 KDVIETCLKYSH-QFNMVTEPACG 285
              + T LK  H + ++VT   CG
Sbjct: 210 IYFLLTRLKVKHMEISLVTRETCG 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,840,653
Number of extensions: 1314462
Number of successful extensions: 3693
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3651
Number of HSP's successfully gapped: 63
Length of query: 361
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 250
Effective length of database: 40,753,473
Effective search space: 10188368250
Effective search space used: 10188368250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)