Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_3.1481.1ON1751759371e-131
YCR040W (MATALPHA1)1.120ON1751757781e-106
YCL066W (HMLALPHA1)1.1ON1751757781e-106
Suva_69.2singletonON1451457641e-105
Skud_3.1191.120ON1741757541e-103
Smik_92.1singletonON1561566744e-91
Skud_71.1singletonON1551566431e-86
ZYRO0F18590g1.1ON2001872746e-30
ZYRO0F15840g1.120ON2001872746e-30
TDEL0C070101.1ON2051452563e-27
Kpol_2002.21.1ON209712354e-24
Smik_3.1441.120ON54402192e-23
TBLA0A070401.120ON201682276e-23
TBLA0A075901.1ON201682276e-23
CAGL0B01243g1.120ON1431262053e-20
CAGL0B00242g1.1ON1841372064e-20
NCAS0B091501.1ON1501351984e-19
TPHA0E036201.120ON195681952e-18
TPHA0E040801.1ON195681952e-18
Suva_3.140singletonON31311782e-17
KNAG0C001501.1ON1451531583e-13
Ecym_10031.1ON263911581e-12
Ecym_11141.120ON263911581e-12
KLTH0F00374g1.1ON249711502e-11
KLLA0C00352g1.1ON2611181502e-11
Kwal_33.matalpha1singletonOFF244761483e-11
Kwal_33.12992singletonOFF244761483e-11
Kwal_YGOB_matalpha11.120ON244761483e-11
Kwal_YGOB_HMalpha11.1ON244761483e-11
KAFR0D007101.120ON172471262e-08
Smik_88.1singletonON35211111e-07
Suva_3.791.120ON35201102e-07
Skud_80.1singletonON32211102e-07
NDAI0A001001.1ON135611135e-07
Skud_15.843.151ON47673663.4
TPHA0G037003.575ON53974654.4
Smik_16.2278.75ON72840655.1
Smik_16.226singletonOFF95340637.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_3.148
         (175 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...   365   e-131
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...   304   e-106
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...   304   e-106
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)       298   e-105
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...   295   e-103
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...   264   4e-91
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...   252   1e-86
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   110   6e-30
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   110   6e-30
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   103   3e-27
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    95   4e-24
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    89   2e-23
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    92   6e-23
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    92   6e-23
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    84   3e-20
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    84   4e-20
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      81   4e-19
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    80   2e-18
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    80   2e-18
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    73   2e-17
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    65   3e-13
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    65   1e-12
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    65   1e-12
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    62   2e-11
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    62   2e-11
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    62   3e-11
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    62   3e-11
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    62   3e-11
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    62   3e-11
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    53   2e-08
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    47   1e-07
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    47   2e-07
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    47   2e-07
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    48   5e-07
Skud_15.84 Chr15 complement(159441..160871) [1431 bp, 476 aa] {O...    30   3.4  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    30   4.4  
Smik_16.227 Chr16 complement(413782..415968) [2187 bp, 728 aa] {...    30   5.1  
Smik_16.226 Chr16 complement(412865..412927,412942..412992,41299...    29   7.8  

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score =  365 bits (937), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 175/175 (100%), Positives = 175/175 (100%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS
Sbjct: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score =  304 bits (778), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAF+IKNK SKS+R T ++KK++ KR+A+ + PSCFNIIRPLKK+IQIP PS  F
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           L KIQ++RIASG+QN Q RQ  K SI  SKKYLNSFMAFRAYYSQFG+GVKQN+LSSLL+
Sbjct: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score =  304 bits (778), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAF+IKNK SKS+R T ++KK++ KR+A+ + PSCFNIIRPLKK+IQIP PS  F
Sbjct: 1   MFTSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRF 60

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           L KIQ++RIASG+QN Q RQ  K SI  SKKYLNSFMAFRAYYSQFG+GVKQN+LSSLL+
Sbjct: 61  LNKIQIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLA 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score =  298 bits (764), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF
Sbjct: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS
Sbjct: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINP 145
           EEWHADKMQHGIWDYFAQQYNFINP
Sbjct: 121 EEWHADKMQHGIWDYFAQQYNFINP 145

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score =  295 bits (754), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/175 (84%), Positives = 160/175 (91%), Gaps = 1/175 (0%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAFRIK KTSKS+RKT I+K VEG  I K I+PSCFN+IRPLKK+IQIPAP+  F
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISK-VEGNGIVKRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           LKKIQ++RI+SGNQ  QCRQ  KASI  SKK++NSFMAFRAYYSQFG+GVKQNILSSLLS
Sbjct: 60  LKKIQIHRISSGNQTTQCRQLSKASIKSSKKHINSFMAFRAYYSQFGSGVKQNILSSLLS 119

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 120 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 174

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score =  264 bits (674), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAFRI NK SKSHR   ++KK++ +RI K + P+CFN+IRPLKK+IQIP PS  F
Sbjct: 1   MFTSKPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRF 60

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           LKKIQ++RIASGNQ+IQCRQ  K SI  +KKYLNSFMAFRAYYSQFG+GVKQNILSSLLS
Sbjct: 61  LKKIQIHRIASGNQHIQCRQLNKTSIKSTKKYLNSFMAFRAYYSQFGSGVKQNILSSLLS 120

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 156
           EEWHADK QHGIWDYFAQQYNFINPGFGFVEWLTNN
Sbjct: 121 EEWHADKTQHGIWDYFAQQYNFINPGFGFVEWLTNN 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score =  252 bits (643), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 129/156 (82%), Positives = 141/156 (90%), Gaps = 1/156 (0%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MFTSKPAFRIK KTSKS+RKT I+K VEG  I K I+PSCFN+IRPLKK+IQIPAP+  F
Sbjct: 1   MFTSKPAFRIKKKTSKSYRKTVISK-VEGNGIVKRISPSCFNVIRPLKKDIQIPAPASRF 59

Query: 61  LKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLS 120
           LKKIQ++RI+SGNQ  QCRQ  KASI  SKK++NSFMAFRAYYSQFG+GVKQNILSSLLS
Sbjct: 60  LKKIQIHRISSGNQTTQCRQLSKASIKSSKKHINSFMAFRAYYSQFGSGVKQNILSSLLS 119

Query: 121 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 156
           EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN
Sbjct: 120 EEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNN 155

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  110 bits (274), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 96/187 (51%), Gaps = 35/187 (18%)

Query: 3   TSKPAFRIK-NKTSKSHRKTDIAKKVEGKRIA-KLINPSCFNIIRPLKKNIQIPAPSPLF 60
           +++P F++K  K  +S R T        K IA K I     N+   + K I+IP+P  + 
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 61  LKKIQ-----------------------------LYRIASGN-QNIQCRQSRKASITPSK 90
           L+KI+                              + IA  +  N+  + SRK     S+
Sbjct: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC---SE 127

Query: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFV 150
           K LNSFMAFRAY SQFG G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFV
Sbjct: 128 KPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFV 187

Query: 151 EWLTNNY 157
           EW+   Y
Sbjct: 188 EWVDQRY 194

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  110 bits (274), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 96/187 (51%), Gaps = 35/187 (18%)

Query: 3   TSKPAFRIK-NKTSKSHRKTDIAKKVEGKRIA-KLINPSCFNIIRPLKKNIQIPAPSPLF 60
           +++P F++K  K  +S R T        K IA K I     N+   + K I+IP+P  + 
Sbjct: 11  SNQPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVL 70

Query: 61  LKKIQ-----------------------------LYRIASGN-QNIQCRQSRKASITPSK 90
           L+KI+                              + IA  +  N+  + SRK     S+
Sbjct: 71  LRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIADSSLNNLSTKGSRKGC---SE 127

Query: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFV 150
           K LNSFMAFRAY SQFG G+KQNILSSLL+  WH+   Q  IWD FAQQ+NF+ P  GFV
Sbjct: 128 KPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCGFV 187

Query: 151 EWLTNNY 157
           EW+   Y
Sbjct: 188 EWVDQRY 194

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  103 bits (256), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 79/145 (54%), Gaps = 37/145 (25%)

Query: 43  IIRPLKKNIQIPAPSPLFLKKIQ-----------------------------LYRIASGN 73
           I+RP+K    IP P  + L+KI+                             L+ IAS  
Sbjct: 64  ILRPIK----IPLPPNILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDV 119

Query: 74  -QNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGI 132
             NI  + +R+   T S K LNSFMAFRAY SQFG G+KQNILSSLL+  WH+   Q GI
Sbjct: 120 LGNIYKKPARE---TASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGI 176

Query: 133 WDYFAQQYNFINPGFGFVEWLTNNY 157
           WD FAQQ+NF+ P  GFVEW+   Y
Sbjct: 177 WDTFAQQFNFVKPKCGFVEWVDQRY 201

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 95.1 bits (235), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 50/71 (70%)

Query: 87  TPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPG 146
           T SKK LN FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P 
Sbjct: 131 TSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190

Query: 147 FGFVEWLTNNY 157
            GFVEW+   Y
Sbjct: 191 CGFVEWVGQTY 201

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 89.0 bits (219), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 39/40 (97%), Positives = 39/40 (97%)

Query: 136 FAQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 175
           F QQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL
Sbjct: 15  FPQQYNFINPGFGFVEWLTNNYAEVRGDGYWEDVFVHLAL 54

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 92.0 bits (227), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 51/68 (75%)

Query: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           ++ LN F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P  GF
Sbjct: 126 ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGF 185

Query: 150 VEWLTNNY 157
           VEWL   Y
Sbjct: 186 VEWLGQTY 193

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 92.0 bits (227), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 51/68 (75%)

Query: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           ++ LN F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P  GF
Sbjct: 126 ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGF 185

Query: 150 VEWLTNNY 157
           VEWL   Y
Sbjct: 186 VEWLGQTY 193

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 83.6 bits (205), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (51%), Gaps = 24/126 (19%)

Query: 52  QIPAPSPLFLKKIQLYRI------ASGNQNIQCRQSRKASITPSKKY------------- 92
           QIP P P+ LK+I+  R+       SG   I    S +     S  +             
Sbjct: 10  QIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSS 69

Query: 93  -----LNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147
                +N+FMAFR YY+Q G G+KQN LS +LSE W+A +    IWD FAQQ+NF +P  
Sbjct: 70  SKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRC 129

Query: 148 GFVEWL 153
           GFV ++
Sbjct: 130 GFVNYI 135

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 84.0 bits (206), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 68/137 (49%), Gaps = 24/137 (17%)

Query: 41  FNIIRPLKKNIQIPAPSPLFLKKIQLYRI------ASGNQNIQCRQSRKASITPSKKY-- 92
            N++       QIP P P+ LK+I+  R+       SG   I    S +     S  +  
Sbjct: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNT 99

Query: 93  ----------------LNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYF 136
                           +N+FMAFR YY+Q G G+KQN LS +LSE W+A +    IWD F
Sbjct: 100 SIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIF 159

Query: 137 AQQYNFINPGFGFVEWL 153
           AQQ+NF +P  GFV ++
Sbjct: 160 AQQFNFASPRCGFVNYI 176

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 80.9 bits (198), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 8/135 (5%)

Query: 20  KTDIAKKVEGKRIAKLINP------SCFNIIRPLKKNIQIPAPSPLFLKKIQLYRIASGN 73
           K +I ++V  +   + + P      +CFNI     KNI IP P    L++++  RI   +
Sbjct: 15  KVNIPRRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPPNWVLQELETIRIIYPS 74

Query: 74  QNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIW 133
           +  Q  + RK   +   K +N F+ FR+YYS++G G+KQ +LS LL++ W +      +W
Sbjct: 75  K--QKPKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALW 132

Query: 134 DYFAQQYNFINPGFG 148
           DYFA QY+ +    G
Sbjct: 133 DYFALQYSTVGCEMG 147

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 50/68 (73%)

Query: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           KK LNSF+AFRAY +QFG G+ Q++LS LLS  WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 150 VEWLTNNY 157
           VEW+   Y
Sbjct: 181 VEWVGQTY 188

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 50/68 (73%)

Query: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149
           KK LNSF+AFRAY +QFG G+ Q++LS LLS  WH+   QH +WD FAQQ+NF+ P  GF
Sbjct: 121 KKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGF 180

Query: 150 VEWLTNNY 157
           VEW+   Y
Sbjct: 181 VEWVGQTY 188

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 73.2 bits (178), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/31 (100%), Positives = 31/31 (100%)

Query: 138 QQYNFINPGFGFVEWLTNNYAEVRGDGYWED 168
           QQYNFINPGFGFVEWLTNNYAEVRGDGYWED
Sbjct: 1   QQYNFINPGFGFVEWLTNNYAEVRGDGYWED 31

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 19/153 (12%)

Query: 1   MFTSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFNIIRPLKKNIQIPAPSPLF 60
           MF+ KP F++    S S  K+ I K+       +  N + F      K   +IP P+ + 
Sbjct: 1   MFSKKPLFKMNITQSHSSNKS-IRKRT------RRPNLNSFASTNAAKNTPKIPDPNII- 52

Query: 61  LKKIQLYRIASGNQNIQCRQ-----SRKASITPSK----KYLNSFMAFRAYYSQFGAGVK 111
             +  L+R  + ++NI         S K   +P +      LNSF+AFRAYYSQF  G+ 
Sbjct: 53  --RAVLFRNLNDDRNIISHDDSSSLSAKTIRSPREICKHGSLNSFIAFRAYYSQFANGIN 110

Query: 112 QNILSSLLSEEWHADKMQHGIWDYFAQQYNFIN 144
           QN LSS+LS+ W +++ Q   WD   +QY  I+
Sbjct: 111 QNKLSSILSKFWKSNQSQQTFWDRLTEQYKQID 143

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 69  IASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADK 127
           I   N N     S +  I   +K +N FMAFR+YYS+F  G V Q  LS +L++ WH   
Sbjct: 89  IKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKP 148

Query: 128 MQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158
                W+ FA+ YN   P   F EWL   Y 
Sbjct: 149 KMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 45/91 (49%), Gaps = 1/91 (1%)

Query: 69  IASGNQNIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADK 127
           I   N N     S +  I   +K +N FMAFR+YYS+F  G V Q  LS +L++ WH   
Sbjct: 89  IKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKP 148

Query: 128 MQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158
                W+ FA+ YN   P   F EWL   Y 
Sbjct: 149 KMKRTWEMFAEHYNMEQPDQSFPEWLEKTYT 179

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 90  KKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFG 148
           KK +N F+ FR+YY++F  G V+Q  LS +LSE W  +   H +W++F Q YN       
Sbjct: 95  KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMC 154

Query: 149 FVEWLTNNYAE 159
           F  WL  NY +
Sbjct: 155 FTLWLEENYQQ 165

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 16/118 (13%)

Query: 53  IPAPSPLFLKKIQ-----------LYRIASGNQNIQCRQSRKASITPSKKYLNSFMAFRA 101
           IPAP  + +  I+           L  + + NQ      SR       KK +N F+AFR+
Sbjct: 59  IPAPPQVLVAYIKEKVKTLNKSEVLMSLGNSNQ----LSSRDVKTKTKKKQINDFIAFRS 114

Query: 102 YYSQFGAGV-KQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEWLTNNYA 158
           YYS+   G+  Q  LS+++S+ W  DK     W+  AQ+YN    G  F  WL  NY 
Sbjct: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYG 172

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N   
Sbjct: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVM 153

Query: 148 GFVEWLTNNY-AEVRG 162
            F EWL  NY  E+ G
Sbjct: 154 CFTEWLEKNYKPEIEG 169

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N   
Sbjct: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVM 153

Query: 148 GFVEWLTNNY-AEVRG 162
            F EWL  NY  E+ G
Sbjct: 154 CFTEWLEKNYKPEIEG 169

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N   
Sbjct: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVM 153

Query: 148 GFVEWLTNNY-AEVRG 162
            F EWL  NY  E+ G
Sbjct: 154 CFTEWLEKNYKPEIEG 169

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 89  SKKYLNSFMAFRAYYSQFGAG-VKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGF 147
           SKK +N F+ FR+YY++   G ++Q  LS++LS+ W +    H  W++F + YN  N   
Sbjct: 94  SKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVM 153

Query: 148 GFVEWLTNNY-AEVRG 162
            F EWL  NY  E+ G
Sbjct: 154 CFTEWLEKNYKPEIEG 169

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 31/47 (65%)

Query: 93  LNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQ 139
           LN FMAFR+YYSQ+  G+KQ  LS +L++ WH+D  +   W    Q+
Sbjct: 121 LNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%)

Query: 136 FAQQYNFINPGFGFVEWLTNN 156
           F QQYNFINPGFGFVEWLTNN
Sbjct: 15  FPQQYNFINPGFGFVEWLTNN 35

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/20 (100%), Positives = 20/20 (100%)

Query: 137 AQQYNFINPGFGFVEWLTNN 156
           AQQYNFINPGFGFVEWLTNN
Sbjct: 16  AQQYNFINPGFGFVEWLTNN 35

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/21 (95%), Positives = 20/21 (95%)

Query: 136 FAQQYNFINPGFGFVEWLTNN 156
           F QQYNFINPGFGFVEWLTNN
Sbjct: 12  FPQQYNFINPGFGFVEWLTNN 32

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 91  KYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFV 150
           K +N FM FR+YYSQ+G G+KQ++LS LLS+ W+A +    +WD FAQQ N I    G  
Sbjct: 61  KSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGIC 120

Query: 151 E 151
           E
Sbjct: 121 E 121

>Skud_15.84 Chr15 complement(159441..160871) [1431 bp, 476 aa] {ON}
           YOL068C (REAL)
          Length = 476

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 49  KNIQIPAPSPLFLKKIQLYRIASGNQNIQCRQSRKASITPSKKYLNSFMAF--RAYYSQF 106
           +N+++P     + K+ Q + + +GN  +Q   S  ++I  S   L   M F   A  S+F
Sbjct: 308 RNLELPLCPYCYQKRKQYFPMTNGNNTMQTNTSFNSTILKSYGVLKPDMTFFGEALPSRF 367

Query: 107 GAGVKQNILSSLL 119
              ++++IL   L
Sbjct: 368 HKTIRKDILECDL 380

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 29.6 bits (65), Expect = 4.4,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 12/74 (16%)

Query: 75  NIQCRQSRKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWD 134
           +I  +Q   AS  P     N   A+ +YYS   +  +Q+ L S   +E H D M      
Sbjct: 184 DIATQQKFSASTDP-----NVANAYNSYYSNASSAAQQSYLHSHQQQETHMDNMGE---- 234

Query: 135 YFAQQYNFINPGFG 148
               +Y+ IN G G
Sbjct: 235 ---SRYSQINRGVG 245

>Smik_16.227 Chr16 complement(413782..415968) [2187 bp, 728 aa] {ON}
           YPL009C (REAL)
          Length = 728

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 3   TSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFN 42
           +SK A RI+N+ S++ +K D A+    ++I  L+N    N
Sbjct: 345 SSKYALRIQNQESQAQKKIDDARTENNRKIQALLNVQELN 384

>Smik_16.226 Chr16
           complement(412865..412927,412942..412992,412996..413022,
           413042..413074,413078..413131,413135..413203,
           413207..413260,413314..413457,413489..413518,
           413522..413575,413584..413613,413668..413694,
           413698..413736,413785..415968) [2859 bp, 953 aa] {OFF}
           YPL009C (PSEUDO)
          Length = 953

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 3   TSKPAFRIKNKTSKSHRKTDIAKKVEGKRIAKLINPSCFN 42
           +SK A RI+N+ S++ +K D A+    ++I  L+N    N
Sbjct: 345 SSKYALRIQNQESQAQKKIDDARTENNRKIQALLNVQELN 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,259,050
Number of extensions: 799326
Number of successful extensions: 1923
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1938
Number of HSP's successfully gapped: 48
Length of query: 175
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 73
Effective length of database: 41,785,467
Effective search space: 3050339091
Effective search space used: 3050339091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)