Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5995.527ON82782737430.0
Skud_4.6965.527ON81182929580.0
Smik_4.6975.527ON81782928680.0
YDR422C (SIP1)5.527ON81582628400.0
CAGL0F03047g5.527ON7448149081e-109
NCAS0F010905.527ON7873688801e-105
TDEL0A039105.527ON7493898741e-105
NDAI0H016005.527ON8423718531e-101
ZYRO0D12562g5.527ON8183908511e-101
SAKL0G04928g5.527ON8923778375e-98
Kwal_47.186425.527ON3093167481e-91
ADR194C5.527ON6373557515e-88
KLTH0G03762g5.527ON7093627522e-87
TBLA0D016505.527ON10163677042e-78
Ecym_40655.527ON7213246865e-78
KNAG0C032305.527ON5613736476e-74
KAFR0E033005.527ON4663465872e-66
Kpol_1004.215.527ON7553705867e-64
Kpol_1023.985.527ON6673754865e-51
TPHA0K005305.527ON6461622646e-23
KLLA0B00583g3.517ON4863052012e-15
Suva_5.1233.517ON4232831931e-14
Ecym_12103.517ON4502951851e-13
TBLA0I032703.517ON4332881832e-13
Skud_5.1363.517ON4182821762e-12
Smik_5.1503.517ON4172861752e-12
YER027C (GAL83)3.517ON4172851724e-12
TPHA0A058103.517ON4242901716e-12
ZYRO0E08404g3.517ON3482841554e-10
TDEL0D058503.517ON4042981441e-08
NCAS0F037303.517ON4321651403e-08
KLTH0G01848g3.517ON416771379e-08
Kpol_195.23.517ON4351721342e-07
Kwal_47.190403.517ON429771342e-07
CAGL0A03696g3.517ON415761333e-07
KNAG0B006003.517ON389761323e-07
Smik_7.553.517ON4151201314e-07
KAFR0I023803.517ON4091221297e-07
SAKL0F02002g3.517ON503821299e-07
KNAG0B036905.527ON3261181242e-06
CAGL0K09350g3.517ON432761243e-06
KAFR0F041403.517ON348631233e-06
KNAG0E015903.517ON423781217e-06
NCAS0E006203.517ON500761217e-06
NDAI0B060103.517ON503561191e-05
Skud_7.603.517ON441761172e-05
AER361C3.517ON475761172e-05
YGL208W (SIP2)3.517ON415761172e-05
Suva_7.533.517ON414771163e-05
NDAI0I028903.517ON582411111e-04
Kwal_47.18638singletonOFF377325771.1
TBLA0D042107.220ON59178771.7
Skud_15.4458.743ON285516910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.599
         (827 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...  1446   0.0  
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...  1144   0.0  
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...  1109   0.0  
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...  1098   0.0  
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   354   e-109
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   343   e-105
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   341   e-105
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   333   e-101
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   332   e-101
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   327   5e-98
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   292   1e-91
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   293   5e-88
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   294   2e-87
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   275   2e-78
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   268   5e-78
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   253   6e-74
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   230   2e-66
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   230   7e-64
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   191   5e-51
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   106   6e-23
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    82   2e-15
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    79   1e-14
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    76   1e-13
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    75   2e-13
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    72   2e-12
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    72   2e-12
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    71   4e-12
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    70   6e-12
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    64   4e-10
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    60   1e-08
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    59   3e-08
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    57   9e-08
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    56   2e-07
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    56   2e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    56   3e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    55   3e-07
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    55   4e-07
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    54   7e-07
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    54   9e-07
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    52   2e-06
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    52   3e-06
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    52   3e-06
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    51   7e-06
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     51   7e-06
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    50   1e-05
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    50   2e-05
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    50   2e-05
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    50   2e-05
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    49   3e-05
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    47   1e-04
Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [cont...    34   1.1  
TBLA0D04210 Chr4 complement(1039847..1041622) [1776 bp, 591 aa] ...    34   1.7  
Skud_15.445 Chr15 complement(785067..785924) [858 bp, 285 aa] {O...    31   10.0 

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score = 1446 bits (3743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/827 (87%), Positives = 721/827 (87%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60
           MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI
Sbjct: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60

Query: 61  PPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120
           PPRMQLLASQP            NNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY
Sbjct: 61  PPRMQLLASQPSTSSTSDCDDSTNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120

Query: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180
           DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE
Sbjct: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180

Query: 181 RHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXXXXKAGSIDIPIKQTYSKKPSVHA 240
           RHRSSIIALKKTLLEN                       KAGSIDIPIKQTYSKKPSVHA
Sbjct: 181 RHRSSIIALKKTLLENSATASPSPTRSSSIHSTSLLPLSKAGSIDIPIKQTYSKKPSVHA 240

Query: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300
           YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV
Sbjct: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300

Query: 301 NSSNSTYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMM 360
           NSSNSTYTIDSATH                     IGYKENSSDSNDDSGAPISATAKMM
Sbjct: 301 NSSNSTYTIDSATHNNNNNNNNNSNSNNSSNSENNIGYKENSSDSNDDSGAPISATAKMM 360

Query: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKXXXXXXXXXXXXXXXXXXQPRKSVLTNSLNL 420
           MKLYGDKTLMERDLNKHQNKSLKKVQNKK                  QPRKSVLTNSLNL
Sbjct: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKLRSASNSRRSSFASLHSLQPRKSVLTNSLNL 420

Query: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYXXXXXXXXXXXXXXXXXXLVILKWKNNSNMP 480
           QPLHPLHPIINDNDSQYSVPQHREIPHHY                  LVILKWKNNSNMP
Sbjct: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYNSMSSMSSISSTNSSESTLVILKWKNNSNMP 480

Query: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540
           ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP
Sbjct: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540

Query: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600
           GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID
Sbjct: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600

Query: 601 VEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660
           VEAPIRPEP              AKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL
Sbjct: 601 VEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660

Query: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDDLFATLQ 720
           DLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDDLFATLQ
Sbjct: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDDLFATLQ 720

Query: 721 QGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHV 780
           QGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHV
Sbjct: 721 QGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHV 780

Query: 781 NLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGNK 827
           NLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGNK
Sbjct: 781 NLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGNK 827

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/829 (71%), Positives = 635/829 (76%), Gaps = 22/829 (2%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60
           MGNSPSTQDPSHS+K++H +HLHEAFNKDRQGSITSQLFNN+KS+HKRH+SHA+   AAI
Sbjct: 1   MGNSPSTQDPSHSSKRNHGYHLHEAFNKDRQGSITSQLFNNKKSVHKRHTSHASSHKAAI 60

Query: 61  PPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120
           P RMQLLAS              NND     EPSPLFKKDYS+A AAD+N+TTLANLSL 
Sbjct: 61  PHRMQLLASH---DVASDCDSSVNNDTIIDKEPSPLFKKDYSLANAADENDTTLANLSLN 117

Query: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180
           D HD SAPEEQVKSP+FLSPGPSMATVKQTK+  DDLSTVN T+VDET+ +ER  HPHHE
Sbjct: 118 DDHDGSAPEEQVKSPSFLSPGPSMATVKQTKSDLDDLSTVNCTVVDETMENERSGHPHHE 177

Query: 181 RHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXXXXKAGSIDIPIKQTYSKKPSVHA 240
           RHRSSIIALKKTL+EN                       K GSIDIP+KQTYSKKPSVHA
Sbjct: 178 RHRSSIIALKKTLMENSATASPSPTRSSSVHSASLPPLTKTGSIDIPVKQTYSKKPSVHA 237

Query: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300
           YQYQYL PDPT S +S   KE+  DNIDAEAGVLQSEDMVLNQSLLQNALKKD+QRLSR 
Sbjct: 238 YQYQYLSPDPTFSGNSHTGKEANGDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRA 297

Query: 301 NSSNSTYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMM 360
           NSSNSTYT+                          I  KENS D +DDS  PISATAKMM
Sbjct: 298 NSSNSTYTMGRENRINNSESN--------------IDGKENSIDPSDDSTVPISATAKMM 343

Query: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKXXXXXXXXXXXXXXXXXXQPRKSVLTNSLNL 420
           MKLYGDKTLMERDLNKHQNK+ KK QNKK                  Q +KS+LTN LNL
Sbjct: 344 MKLYGDKTLMERDLNKHQNKT-KKAQNKKLRSASNSRRSSFASLHSLQSKKSILTNGLNL 402

Query: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYXXXXXXXXXXXXXXXXXXLVILKWKNNSNMP 480
           QPLHPLHPIINDN+SQYS PQHREI HH                   LV+LKWK+++NM 
Sbjct: 403 QPLHPLHPIINDNESQYSAPQHREISHHSNSISSMSSISSTNSTENTLVVLKWKSDTNMT 462

Query: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540
           ATTEVSI+S+DIAS LKEQ EVNLD+DASLDSEK LN RIRMIYD+VH+EWFVP+LFLP 
Sbjct: 463 ATTEVSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHREWFVPDLFLPA 522

Query: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600
           GIYRLQFSING+LTHSNFLPTATDSEG FVNWFEVLPGYHTIEPFRDEAD + Q+ ST+D
Sbjct: 523 GIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRDEADMDFQMRSTLD 582

Query: 601 VEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660
            EAPIRPEP              AK  ERP TPFSDYRGLSRSNS  LR SFVRLKASSL
Sbjct: 583 EEAPIRPEPKRLSSSRKSSYYS-AKDGERPGTPFSDYRGLSRSNSVFLRGSFVRLKASSL 641

Query: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPIQ---EDLPSQDLPSFTHKVVDCNQDDLFA 717
           DLMA+IKPE LEYSNEIP+LF IG  S T  +   E L  QD PSFTHKVVDCNQDDLFA
Sbjct: 642 DLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFERLSPQDRPSFTHKVVDCNQDDLFA 701

Query: 718 TLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHII 777
           TLQQGGNIDAETAE VFLSRYPIPDLPIYLNSSYLN+ILNQ NPNSE  D DEG INHII
Sbjct: 702 TLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNRILNQSNPNSEFHDGDEGGINHII 761

Query: 778 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGN 826
           PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKA GN
Sbjct: 762 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAGGN 810

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/829 (68%), Positives = 618/829 (74%), Gaps = 18/829 (2%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60
           MGNSPSTQDPSHS KK+H +H HE FNKDRQGSITSQLFNNRKSIHKRH SH +  N  I
Sbjct: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60

Query: 61  PPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120
           P RMQLLAS              N+D +   EPS LFKKDYS+   AD N+TTLANLSL 
Sbjct: 61  PSRMQLLASH---DSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLI 117

Query: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180
           D HD  APEEQVKSP+FLSPGPSMATVKQTK+  ++LST N T VDE   D R +HP HE
Sbjct: 118 DDHDVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHE 177

Query: 181 RHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXXXXKAGSIDIPIKQTYSKKPSVHA 240
           RHRSSIIALKKTLLEN                       K  SID P+K  YSKKPS+HA
Sbjct: 178 RHRSSIIALKKTLLENSATASPSPTRSSSVHSASMPPLTKMDSIDTPLKPAYSKKPSIHA 237

Query: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300
           YQYQYL PDPT S +SQ  KE  SDNIDAEAGVLQSEDMVLNQSLLQNALKKD+QRLSR 
Sbjct: 238 YQYQYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRA 297

Query: 301 NSSNSTYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMM 360
           NSSNST TI+++                       I  KE+S   ND+S  PISATAKMM
Sbjct: 298 NSSNSTCTIENSN-----------NNNNYSSSENNIRNKEDSGSFNDNSNVPISATAKMM 346

Query: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKXXXXXXXXXXXXXXXXXXQPRKSVLTNSLNL 420
           MKLYGDKTLMERDLNKHQ K+ KKVQNKK                  Q +KS+LTNSLNL
Sbjct: 347 MKLYGDKTLMERDLNKHQTKT-KKVQNKKLKSVSNSRRSSFASLHSLQSKKSILTNSLNL 405

Query: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYXXXXXXXXXXXXXXXXXXLVILKWKNNSNMP 480
           QPLHPLHPIINDN+SQYS PQHRE+ H                    LVILKWKN SNM 
Sbjct: 406 QPLHPLHPIINDNESQYSAPQHREMSHPSNSMSSMSSISSTNSAESTLVILKWKNYSNMA 465

Query: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540
            TTEVSI+S+DIAS LKEQ EV+ DE ASLDSEKQLNPRIRM+YD VHKEWF P+LFLPP
Sbjct: 466 VTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPP 525

Query: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600
           GIYRLQFSING+LTHSN+LPTATDSEG FVNWFEVLPGYHTIEPFR+EAD  SQV   ++
Sbjct: 526 GIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLE 585

Query: 601 VEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660
            E+PIRPE               AKGVERPSTPFSDYRGLSRS+S N+RDSFVRLKASSL
Sbjct: 586 EESPIRPELKRFSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSL 645

Query: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPI---QEDLPSQDLPSFTHKVVDCNQDDLFA 717
           DLMA+IKPE LEYSNEIP+LF I +G  T +     D   Q+ PSFT+KVVDCNQDDLFA
Sbjct: 646 DLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFA 705

Query: 718 TLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHII 777
           TLQQGGNIDAETAE VFLSRYPIPDLPIYLNSSYLNKILNQ NPNSE  D+DEGAINHII
Sbjct: 706 TLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHII 765

Query: 778 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGN 826
           PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKA GN
Sbjct: 766 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKARGN 814

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/826 (68%), Positives = 626/826 (75%), Gaps = 18/826 (2%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60
           MGNSPSTQDPSHS KK+H HH H+AFNKDRQGSITSQLFNNRKS HKR +SH +  N AI
Sbjct: 1   MGNSPSTQDPSHSTKKEHGHHFHDAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAI 60

Query: 61  PPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120
           PPRMQLLAS              ++D +    PS LFKKDYS++ AAD N+TTLANL+L 
Sbjct: 61  PPRMQLLASH---DPSTDCDGRMSSDTTIDKGPSHLFKKDYSLSSAADVNDTTLANLTLS 117

Query: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180
           D HD  APEEQVKSP+FLSPGPSMATVK+TK+  DDLST+N T+VDET  +ER D PHHE
Sbjct: 118 DDHDVGAPEEQVKSPSFLSPGPSMATVKRTKSDLDDLSTLNYTMVDETTENERNDKPHHE 177

Query: 181 RHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXXXXKAGSIDIPIKQTYSKKPSVHA 240
           RHRSSIIALKK LLE+                       K  SIDIP++Q YSKKPS+HA
Sbjct: 178 RHRSSIIALKKNLLESSATASPSPTRSSSVHSASLPALTKTDSIDIPVRQPYSKKPSIHA 237

Query: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300
           YQYQYL+ D T S++SQ+DKE  SD++DAEAGVLQSEDMVLNQSLLQNALKKD+QRLSRV
Sbjct: 238 YQYQYLNNDETFSENSQMDKEGNSDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRV 297

Query: 301 NSSNSTYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMM 360
           NSSNS YT +  +H                        K N+  SNDD  APISATAKMM
Sbjct: 298 NSSNSMYTAERISHANNNGNIENNTRN-----------KGNAGGSNDDFTAPISATAKMM 346

Query: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKXXXXXXXXXXXXXXXXXXQPRKSVLTNSLNL 420
           MKLYGDKTLMERDLNKH NK+ KK QNKK                  Q RKS+LTN LNL
Sbjct: 347 MKLYGDKTLMERDLNKHHNKT-KKAQNKKIRSVSNSRRSSFASLHSLQSRKSILTNGLNL 405

Query: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYXXXXXXXXXXXXXXXXXXLVILKWKNNSNMP 480
           QPLHPLHPIINDN+SQYS PQHREI HH                   LV+LKWK++  + 
Sbjct: 406 QPLHPLHPIINDNESQYSAPQHREISHHSNSMSSMSSISSTNSTENTLVVLKWKDDGTVA 465

Query: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540
           ATTEV I+S DIAS LKEQ E+ LDE+ASLDSEKQLNPRIRM+YD VHKEWFVP+LFLP 
Sbjct: 466 ATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLPA 525

Query: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600
           GIYRLQFSINGILTHSNFLPTATDSEG FVNWFEVLPGYHTIEPFR+EAD +SQV  T+D
Sbjct: 526 GIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADIDSQVEPTLD 585

Query: 601 VEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660
            E P RPE               AKGVERPSTPFSDYRGLSRS+S N+RDSFVRLKASSL
Sbjct: 586 EELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLSRSSSINMRDSFVRLKASSL 645

Query: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPIQ---EDLPSQDLPSFTHKVVDCNQDDLFA 717
           DLMA++KPE L YSNEIP+LF IG+GS   ++   +D+  Q+ PSFTH+VVDCNQDDLFA
Sbjct: 646 DLMAEVKPERLVYSNEIPNLFNIGDGSTISVKGDSDDVHPQEPPSFTHRVVDCNQDDLFA 705

Query: 718 TLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHII 777
           TLQQGGNIDAETAE VFLSRYP+PDLPIYLNSSYLN+ILNQ N NSES ++DEGAINHII
Sbjct: 706 TLQQGGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNRILNQSNQNSESHERDEGAINHII 765

Query: 778 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKA 823
           PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV+YAPCYYKTQK+
Sbjct: 766 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVVYAPCYYKTQKS 811

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  354 bits (908), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 276/814 (33%), Positives = 378/814 (46%), Gaps = 175/814 (21%)

Query: 96  LFKKDYSVAKAADDNE------TTLANLSLYDRH-DASAPEEQVKSPTFLSPGPSMATVK 148
           LFK+DYSV K A + E        +A LSL     D SA           SPGPS ATV+
Sbjct: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALH-------ISSPGPSNATVQ 56

Query: 149 QTKNYPDDLSTVNNTIVDET-IGDERKDHPHHER----HRSSIIALKKT----------- 192
             K           T  DE+  GD    +  H R    HR SI+ALK +           
Sbjct: 57  TIKR--------EVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEAAAAK 108

Query: 193 -----------LLENXXXXXXXXXXXXXXXXXXXXXXXKAGSIDIPI----KQTYSKKPS 237
                      ++++                       +  SIDIP     +++ ++  +
Sbjct: 109 RKNLPFRTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVN 168

Query: 238 VHAYQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRL 297
              Y Y Y              + S     D + G+LQ  D+VLNQ LL+ ALK+D++R 
Sbjct: 169 SKPYLYNY--------------EPSGVPVGDPDGGMLQGTDVVLNQELLEQALKRDMKRK 214

Query: 298 SRVNSSNSTYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATA 357
                 +ST  ++                                     ++  P SATA
Sbjct: 215 RADTMQSSTVELNKKVDTNTSKNSNHTEIMKNPP----------------ETAEPTSATA 258

Query: 358 KMMMKLYGDKTLMERDLNKHQNKSLKKVQNKKXXXXXXXXXXXXXXXXXXQPRKSVLTN- 416
            MMM+LYGD+TL+ + + K      K+ +NK                     ++ +L+N 
Sbjct: 259 AMMMRLYGDRTLLNQQITKQ-----KEDENKYSHTITNAAYKKLKPFSGV--KRKILSNP 311

Query: 417 SLNLQPLHPLHPIINDNDSQY----SVPQHREIPHHYXXXXXXXXXXXXXXXXXXLVILK 472
           +LNLQPL P+ P       Q     S   H E P                      VILK
Sbjct: 312 NLNLQPLEPIRPNEPPTSGQRTPNNSAHVHSESP----------------SPDRTNVILK 355

Query: 473 WKNNSNMPATTE--VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKE 530
           W+++ N     E  V ++S++I ++LK   ++  +         Q N +I + YD+ + E
Sbjct: 356 WRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFN-KIPLSYDSHNNE 414

Query: 531 WFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEAD 590
           W+VP+L+LP GIYRLQF +NG L HS+FLPTATD +G  +NWFEVL GY  IEP+RDE++
Sbjct: 415 WYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESE 474

Query: 591 TESQVGSTID---------------------------VEAPIRPEPXXXXXXXXXXXXXX 623
            +S   S++D                           V   ++                 
Sbjct: 475 IQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYS 534

Query: 624 AKGVERPSTPFSDYRGLSRSNS----------ANLRDSFVRLKASSLDLMAQIKPEILEY 673
           AK  E+  T FSDY G+SR+NS          AN RD+        L+    IKP++ EY
Sbjct: 535 AKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDN-------DLEFFPPIKPKVYEY 587

Query: 674 SNEIPSLFTIG---------NGSATPIQEDLPSQ--DLPSFTHKVVDCNQDDLFATLQQG 722
           SN IP+LF I          NG+     E+ P    D PSFT++VVDCNQD LF  LQ+G
Sbjct: 588 SNNIPALFRISCDMEDVDDDNGT-----ENNPRAFYDRPSFTNRVVDCNQDALFGDLQKG 642

Query: 723 GNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNL 782
           G +DAE AE +FL +Y +PDLP+YLNS+YLNKI ++ +  +    +D  +INHIIPHVNL
Sbjct: 643 GKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQD-SSINHIIPHVNL 701

Query: 783 NHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
            HLLTSSIRD I+SVACTTRY GKFITQVIYAPC
Sbjct: 702 KHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  343 bits (880), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/368 (50%), Positives = 232/368 (63%), Gaps = 36/368 (9%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           V+LKW++  + P   ++SI+S DI+S              ++ ++     ++ M+++ + 
Sbjct: 430 VVLKWRDQIDNPKHCKISIVSDDISS--------------AIPAKATKAGKLPMLFNPMI 475

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
           KEW+VP L LPPGIYRL+FSING LTHSNFLPTATDS G  VNWFEVLPGY T+EP+RDE
Sbjct: 476 KEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDE 535

Query: 589 --ADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSA 646
               T    GS    +  +R                 A G     TP+SDY G+SRSNSA
Sbjct: 536 IIETTFHTNGS----QGTLRDNNPTTIRSRRSSSFVSANGDLASMTPYSDYTGISRSNSA 591

Query: 647 --NLRDSFVRLKA-SSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPI--------QEDL 695
             + R S V L+    LDL   ++P+ +EYSNEIP LF I N               E L
Sbjct: 592 LNSKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNETL 651

Query: 696 PSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKI 755
              + PSFT++VVDCNQD LF+ LQ+ GNIDAETAE++FL++Y +PDLPIYLNSSYLNKI
Sbjct: 652 SPFEEPSFTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKI 711

Query: 756 LNQ-----GNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQ 810
             Q      +P   +       I HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQ
Sbjct: 712 FLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQ 771

Query: 811 VIYAPCYY 818
           V+YAPC Y
Sbjct: 772 VMYAPCNY 779

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 118/431 (27%), Positives = 173/431 (40%), Gaps = 143/431 (33%)

Query: 1   MGNSPSTQDPSHSAK---------KD----HSHHLHEAFNKDRQGSITSQLFNNRKSIHK 47
           MGN+PS+ + +   K         KD    H+ HL +    +R+GSI+S LF N+ S  K
Sbjct: 3   MGNNPSSSEHTQKDKEEEEEEEAIKDTIILHNKHL-DHLQDERKGSISSNLFTNKNS-SK 60

Query: 48  RHS------SHANYDNAAIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDY 101
           RH+      S    DN   PP                               +  FKK Y
Sbjct: 61  RHATSIMSQSKVTNDNIQNPPE------------------------------TVFFKKGY 90

Query: 102 SVAKAA-DDNETTLANLSLYDRHDASAP------------EEQVKSPTFLSPGPSMATVK 148
           S++++  DD++      +  D  +   P            +E  KS +F+SPGP+  TV+
Sbjct: 91  SISRSMQDDSDIKTEGQATVDSENIHEPMASLSLKTSMENDENRKSFSFMSPGPANPTVE 150

Query: 149 QTKNYPDDLSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENXXXXXXXXXXXX 208
           QTK+   D++   N+                  HR SI+ LK+TL               
Sbjct: 151 QTKH---DVTNKENSF----------------EHRPSIVTLKQTLSGTKVTNDNNIDKLN 191

Query: 209 XXXXXXXXX-----------XXKAGSIDIPIKQTYS---------KKPSVHAYQYQYL-- 246
                                 + GSIDIP +  Y+         K+ SVHAYQ+ Y   
Sbjct: 192 KTISSSSNSQSVSTASSSSIANRTGSIDIPKENRYNFKDAMDTIPKQHSVHAYQHDYFTI 251

Query: 247 -DPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRVNSSNS 305
            D +     D +L   +  DN  +E GVLQ+ D+VLNQS L++A+K+D++R  R ++  S
Sbjct: 252 NDENARNGSDGRL--STSGDN--SEPGVLQNVDIVLNQSFLKDAMKRDMKR-KRTDTGAS 306

Query: 306 TYTIDSATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMMMKLYG 365
           T T D                                 +   +   PISATA MM+KLYG
Sbjct: 307 TATPD--------------------------------IEKPTEKKKPISATAAMMLKLYG 334

Query: 366 DKTLMERDLNK 376
           DK  ME++  K
Sbjct: 335 DKNQMEKEEKK 345

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  341 bits (874), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/389 (48%), Positives = 237/389 (60%), Gaps = 45/389 (11%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           VILKW++    P+  +++IIS DIAS L      N D      S+K  +    M YD   
Sbjct: 376 VILKWRDQIEDPSKCKITIISTDIASAL------NFDP-----SDKSFHGTFSMKYDEKE 424

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
             ++VP L LPPGIY+ QF ING + HSN LP+ATDS G  VNWFEV+PGY ++EPFR+E
Sbjct: 425 NNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNE 484

Query: 589 ADTESQVGSTIDV--------------EAP-----IRPEPXXXXXXXXXXXXXXAKGVER 629
            D    +G  ID               E+P     ++P P               K  ER
Sbjct: 485 IDYHENMG--IDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQ-ER 541

Query: 630 PSTPFSDYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGN--GS 687
             TP+SDY G+SR NSA  +   +    SS+DL+  ++P+  EYSNEIP LF  GN  G 
Sbjct: 542 SGTPYSDYTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQ 601

Query: 688 ATPIQ--------EDLPSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYP 739
           +   Q         + PS D PSF   VVDCNQD+LF +LQQGG +DAETAE +FL +Y 
Sbjct: 602 SDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKYT 661

Query: 740 IPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVAC 799
           +PDLP+YLNS+YLNKI N+   ++  G    G +NHIIPHVNLNHLLTSSIRDE+ISV C
Sbjct: 662 VPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSG-LNHIIPHVNLNHLLTSSIRDEMISVGC 720

Query: 800 TTRYEGKFITQVIYAPCYYKTQ-KAHGNK 827
           TTRYEGKFITQV+YAPCYY +  KA G K
Sbjct: 721 TTRYEGKFITQVVYAPCYYASGPKAEGKK 749

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 131/319 (41%), Gaps = 84/319 (26%)

Query: 1   MGNSPSTQDPSHSAKK--DHSHHLHEA-----FNKDRQGSITSQLFNNRKSIH-KRHSSH 52
           MGNSPS Q+         D +H    A      N  RQ SITSQLF +R + H   HS +
Sbjct: 1   MGNSPSVQEHQQQPHGVLDANHPFRRAQLGNEMNSGRQQSITSQLFPSRNTRHVGPHSMN 60

Query: 53  ANYDNAAIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDN-- 110
           A  +    P                              +P  LFK DYS+   A++   
Sbjct: 61  AKRNRHPHP------------------------------QPPSLFKSDYSLRSTAEETPA 90

Query: 111 --------ETTLANLSLYDRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNN 162
                      +A LSL       +  E  + P+FL+PG S  TV+ T+      + + N
Sbjct: 91  NTGSTENIRDNMAGLSL------KSSNENAQVPSFLTPGHSTPTVQPTRQAAVPAADLKN 144

Query: 163 TIVDETIGDERKDHPHHERHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXXXXKAG 222
            + +    +++K+   H   R S++ALKKTLL++                        + 
Sbjct: 145 KLQNGL--NQQKEISSHRFQRPSVVALKKTLLDDGELHSTSSRSTSGDVVS-------SA 195

Query: 223 SIDIPIKQTYSKKPSVHAYQYQYLDPD-PTLSDDSQLDKESKSDNID----AEAGVLQSE 277
           S+DI                Y  L+ D PT S     D ++  D  D    ++ G LQSE
Sbjct: 196 SLDI----------------YSALNLDSPTQSGSKAKDTDADPDTSDFDDISDDGYLQSE 239

Query: 278 DMVLNQSLLQNALKKDIQR 296
           D+VLNQSLLQN L++D++R
Sbjct: 240 DVVLNQSLLQNVLRRDMKR 258

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  333 bits (853), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/371 (50%), Positives = 233/371 (62%), Gaps = 29/371 (7%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           V+LKW++  + P   +++IIS DI + L+             ++    N  + M+++ + 
Sbjct: 479 VVLKWRDQIDNPKKCKIAIISDDIVNALESS-----SSKRKSNTNNNDNNTLPMVFNPMI 533

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
           KEW++P L LPPGIYRL+FSIN  +THSNFLPTATDS G  VNWFEVLPGY  +EP+RDE
Sbjct: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593

Query: 589 ADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNS--- 645
              E+    T   +  +                  AK      TP+SDY G+SRS+S   
Sbjct: 594 I-IETTF-HTAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSSSVG 651

Query: 646 -ANLRDSFVRLKASS-LDLMAQIKPEILEYSNEIPSLFTIGNGSAT---PIQEDLPSQ-D 699
            A  + S V L+ ++ LDL   I+P+ + YS EIP LF I N   T    I +D  S  +
Sbjct: 652 TATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFE 711

Query: 700 LPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQG 759
            PSFTHKV+DCNQD LFA LQ+ GNIDAETAE +FL+RYPIPDLPIYLNS+YLNKI  Q 
Sbjct: 712 RPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQF 771

Query: 760 N--------PNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 811
                    P S S       + HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQV
Sbjct: 772 QKQHNDPTLPASSS-----IGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQV 826

Query: 812 IYAPCYYKTQK 822
           +YAPC Y +Q+
Sbjct: 827 MYAPCNYSSQE 837

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 127/427 (29%), Positives = 182/427 (42%), Gaps = 109/427 (25%)

Query: 1   MGNSPSTQDPSHSA-----KKDHSHHLH------EAFNKDRQGSITSQLFNNRKSIHKRH 49
           MGN+PST D  ++A     KK   H+ H      +   K+R+GSITS LF+++ S  KRH
Sbjct: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGS-SKRH 59

Query: 50  SSHANYDNAAIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSV------ 103
                   A +P  ++                          +   +FKKDYS+      
Sbjct: 60  --------ALMPKPIE---------------------AQGNIKSHNVFKKDYSMDEPLTN 90

Query: 104 ---AKAADDNET----TLANLSLYDRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDD 156
               K  D N+     T+A+LSL      S+  E+ KS +F  PGPS  TV+ TK+   D
Sbjct: 91  KGGIKNNDFNDENIHETMASLSLV----TSSDNERKKSMSFARPGPSTPTVQPTKH---D 143

Query: 157 LSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLEN--------XXXXXXXXXXXX 208
           ++++  +    T  D          HR SI+ALK TL E+                    
Sbjct: 144 ITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQS 203

Query: 209 XXXXXXXXXXXKAGSIDIPIK----------QTYSKKPSVHAYQYQYLDPDPTLSDDSQL 258
                      K  SIDIP +          +T  K P+VH+YQYQY + + T ++D  L
Sbjct: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENT-NNDGGL 262

Query: 259 --------DKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRVNSSNSTYTID 310
                   D +  + N D E+GVLQS D+V+NQS LQNALK+D++R         T TI 
Sbjct: 263 HKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR-------KRTDTIS 315

Query: 311 SATHXXXXXXXXXXXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMMMKLYGDKTLM 370
           +                        +  K+            +SATA MM+KLYGD TL 
Sbjct: 316 T--------------NKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTLK 361

Query: 371 ERDLNKH 377
           E++  K+
Sbjct: 362 EKETFKN 368

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  332 bits (851), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 238/390 (61%), Gaps = 49/390 (12%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQ-LNPRIRMIYDAV 527
           V +KW+++  +  T  +S++S DIASTL            S + +K        M Y+  
Sbjct: 441 VAIKWRDHLPVDGTNRMSMVSEDIASTL------------SFERQKHGARNTFPMRYEEE 488

Query: 528 HKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD 587
            KEW VP+L LP G+YRLQF ING LTHSN+LPTATDS G FVNWFEV+PGY  +EP+RD
Sbjct: 489 TKEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRD 548

Query: 588 EADTESQ----------VGSTIDV-----EAPIRPEPXXXXXXXX---XXXXXXAKGVER 629
           E + +S            GS + +     E  +  EP                 +  V R
Sbjct: 549 EVELDSGQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIR 608

Query: 630 PSTPFSDYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLF-TIGNGSA 688
            +TP+SDY G+SRS+SA LR S +    SSLDL   ++P+  +YSNEIP LF T     A
Sbjct: 609 SNTPYSDYTGISRSSSA-LRKSPINCTTSSLDLHTALQPKKYKYSNEIPELFKTAPITKA 667

Query: 689 TPIQEDL-------PSQDL----PS----FTHKVVDCNQDDLFATLQQGGNIDAETAEIV 733
               ED        P+ D     PS    F ++VVDCNQD+LF  LQQGG +DAETAE +
Sbjct: 668 NDENEDFTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQGGLLDAETAEQL 727

Query: 734 FLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDE 793
           FL +YP+PDLPIYLNS YLN+I+++   N+  G    G INHIIPHVNLNHLLTSSIRDE
Sbjct: 728 FLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGG-GSGGINHIIPHVNLNHLLTSSIRDE 786

Query: 794 IISVACTTRYEGKFITQVIYAPCYYKTQKA 823
           +ISV CTTRYEGKFITQVIYAPCYY+  + 
Sbjct: 787 MISVGCTTRYEGKFITQVIYAPCYYENGRT 816

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 127/337 (37%), Gaps = 93/337 (27%)

Query: 1   MGNSPST------------QDPSHSAKK-DHSHHLHEAFNKDRQGSITSQLFNNRKSIHK 47
           MGN+PS             Q+ ++S+ +   + +L E  +K RQ SITSQLF +RK+ H 
Sbjct: 1   MGNTPSAHQRVGRKGSENFQESNNSSNRYSQTKYLLEV-DKGRQSSITSQLFPSRKTRHA 59

Query: 48  RHSSHANYDNAAIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAK-- 105
                        P  +  L  +                 +    P  LFKK+YS+ +  
Sbjct: 60  -------------PSGLGNLKRKTQ---------------NVVPHPPSLFKKNYSLEEAS 91

Query: 106 -------------------AADD-----NETTLANLSLYDRHDA-SAPEEQVKSPTFLSP 140
                              AADD     N+T  +  S+ +     S        P F SP
Sbjct: 92  AGAQGPNNNNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNETGPMFFSP 151

Query: 141 GPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENXXXX 200
           GP+  TV+ TK              +E I     +   H  +R S++ALKK L E+    
Sbjct: 152 GPATPTVQPTK--------------EEAIPPMDDNMIFH--NRQSVVALKKNLEESEQPS 195

Query: 201 XXXXXXXXXXXXXXXXXXXKAGSIDIPIKQTYSKKPSVHAYQYQYLDPDPTLSDDSQLDK 260
                              +      P+ +                 P+   S D+  D 
Sbjct: 196 SRSGSSANMETRTTPIDNRRLK----PLPRQAVAAAITATATTAPATPNGRPSIDT--DP 249

Query: 261 ESKS-DNIDAEAGVLQSEDMVLNQSLLQNALKKDIQR 296
           ES   DNI ++ G L S+D+VLNQSLL N +K+D++R
Sbjct: 250 ESSDIDNI-SDDGYLHSKDIVLNQSLLHNVIKRDMKR 285

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  327 bits (837), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 186/377 (49%), Positives = 230/377 (61%), Gaps = 47/377 (12%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           V+LKW++    P T ++S+IS DI++ L            +L S K    +I M Y+   
Sbjct: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
           K WFVP L LPPG+Y+LQF ING L HSNFLPTATDS G FVNWFEVLPGY+ IEP RD 
Sbjct: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631

Query: 589 ADTESQVGSTIDVE--------------APIRPEPXXXXXXXXXXXXXXAKGVERPSTPF 634
                  GS + V               API P P              +K +ER +TP+
Sbjct: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPI-PRP-PLLSQATSSSYRSSKYIERSTTPY 689

Query: 635 SDYRG-LSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGS--ATPI 691
           SDY G LSRSNSA  R    + K+SS D+ A + P+  EYS +IP LF + +       I
Sbjct: 690 SDYTGILSRSNSA--RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEEDHDHDI 747

Query: 692 QEDLPS---------QDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPD 742
            ED PS          + PSF  +V DCNQD LF+ LQQ   IDA+ AE  FL +YP+PD
Sbjct: 748 PEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPD 807

Query: 743 LPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTR 802
           LPIYLNSSYLNK+ NQ   ++ +G+  +  +N +IPHVNLNHLLTSSIR+EIISV CTTR
Sbjct: 808 LPIYLNSSYLNKVFNQLQKDNNAGET-KAVVNPVIPHVNLNHLLTSSIREEIISVGCTTR 866

Query: 803 YEGKFITQVIYAPCYYK 819
           YEGKFIT V+YAPCYY+
Sbjct: 867 YEGKFITHVVYAPCYYE 883

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 77/194 (39%), Gaps = 40/194 (20%)

Query: 135 PTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLL 194
           P  LSPGP+  TV+ T++  + L T  + +  E   D  +D      HR SI+ALK++L+
Sbjct: 199 PFPLSPGPASPTVEPTRHEAELLPT-RSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLV 257

Query: 195 ENXXXXXXXXXXXXXXXXXXXXXXX-----------------------------KAGSID 225
           E                                                     +  SID
Sbjct: 258 EGRIGSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSID 317

Query: 226 IPIKQTYSKKPSVHAYQYQYLDPDPTLSDDSQ---LDKESKSDNIDAEAGVLQSEDMVLN 282
           IP  + ++   ++ + +      D T   D Q   L   S    +D   G L+  D++LN
Sbjct: 318 IP-GRGHAATATIGSNR------DTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLN 370

Query: 283 QSLLQNALKKDIQR 296
            ++L++A++KD++R
Sbjct: 371 NAVLESAIRKDMKR 384

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 54/113 (47%), Gaps = 28/113 (24%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60
           MGN+ ST +     K+ HSH L     +DRQ SITSQLF  R + + +  S  +   AA 
Sbjct: 1   MGNTASTVN--LQEKRHHSHLLP----RDRQHSITSQLFPGRNTRNAQDDSPVSAAAAAA 54

Query: 61  PP-----RMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAAD 108
            P     R+ L                 N+  +  S PSPLFK +YS+ ++++
Sbjct: 55  APGKWKRRLSL-----------------NHAPAVVSTPSPLFKPNYSMNESSN 90

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  292 bits (748), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 160/316 (50%), Positives = 198/316 (62%), Gaps = 19/316 (6%)

Query: 522 MIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHT 581
           M++D     W  P+L+LP G+Y+ QF ING L HS FLPTATDS G  VNWFEV+ G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 582 IEPFRDEAD---TESQVG-STIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDY 637
           IEP RD      TE+QV  S  D  A  RP P              AK +ER  TP+SDY
Sbjct: 61  IEPSRDVISNDFTENQVAISANDPSASPRP-PILSGSSSFSNWKNSAKHIERSGTPYSDY 119

Query: 638 RGL-SRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTI---GNGSATPIQE 693
            GL SR++ A  +        SS DL+A +   + EYSNEIP LF     G+ +  P QE
Sbjct: 120 TGLCSRTDLA--KPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQE 177

Query: 694 DLPSQD----LPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNS 749
            +PSQ+     PSF H+V DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP+YL+S
Sbjct: 178 SVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDS 237

Query: 750 SYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFIT 809
           S+LN +       +++  K    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFIT
Sbjct: 238 SFLNAVFRGFQEKNDTKSK----LNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFIT 293

Query: 810 QVIYAPCYYKTQKAHG 825
           Q+IY PCYY  ++  G
Sbjct: 294 QIIYTPCYYGNKEKSG 309

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  293 bits (751), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 210/355 (59%), Gaps = 27/355 (7%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           VI+KW++    P  T++SI+S DIAS +                 K    ++ M++    
Sbjct: 308 VIIKWRDCLLDPQRTKLSIVSPDIASVI----------------HKNSKRKVAMVFSKDE 351

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
           + W  P+L LPPGIY+LQF ING L HSNFLPTATDS    VNWFEV+P Y   EP+RD 
Sbjct: 352 QFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDP 411

Query: 589 ADTESQVG-STIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSAN 647
           A  E  +   +  + AP    P              A+ VER +TP SDY G+SRS SA 
Sbjct: 412 APEEVAMPPESPQLTAPAAGRPPLLKRGTSSSSR--ARVVERSNTPISDYTGISRSGSA- 468

Query: 648 LRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKV 707
            R      K+++   ++ I   +L+YS EIP LF        P     P+    SF   +
Sbjct: 469 -RPLLAHHKSANSIELSPIPRCVLQYSTEIPELF---KPEGCPPD---PNTAPGSFNENI 521

Query: 708 VDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGD 767
            DCNQD+LF  LQ+   + A+ AE V + +YP+PDLP+YLNSSYLN+I  +   +S +GD
Sbjct: 522 QDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQRSSVTGD 581

Query: 768 KDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQK 822
               +  HIIPHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ++YAPCYY++ +
Sbjct: 582 VKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAPCYYESSR 636

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  294 bits (752), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/362 (46%), Positives = 215/362 (59%), Gaps = 34/362 (9%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           VIL WK+N   P T ++SI+S DI+STL    + +               +I M++D   
Sbjct: 363 VILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFS---------------KIPMVFDMER 407

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
             W   +L+LP G+Y+ QF ING L HS++LPTATDS G  VNWFEV+ G+ +IEP RD 
Sbjct: 408 NCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV 467

Query: 589 ADTE----SQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSN 644
             +E    S+    ++  AP RP                ++ VER  TPFSDY GL  S 
Sbjct: 468 ISSEDVKLSKDQIAVEQPAPERPA-LGSDGSSSSNWKGSSRHVERSGTPFSDYTGLC-SR 525

Query: 645 SANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIG-NGSATP-------IQEDLP 696
           S   +        SS DL+A +     EY++EIP LF    +GS  P       + +D  
Sbjct: 526 SELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDG- 584

Query: 697 SQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKIL 756
           SQ  PSF H+V DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN + 
Sbjct: 585 SQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVF 644

Query: 757 NQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           +     ++S  +    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+IY PC
Sbjct: 645 SGFQDKTDSKTR----VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPC 700

Query: 817 YY 818
           YY
Sbjct: 701 YY 702

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 119/317 (37%), Gaps = 97/317 (30%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSS--------H 52
           MGN+PST   ++   K  S    E   + RQ SITSQLF +R S     S         H
Sbjct: 1   MGNNPST---ANMQNKRVSQLAQEP--RGRQDSITSQLFPSRTSGRNPESKVGWKSRVLH 55

Query: 53  ANYDNA--AIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKAADDN 110
            N  +A  A  P +Q    +             N   S +  P+P      +   +AD++
Sbjct: 56  GNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPMCT--TTHASADES 113

Query: 111 ETT-----LANLSLYDRHDASAPEEQVK---------SPTFLSPGPSMATVKQTKNYPDD 156
            ++     LA LSL  ++  S P  +           +P   SPGPS   VK TK     
Sbjct: 114 SSSSLRDHLAELSL--QNSESQPNRKTSPGLGPAPAPAPVLRSPGPSTPVVKYTK----- 166

Query: 157 LSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXX 216
               ++ I D+                SSI +LKK L+E                     
Sbjct: 167 ----HDAISDQI---------------SSITSLKKMLVEGRVGDNIHPPPT--------- 198

Query: 217 XXXKAGSIDIPIKQTYSKKPSVHAYQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQ- 275
                 SIDIP      ++PS  A    Y                  SD+ D E  +LQ 
Sbjct: 199 ------SIDIP------RRPSA-ALSDAYF-----------------SDDGDDEESLLQG 228

Query: 276 SEDMVLNQSLLQNALKK 292
           + D+V+N S+L+NA+K+
Sbjct: 229 TNDVVINNSVLENAMKR 245

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  275 bits (704), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 220/367 (59%), Gaps = 27/367 (7%)

Query: 469  VILKWKN---NSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYD 525
            VI+K+++    S +P T ++ +IS DI +TL       L E          N ++ ++Y+
Sbjct: 664  VIIKYRDPMEESEIPET-KIQLISKDINTTLHYDTTDLLTE----------NNKMELVYN 712

Query: 526  AVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPF 585
               K W +P L LPPGIY++QF +N  L HS+FLPTATD  G  VNWFEVL GY  IEPF
Sbjct: 713  KDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPF 772

Query: 586  RDEADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNS 645
            RDE +  S   S   +   I PE               A    + STP S+Y G+SRSNS
Sbjct: 773  RDE-NISSADNSDGTLMQNIIPE-----KLKTISMTKMAGNGSKGSTPRSNYTGVSRSNS 826

Query: 646  ANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLF---TIGNGSATPIQEDLPSQDLPS 702
             +   S    K+ +++L   ++P  +EYS EIP +F   T  N S  P+Q   P +  P 
Sbjct: 827  LSASSSSSVWKSVNVNLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYH-PERKRPG 885

Query: 703  FTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPN 762
              H VVDC+Q++LF  L   G +D ETAE +FL +YP+P+LPIYLNS Y+ +I+ + N  
Sbjct: 886  LLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQP 945

Query: 763  SESG---DKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYK 819
            S SG     +   +NHIIPHVNL HLLTSSIR+E+ISVACTTRYEGKF+TQ++Y PC+Y+
Sbjct: 946  SGSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYE 1005

Query: 820  TQKAHGN 826
              K+  N
Sbjct: 1006 NLKSGEN 1012

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 73/202 (36%), Gaps = 50/202 (24%)

Query: 122 RHDASAPEEQVKSPTFLSPGPSMATVKQTK---NYPDDLSTVNNTIVDETIGDERKD--- 175
           R+D      Q +    LSPGPS  TV+Q+K   NY +D     N I         ++   
Sbjct: 123 RNDNDPINNQQQPLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRNTSP 182

Query: 176 --------------HPHHERHRSSIIALKKTLLENXXXXX----XXXXXXXXXXXXXXXX 217
                         H +   HR S++ALKK+L E                          
Sbjct: 183 NIPSNTNNIINMNSHNYASSHRPSVVALKKSLEETLDFTTNDPRQIYSSRSSQSSFSTMS 242

Query: 218 XXKAGSIDIPIKQTYSKKPSVHAYQYQYLDPD---PTLSDDSQLDKESKSDNIDAEAGVL 274
             ++ SIDIP + + S+  S      QY D D   P   +D                  L
Sbjct: 243 NTRSASIDIPTRNSASRVGS------QYFDADFNVPRFEND-----------------FL 279

Query: 275 QSEDMVLNQSLLQNALKKDIQR 296
             ++  LNQ L+QN L ++ ++
Sbjct: 280 HPDEPALNQKLIQNMLTQERRK 301

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  268 bits (686), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 192/324 (59%), Gaps = 27/324 (8%)

Query: 519 RIRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPG 578
           +I M+Y    + W   +L LP GIY+L F ING + HSN+LPTATDS    VNWFEV+PG
Sbjct: 399 KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458

Query: 579 YHTIEPFRDEADTES--------QVGSTIDVEAP----IRPEPXXXXXXXXXXXXXXAKG 626
           Y  IEP+RD A   S        +    +  E P    IRP                A+ 
Sbjct: 459 YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPP----LINRGTSSSSRARV 514

Query: 627 VERPSTPFSDYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNG 686
           +ER +TP SDY G+   NS +    +     +S D+    K   L YS+++P LF +GN 
Sbjct: 515 IERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNA 574

Query: 687 SATPIQEDL-------PS---QDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLS 736
           S    Q+         PS   QD P+F   V DCNQD+LF  LQ+  N++A+ AE VFL 
Sbjct: 575 STGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLE 634

Query: 737 RYPIPDLPIYLNSSYLNKILNQGNPNSESGD-KDEGAINHIIPHVNLNHLLTSSIRDEII 795
           +Y +PDLPIYLNS+ LN+I N+   NS  GD     ++ HIIPHVNLNHLLTS+IRDEII
Sbjct: 635 KYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEII 694

Query: 796 SVACTTRYEGKFITQVIYAPCYYK 819
           SV CTTRYEGKFITQ++YAPCYY+
Sbjct: 695 SVGCTTRYEGKFITQIMYAPCYYE 718

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 65/178 (36%), Gaps = 48/178 (26%)

Query: 23  HEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAIPPRMQLLASQPXXXXXXXXXXX 82
           H    + RQ SITSQLF  R     +  S  N    A                       
Sbjct: 43  HGTKERVRQQSITSQLFPGRHQARSKWKSQRNVAPGA----------------------- 79

Query: 83  XNNDVSAASEPSPLFKKDYSVA----KAADDNETTLANLSLYDRHDASAPEEQVKSPTFL 138
               VS       LFK+DYS++        +       + L    + +  +   ++   +
Sbjct: 80  ----VSGVGGVDHLFKRDYSLSDDSSAVGMEGVQEEGGVDLIGMPNVAGLKLDSRAQAIM 135

Query: 139 SPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLEN 196
           SPGPS ATV+ +K             ++ +I  E       + HR SI+ALK+ L++ 
Sbjct: 136 SPGPSSATVEHSK-------------LEASISPELA----AQVHRPSIVALKQNLIQG 176

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  253 bits (647), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 154/373 (41%), Positives = 206/373 (55%), Gaps = 48/373 (12%)

Query: 469 VILKWKNNSNMP-ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527
           VILKW++    P   T  +I SHDI STL+      +  +      +     + + YDA 
Sbjct: 217 VILKWRDPQLQPYQGTGAAIKSHDIYSTLRA-----IKSELITPERENKEDLLYLDYDAK 271

Query: 528 HKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD 587
            K+WFVP+L+LPPGIYRL+F ING+L HSNFLPTATD+ G  VNWFEVLPGY TIEP+RD
Sbjct: 272 KKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD 331

Query: 588 EADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYR-------GL 640
               ES +G     +  I  +P                         S+ R        L
Sbjct: 332 ----ESMIGQD---DESIDSQPYKSTTDVTDYAGISRSSSVVSKHSKSNLRLPNLHITSL 384

Query: 641 SRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFT---IGNGSATPIQEDLPS 697
           ++ +SA++ ++    + + + L+ + K    EYS EIP LF    +       I+E    
Sbjct: 385 NKESSASVNEANETNEGNDIQLLPEPK---YEYSTEIPELFQFDDVNTRKTNDIKEVRKE 441

Query: 698 QDLPS--------FT-HKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLN 748
             L +        FT  +VV+ NQD LFA++Q+ G +  E AE  FL+++ + DLPIYLN
Sbjct: 442 SKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLN 501

Query: 749 SSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 808
           S+YLNK  +             G +NHIIPHVNL HLLT+SI+++II V CTTRY GKFI
Sbjct: 502 STYLNKNFS-------------GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFI 548

Query: 809 TQVIYAPCYYKTQ 821
           TQVIYAPC Y  Q
Sbjct: 549 TQVIYAPCSYDKQ 561

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 14/123 (11%)

Query: 264 SDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRVNSSNSTYTIDSATHXXXXXXXXX 323
           ++ +D ++G++Q++D VLNQ++LQ+A+KKD++R  + N SN++ T  +  H         
Sbjct: 59  TEALDPDSGIVQNQDRVLNQAILQHAIKKDMKR--KRNDSNASGTAAAVLHNHRQQQQQE 116

Query: 324 XXXXXXXXXXXXIGYKENSSDSNDDSGAPISATAKMMMKLYGDKTLMERDLNKHQNKSLK 383
                        G           +   +SATA +M+KLYGDK  +  ++  H+ + + 
Sbjct: 117 ENVEGPTLVGAQTGA----------ASGEMSATAAIMLKLYGDKNQLAHEV--HEAREVH 164

Query: 384 KVQ 386
           +V+
Sbjct: 165 EVK 167

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  230 bits (587), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 195/346 (56%), Gaps = 43/346 (12%)

Query: 470 ILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHK 529
           ILKW+    +   + V+I+S DI STL    + +     +    K+   +I ++YD V  
Sbjct: 157 ILKWR--EPIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212

Query: 530 EWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEA 589
           EW++P LFLPPGIY+LQF ING L HSN+LPTAT++ G  VNWFEV+ GY TIEP+RDE 
Sbjct: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE- 271

Query: 590 DTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLR 649
                       E  I  E                      S   +DY G+SRS+S    
Sbjct: 272 ------------ERIIHREKSTANESIS-------------SNSLTDYAGISRSSSIVSN 306

Query: 650 DSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVD 709
            S +   +  L  +     EI +Y+NEIP +F   + + + +     +Q       KV+D
Sbjct: 307 KSSLISSSLKLTNLNLNDDEI-KYTNEIPEIFKFDSTANSNVN----NQAFDMSLSKVID 361

Query: 710 CNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKD 769
            NQD +FA+LQ+   ++ + AE  FL+R+ I DLPIYLNS++LNKI  +        D +
Sbjct: 362 LNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIFIR--------DNN 413

Query: 770 EGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 815
               N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 414 NETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  230 bits (586), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 203/370 (54%), Gaps = 38/370 (10%)

Query: 469 VILKWKNNSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVH 528
           V LKW++  +      +SI+S++I S +             LDSE       RM+Y    
Sbjct: 396 VFLKWRDLIDDIENANISIVSNEILSVICMN---------DLDSENS--DSARMVYYPDT 444

Query: 529 KEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDE 588
            EW    LFLPPGIY+LQF++NG L HS++LPTATD+ G  VNWFEV  GY +IEPFRD 
Sbjct: 445 SEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDN 504

Query: 589 ADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKG-VERPSTPFSDYRGLSRSNSAN 647
              ++++   I     ++P P                    RP+TP+SD+ G++RS+   
Sbjct: 505 DYVKNEISGGI-----LQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFAGINRSSPLP 559

Query: 648 LRDSFVRLKASSLDL-MAQIKPE-ILEYSNEIPSLF--------TIGNGSATPIQEDLPS 697
           LR+    +K+++ DL  +   PE   +Y+ EIP ++        T      T   ED+  
Sbjct: 560 LREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATETTTDDEDITK 619

Query: 698 QDL------PSFTHKVVDCNQDDLFATLQQ--GGNIDAETAEIVFLSRYPIPDLPIYLNS 749
             L       S  + V+ C+Q DLF  L +  G  ++ +  E +FL++YPI DLPIYLN+
Sbjct: 620 PPLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNT 679

Query: 750 SYLNKILNQGNPNSESGD---KDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGK 806
            Y+NK L Q        D   ++   +NHI+PHVN+ HLLT +I+D +I+VACT RY GK
Sbjct: 680 DYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAVACTVRYGGK 739

Query: 807 FITQVIYAPC 816
           FITQV+Y+PC
Sbjct: 740 FITQVVYSPC 749

 Score = 40.0 bits (92), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 79/191 (41%), Gaps = 56/191 (29%)

Query: 24  EAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAIPPRMQLLASQPXXXXXXXXXXXX 83
           +A  K RQGSI S+LF        R++S+ N   + +  R  L                 
Sbjct: 32  DALFKQRQGSIRSELFT------SRNNSNRNKIYSELAARNNLTT-----------INSS 74

Query: 84  NNDVSAASEPSPLFKKDYSVAK-------AADDNETTLANLSLYDRHDASAPEEQVKSPT 136
           N +V  +     LFKKDYS+ +         +  + T  + + Y     S+  +   +P+
Sbjct: 75  NTNVKES-----LFKKDYSMGRHPNTVNHVKNRVDFTRNSSNEYSSSSLSSNTDSAYTPS 129

Query: 137 FLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPH------------HERHRS 184
           F S GPS ATV+Q+               ++ I  + + HPH            HE HR 
Sbjct: 130 FFSLGPSTATVEQS--------------TEKVIRLDEQHHPHQNLASKKDIVINHE-HRP 174

Query: 185 SIIALKKTLLE 195
           SI+ALK+ L E
Sbjct: 175 SILALKQNLYE 185

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  191 bits (486), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 131/375 (34%), Positives = 191/375 (50%), Gaps = 55/375 (14%)

Query: 469 VILKWKNNSNMPATTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527
           V+L+W+++     T + VSIIS DI ++++ Q           +S   L     M YD  
Sbjct: 312 VVLRWRDSYIQNETCKSVSIISEDILTSVQAQ-----------NSGVLLISNFSMTYDKN 360

Query: 528 HKEWFVPELFLPPGIYRLQFSING-ILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFR 586
              W +P+LFLPPG YRL+F I+     +SN+LP   D  G  +N  E+LPGY ++EPF 
Sbjct: 361 ENNWVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFE 420

Query: 587 DEADT---ESQVGSTIDV--------EAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFS 635
                   E+ + S + +        E P  PE                   E  +  +S
Sbjct: 421 HNNHIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISED---ELDNDQYS 477

Query: 636 DYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILE--YSNEIPSLFTIGNGSATPIQE 693
              G  R+NS       +    +SL     IKP I E  Y+NEIP LF I + +   + E
Sbjct: 478 KVYG-KRNNS-------IGQSKTSL----SIKPCISEVTYTNEIPQLFKITDNNCI-VNE 524

Query: 694 DL--------PSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPI 745
           +         PS   P   ++V+DCNQD LFAT QQ G +D E AE +FL +YP+PDLP+
Sbjct: 525 NYERYGFVEPPSYGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPV 584

Query: 746 YLNSSYLNKILNQGNPNSESGDKDEGAI-----NHIIPHVNLNHLLTSSIRDEIISVACT 800
           +L+S +  K+ +  + +    D +   I        IPHVNLNH+LT+ I + +ISVACT
Sbjct: 585 FLDSHFSEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACT 644

Query: 801 TRYEGKFITQVIYAP 815
           TRY+ KF+T ++Y+P
Sbjct: 645 TRYKRKFVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 92/162 (56%), Gaps = 18/162 (11%)

Query: 672 EYSNEIPSLFTIGNGSATPIQEDL-------PSQDLPSFTHKVVDCNQDDLFATLQQGGN 724
           +Y+N+IP LF     +   +  +        PS   PSF + +VDC+Q+ LF +LQQ G 
Sbjct: 481 KYTNQIPELFKFSEKNIRELSTETEITFLEPPSYGEPSFYNNIVDCSQEKLFLSLQQNGA 540

Query: 725 IDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKD---EGAI----NHII 777
           +D+  AE V L RYP+ +LPI+  +  + K+ +  N  ++S       EG      ++I 
Sbjct: 541 VDSYVAEQVILQRYPVSELPIFFENISMEKLASHNNNLNKSHTNKHWLEGLTPNESDNIT 600

Query: 778 ----PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 815
               PHV LNHL+T  I   ++SVA TTRY+ K+ITQ++Y+P
Sbjct: 601 PKEPPHVILNHLVTQKISRNVVSVAVTTRYKQKYITQILYSP 642

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 57/120 (47%), Gaps = 13/120 (10%)

Query: 469 VILKWKNNSNMPATTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527
           V L+W ++   P   + VSIIS DI   +      N       D  K    R+ + YD++
Sbjct: 314 VTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNN-------DKIK----RLPLKYDSL 362

Query: 528 HKEWFVPELFLPPGIYRLQFSINGI-LTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFR 586
             EW + +LFLP G Y   F IN   + HS  + T  D  GK VN+FEV     T EP +
Sbjct: 363 THEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQ 422

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 124/305 (40%), Gaps = 76/305 (24%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEAD- 590
           F  +L LPPG +R +F ++  L  S+FLPTATD  G FVN+ E++P   +++    E D 
Sbjct: 237 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVPP-ESMQMMNYELDA 295

Query: 591 -------------------TESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPS 631
                              ++SQ      +++ +R +P              A  +E   
Sbjct: 296 QQQTQQKQNMQNQQLSDNVSQSQKIRDQTIQSQVRRQPSQSKDGKLSARSQLALHIEE-- 353

Query: 632 TPFSDYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPI 691
                       +  ++ + + R K        Q+K +  EY+ +IP++FT         
Sbjct: 354 ------------DPDDMGNGYTRFKEEQ-----QLKTD-YEYTQDIPAVFTD-------- 387

Query: 692 QEDLPSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSY 751
                    PS   +         + TL      D +      +S    P LP  L    
Sbjct: 388 ---------PSVMEQ--------YYLTL------DQQQNNQQNMSWLTPPQLPPQLE--- 421

Query: 752 LNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 811
            N ILN  N N+E G ++      I  HV LNHL TSSI+   + VA   RY+ K+ TQ+
Sbjct: 422 -NVILNNYNKNAEPGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYATQI 480

Query: 812 IYAPC 816
           +YAP 
Sbjct: 481 LYAPL 485

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 118/283 (41%), Gaps = 67/283 (23%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL-PGYHTIEPFRDEADTES 593
           +L LPPG +R +F ++  L  S++LPTATD  G FVN+ EV  P   + EP +  +D +S
Sbjct: 206 KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKS 265

Query: 594 QVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFV 653
                                         ++  +RP +  S           ++ D + 
Sbjct: 266 N-------------------------HADDSQSAKRPMSARSRIALEIEKEPDDMGDGYT 300

Query: 654 RLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQD 713
           R         A  KP+ LEY+ +IP++FT  N                           +
Sbjct: 301 RFHDE-----APPKPD-LEYTQDIPAVFTDPNV-------------------------ME 329

Query: 714 DLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAI 773
             + TL Q  N     A +        P LP +L +  LN   N  N  +++ +   GA+
Sbjct: 330 QYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILN---NYSNAQTDNNENTSGAL 380

Query: 774 NHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
             I  HV LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 381 -PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 122/295 (41%), Gaps = 66/295 (22%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADT 591
           F  +L LPPG +R +F ++  L  S+FLPTATD  G FVN+ E++       P   E   
Sbjct: 213 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV-----ASPPSQEQQP 267

Query: 592 ESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLS-RSNSA---- 646
            S +    D E PI                      +  S    + RG+S RS  A    
Sbjct: 268 ASDLQYVSD-EGPISKHVENIREGRS----------DAASAAVDEERGMSSRSKLALQIE 316

Query: 647 ----NLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPS 702
               ++ D + R +  S ++       + E++ +IP++FT                  PS
Sbjct: 317 DDPDDMGDGYTRFREESKEI------PVYEFTQDIPAVFTD-----------------PS 353

Query: 703 FTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPN 762
              +         + TL Q  N     A +        P LP +L     + ILN  N +
Sbjct: 354 VMGQ--------YYLTLDQQKNNQQNLAWLT------PPQLPPHLE----HVILNHYNKS 395

Query: 763 SESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCY 817
           ++   ++      I  HV LNHL TSSI+   + VA   RY+ K+ TQ++YAP +
Sbjct: 396 ADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPLH 450

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 117/288 (40%), Gaps = 64/288 (22%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEP-----FRDEA 589
           +L LPPG +R +F ++  L  S+FLPTATD  G FVN+ EV+    T++        ++ 
Sbjct: 201 KLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVAPPTTVDENIGGNLPNQT 260

Query: 590 DTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLR 649
              S     +    PI  +                   ++P +  S           +L 
Sbjct: 261 ADSSNYQQDMGAGKPIYKQ-------------DNQAQTKQPMSARSRIAFEIEKEPDDLG 307

Query: 650 DSFVRLKASSLDLMAQIKP--EILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKV 707
           D F R            KP  + +EY+ +IP++FT                  P+   + 
Sbjct: 308 DGFTRFHEE--------KPLKQDVEYTQDIPAVFTD-----------------PTVMEQ- 341

Query: 708 VDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGD 767
                   + TL Q  N     A +        P LP +L +  LN     G+ N  +  
Sbjct: 342 -------YYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSYSGSGSDNENTS- 387

Query: 768 KDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 815
              GA+  I  HV LNHL TSSI+   + VA   RY+ K++TQ++YAP
Sbjct: 388 ---GAL-PIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYVTQILYAP 431

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 111/282 (39%), Gaps = 70/282 (24%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV-LPGYHTIEPFRDEADTES 593
           +L LPPG +R +F ++  L  S++LPTATD  G FVN+ EV  P   T EP +   D ++
Sbjct: 204 KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDWTNEPQQQVTDNKA 263

Query: 594 QVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFV 653
                                          +  +RP +  S           ++ D + 
Sbjct: 264 -------------------------YHADDNQSTKRPMSARSRIALEIEKEPDDMGDGYT 298

Query: 654 RLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQD 713
           R    +       KP  LEY+ +IP++FT  N                           +
Sbjct: 299 RFHDETPS-----KPN-LEYTQDIPAVFTDPNV-------------------------ME 327

Query: 714 DLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAI 773
             + TL Q  N     A +        P LP +L +  LN   N         D   GA+
Sbjct: 328 QYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSYSN------AQTDNTSGAL 375

Query: 774 NHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 815
             I  HV LNHL TSSI+   + VA   RY+ K++TQ++Y P
Sbjct: 376 -PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTP 416

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 113/286 (39%), Gaps = 76/286 (26%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL-PGYHTIEPFRDEADTES 593
           +L LPPG +R +F ++  L  S++LPTATD  G FVN+ EV  P   + EP +  +D ++
Sbjct: 203 KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSSEPQQQGSDNKA 262

Query: 594 QVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFV 653
                                          K  +RP +  S           ++ D + 
Sbjct: 263 NYAD-------------------------DDKLNKRPMSARSRIALEIEKEPDDMGDGYT 297

Query: 654 RLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQD 713
           R    +       KP  LEY+ +IP++FT  N                           +
Sbjct: 298 RFHDET-----PAKPN-LEYTQDIPAVFTDPNV-------------------------ME 326

Query: 714 DLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAI 773
             + TL Q  N     A +        P LP +L +  LN   N         D   GA+
Sbjct: 327 QYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSYSN------AQTDNTSGAL 374

Query: 774 ---NHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
              NH+I    LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 375 PIPNHVI----LNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 109/285 (38%), Gaps = 74/285 (25%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQ 594
           +L LPPG +R +F ++  L  S++LPTATD  G FVN+ EV                   
Sbjct: 203 KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV------------------- 243

Query: 595 VGSTIDVEAP--IRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSF 652
                   AP     EP              +K  +RP +  S           ++ D +
Sbjct: 244 -------SAPPDWGNEPQQHLAEKKANHVDDSKLSKRPMSARSRIALEIEKEPDDMGDGY 296

Query: 653 VRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQ 712
            R    +       KP  LEY+ +IP++FT  N                           
Sbjct: 297 TRFHDET-----PAKPN-LEYTQDIPAVFTDPNV-------------------------M 325

Query: 713 DDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGA 772
           +  + TL Q  N     A +        P LP +L +  LN   N         D   GA
Sbjct: 326 EQYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSYSN------AQTDNTSGA 373

Query: 773 INHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           +   IP HV LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 374 L--PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 56/290 (19%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQ 594
           +L LPPG ++ +F ++  L  S+FLPTATD  G FVN+ E +P  H      D +  ++ 
Sbjct: 182 KLQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVPRTHP-----DASLQQTH 236

Query: 595 VGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSA-------- 646
           V +  D +  +R +                      S     Y   +RS  A        
Sbjct: 237 VAN--DQDGKLRQDQQQQQLSQQQAQKPAQPQGVTESNKSKKYPRSARSQIAFEIEQEPD 294

Query: 647 NLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHK 706
           +L D F R +        Q    +LEY+ +IP++FT      T +++             
Sbjct: 295 DLGDGFTRFREE------QPLKAVLEYTQDIPAVFT----DPTVMEQ------------- 331

Query: 707 VVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESG 766
                    + TL Q  N     A +        P LP +L     N ILN  + +S   
Sbjct: 332 --------YYLTLDQQQNNHQNLAWLT------PPQLPPHLE----NVILNNYSSSSSDN 373

Query: 767 DKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
            ++      I  HV L+HL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 374 SQNTSGSLPIPNHVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 117/284 (41%), Gaps = 92/284 (32%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQ 594
           +L LP G +R +F ++  L  S++LPTATD  G FVN+         +E  R + DT S 
Sbjct: 154 KLQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNY---------LEIGRGQKDTLS- 203

Query: 595 VGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSANLRDSFVR 654
             S I +E    P+                                      ++ + F R
Sbjct: 204 ARSRIAMEIENEPD--------------------------------------DIGNGFTR 225

Query: 655 LKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDD 714
            K         +KP++ EY+ +IP++FT                  PS          + 
Sbjct: 226 FKEE-----IPLKPQV-EYTQDIPAVFTD-----------------PSV--------MEQ 254

Query: 715 LFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILN-QGNPNSESGDKDEGAI 773
            + TL Q  +     A +        P LP +L    LN     QG+ N+E+   + GA+
Sbjct: 255 YYLTLDQQQHNHQNMAWLT------PPTLPPHLEDVPLNSYNGIQGDSNNEN---NSGAL 305

Query: 774 NHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
              IP HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 306 P--IPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 123/298 (41%), Gaps = 82/298 (27%)

Query: 528 HKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD 587
           H +    +L LP G +R +F ++  L  S++LPTATD                       
Sbjct: 179 HPDLLHVKLQLPVGTHRFRFIVDNELRFSDYLPTATD----------------------- 215

Query: 588 EADTESQVGSTIDVEAPIRPEPXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSNSAN 647
                 Q+G+ ++    I P                    E+P T     +   R N  N
Sbjct: 216 ------QMGNFVNYLEVIAP-----------------PSQEKPQT-----KDKQRDNE-N 246

Query: 648 LRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDL---PS----QDL 700
             D   R     +   ++I  EI +  +EI      GNG  T  +E+L   PS    QD+
Sbjct: 247 KNDVARRKTTDPVSARSRIALEIEKEPDEI------GNG-FTRFREELTLGPSLEYTQDI 299

Query: 701 PS-FTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQG 759
           P+ FT   V    +  + TL Q  N     A +        P LP +L +  LN   N  
Sbjct: 300 PAVFTDPTV---MEQYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVPLNSYTNSQ 350

Query: 760 NPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           N   +S + + GA+   IP HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 351 N---DSNENNSGAL--PIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 403

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 81/165 (49%), Gaps = 16/165 (9%)

Query: 654 RLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLP-SQDLPS-FTHKVVDCN 711
           +L+   +   ++I  EI    ++I + FT   G  TP+ +++  +QD+P+ FT   V   
Sbjct: 281 KLRDKPISARSRIALEIEREPDDIGNGFTRFRGE-TPLLKNIEYTQDIPAVFTDPTV--- 336

Query: 712 QDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEG 771
            +  + TL Q  N     A +        P LP +L +  LN   N    N+E+      
Sbjct: 337 MEQYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSYSNSQGTNNENNSGALP 390

Query: 772 AINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
             NH+I    LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 391 IPNHVI----LNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 431

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           +L LPPG +R +F ++  L  S++LPTATD  G FVN+ E+
Sbjct: 206 KLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P LP +L +  LN   N  +P     + + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 341 PQLPPHLENVILNNYSNSSDPGGSGSENNSGALP--IPNHVVLNHLATSSIKHNTLCVAS 398

Query: 800 TTRYEGKFITQVIYAPC 816
             RY+ K+ TQ++Y+P 
Sbjct: 399 IVRYKRKYATQILYSPL 415

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 79/172 (45%), Gaps = 45/172 (26%)

Query: 647 NLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHK 706
           ++ D F R +         +KP+ LEY+ +IP++FT                  P+   +
Sbjct: 306 DMGDGFTRFREEK-----PLKPQ-LEYTQDIPAVFTD-----------------PTVMEQ 342

Query: 707 VVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNS-ES 765
                    + TL Q  N          LS    P LP +L     N ILN  + NS E+
Sbjct: 343 --------YYLTLDQQQNNHQN------LSWLTPPQLPPHLE----NVILNSYSSNSPET 384

Query: 766 GDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           G  + G++   IP HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 385 GQNNSGSLP--IPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 29/42 (69%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL 576
           +L LPPG ++ +F ++  L  S+FLPTATD  G FVN+ E +
Sbjct: 177 KLQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P LP +L +  LN   +Q  P     + + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 354 PQLPPHLENVILNNYSSQSEPGDSGSENNSGALP--IPNHVVLNHLATSSIKHSTLCVAS 411

Query: 800 TTRYEGKFITQVIYAPC 816
             RY+ K+ TQ++Y+P 
Sbjct: 412 IVRYKRKYATQILYSPL 428

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL 576
           +L LPPG +R +F ++  L  S+FLPTATD  G FVN+ E++
Sbjct: 167 KLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 208

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 800
           P LP +L +  LN      N   ES + + GA+  I  HV LNHL TSSI+   + VA  
Sbjct: 343 PQLPPHLENVILNSY---SNAQGESNENNSGAL-PIPNHVILNHLATSSIKHNTLCVASI 398

Query: 801 TRYEGKFITQVIYAPC 816
            RY+ K++TQ++YAP 
Sbjct: 399 VRYKRKYVTQILYAPL 414

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 32/49 (65%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIE 583
           +L LPPG +R +F ++  L  S+FLPTATD  G FVN+ E+ P   T E
Sbjct: 201 KLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTDE 249

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P+LP  L    LN      N N    D D G      P +V LNHLLTSSI++ ++ + C
Sbjct: 321 PELPSQLERCILN------NKNE---DTDNGPCELTTPNYVTLNHLLTSSIKNNMLCLGC 371

Query: 800 TTRYEGKFITQVIYAP 815
           + RY  K++TQV Y P
Sbjct: 372 SVRYRQKYVTQVYYTP 387

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%)

Query: 536 LFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD 587
           L LP G ++ +F ++  L  S+FLPTATD  G FVN+ EV P   T+E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 489 SHDIASTLKEQLEVNLDEDAS----LDSEKQLNPRIRMIYDAVHKEWFVPELFLPPGIYR 544
           S +I S+L   +E+   +  S      S  +    I +I D+ H   F  +L L PG +R
Sbjct: 155 STEIKSSLMVPVEIKWQQGGSKVYVTGSFTKWRKMIGLIPDSKHSGAFHVKLRLLPGTHR 214

Query: 545 LQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTIDVEAP 604
            +F ++  L  S+FLPTATD  G FVN+ EV       EP +   D + +      ++AP
Sbjct: 215 FRFVVDNELRVSDFLPTATDQMGNFVNYIEVR------EPEKKATDGKRKSKKEYSIQAP 268

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 11/72 (15%)

Query: 745 IYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRY 803
           + LN  Y+ +  +Q N N      + GA+   IP HV LNHL+TSSI+   + VA   RY
Sbjct: 350 VILNKYYMTQ--DQFNEN------NSGALP--IPNHVVLNHLITSSIKHNTLCVASIVRY 399

Query: 804 EGKFITQVIYAP 815
           + K++TQ++YAP
Sbjct: 400 KQKYVTQILYAP 411

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 60/122 (49%), Gaps = 16/122 (13%)

Query: 697 SQDLPS-FTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKI 755
           +QD+P+ FT   V    +  + TL Q  N     A +        P LP +L +  LN  
Sbjct: 301 TQDIPAVFTDPTV---MEQYYLTLDQQQNNHQNMAWLT------PPQLPPHLENVILNSY 351

Query: 756 LNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYA 814
               N   ES +   GA+   IP HV LNHL TSSI+   + VA   RY  K++TQ++YA
Sbjct: 352 ---SNSQGESNENTSGALP--IPNHVILNHLATSSIKHNTLCVASIVRYRQKYVTQILYA 406

Query: 815 PC 816
           P 
Sbjct: 407 PL 408

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 31/45 (68%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL 576
           F  +L LPPG +R +F ++  L  S++LPTATD  G FVN+ EV+
Sbjct: 174 FYVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 218

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 42/82 (51%)

Query: 735 LSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEI 794
           LS    P LP +L +  LN          ESG ++      I  HV LNHL TSSI+   
Sbjct: 421 LSWLTPPQLPPHLENVILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNT 480

Query: 795 ISVACTTRYEGKFITQVIYAPC 816
           + VA   RY+ K+ TQ++YAP 
Sbjct: 481 LCVASIVRYKSKYATQILYAPL 502

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 32/46 (69%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLP 577
           F  +L LPPG +R +F ++  L  S++LPTATD  G FVN+ E++P
Sbjct: 249 FHIKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVP 294

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 469 VILKWKNNSNMPATTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAV 527
           V L+++++  +P     V+I   DI S L+            +   +Q    I + ++  
Sbjct: 72  VKLRFRDSHTIPFRVHSVAIQGTDITSKLQRT--------GKMGGLQQ----IPLQFEGD 119

Query: 528 HKEWFVPELFLPPGIYRLQFSINGILT-HSNFLPTATDSEGKFVNWFEVLPGYHTIEP 584
             EW  P+L+LPPG Y+ +F IN   + HS +LP  T  +G   N+F V+     +EP
Sbjct: 120 SSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP 177

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 57/148 (38%), Gaps = 23/148 (15%)

Query: 671 LEYSNEIPSLFTIGNGSATPIQEDLPSQDLPSFTHKVVDCNQDDLFATLQQGGNIDAETA 730
           +EY+NEI  LF    G     Q D  +Q  P  TH     NQ   F    Q  +  +   
Sbjct: 195 VEYTNEILPLF---EGYCDSQQIDHTAQYKPK-THM----NQKTFFYYAFQEQDAASGDY 246

Query: 731 EIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSS- 789
           +  F  RY +P +P Y    Y   I  Q N            +   I   NLN  +  S 
Sbjct: 247 DAQFCERYTVPIIPPYF---YSIDITPQDN---------TLKVPLPIQLANLNRTIFPSP 294

Query: 790 --IRDEIISVACTTRYEGKFITQVIYAP 815
             I ++ + + C   Y GK++  + Y P
Sbjct: 295 EDICNDYLCIGCVISYRGKYMAHLFYRP 322

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P LP  L +  LNK    G P S+S + + GA+   IP H  LNHL+T+SI+   + VA 
Sbjct: 361 PQLPPQLENVILNKF---GEPLSQSTENNAGALP--IPNHSVLNHLVTTSIKHNTLCVAT 415

Query: 800 TTRYEGKFITQVIYAP 815
             RY  K+++Q+ Y P
Sbjct: 416 NNRYRQKYVSQIYYVP 431

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           F  +L L PG +R +F ++  L  S+ LPTATD  G FVN+ EV
Sbjct: 209 FKIKLQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 755 ILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIY 813
           ILN  N    + D + G +   IP HV LNHL+ +S++  +++++ TTRY+ KFITQV Y
Sbjct: 287 ILNDQNSLQHTDDSNAGFLP--IPNHVVLNHLIVNSVKSNMLAISTTTRYKEKFITQVCY 344

Query: 814 APC 816
           +P 
Sbjct: 345 SPI 347

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%)

Query: 520 IRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGY 579
           I ++    + +W    L LPPG +R +F ++  L  S+ +P+ATDS G  VN+ EV P  
Sbjct: 132 IALVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKPSK 191

Query: 580 HTIE 583
              E
Sbjct: 192 RQYE 195

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 46/78 (58%), Gaps = 8/78 (10%)

Query: 741 PDLPIYLNSSYLNKILN-QGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVA 798
           P LP +L +  LN   + QG    ES + + GA+   IP HV LNHL TSSI+   + VA
Sbjct: 351 PQLPPHLENVILNSYSSLQG----ESNENNSGALP--IPNHVILNHLATSSIKHNTLCVA 404

Query: 799 CTTRYEGKFITQVIYAPC 816
              RY+ K+ TQ++YAP 
Sbjct: 405 SIVRYKQKYATQILYAPL 422

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL 576
           +L LPPG ++ +F ++  L  S++LPTATD  G FVN+ EV+
Sbjct: 191 KLQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 7/76 (9%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 800
           P LP +L +  LN   +  N N+       GA+  I  HV LNHL+T+SI+   + VA  
Sbjct: 431 PQLPPHLENIILNSSQDTSNENTS------GAL-PIPNHVVLNHLVTTSIKHNTLCVASI 483

Query: 801 TRYEGKFITQVIYAPC 816
            RY+ K++TQ++YAP 
Sbjct: 484 IRYKHKYVTQILYAPL 499

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (65%)

Query: 532 FVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           F  +L LP G +R +F ++  L  S+FLPTATD  G FVN+ EV
Sbjct: 267 FHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 520 IRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           I +I  A H      +L LPPG +R +F ++  L  S++LPTATD  G FVN+ E+
Sbjct: 235 IGLIPVAGHPNLLHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 779 HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 800
           P LP  L +  LNK     +  +E+   + GA+  I  HV LNHL+TSSI+   + VA  
Sbjct: 367 PQLPPQLENVILNKYYATQDQFNEN---NSGAL-PIPNHVVLNHLVTSSIKHNTLCVASI 422

Query: 801 TRYEGKFITQVIYAPC 816
            RY+ K++TQ++Y P 
Sbjct: 423 VRYKQKYVTQILYTPI 438

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 520 IRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           I +I DA     F  +L L PG +R +F ++  L  S+FLPTATD  G FVN+ EV
Sbjct: 216 IGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 800
           P LP +L     + ILN  N +++   ++      I  HV LNHL TSSI+   + VA  
Sbjct: 403 PQLPPHLE----HVILNHYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASI 458

Query: 801 TRYEGKFITQVIYAPC 816
            RY+ K+ TQ++YAP 
Sbjct: 459 VRYKQKYATQILYAPL 474

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%)

Query: 520 IRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVL 576
           I ++ D      F  +L LPPG +R +F ++  L  S+FL TATD  G FVN+ E++
Sbjct: 220 IGLVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P LP  L +  LNK     +  +E+   + GA+   IP HV LNHL+TSSI+   + VA 
Sbjct: 341 PQLPPQLENVILNKYYATQDQFNEN---NSGALP--IPNHVVLNHLVTSSIKHNTLCVAS 395

Query: 800 TTRYEGKFITQVIYAP 815
             RY+ K++TQ++Y P
Sbjct: 396 IVRYKQKYVTQILYTP 411

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 484 EVSIISHDIASTLKEQLEVNLDEDAS----LDSEKQLNPRIRMIYDAVHKEWFVPELFLP 539
           E S    +I S+L   +E+   +  S      S  +    I +I D+ +   F  +L L 
Sbjct: 150 EASGGPSEIKSSLMVPVEIRWQQGGSKVYVTGSFTKWRKMIGLIPDSDNNGSFHVKLRLL 209

Query: 540 PGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           PG +R +F ++  L  S+FLPTATD  G FVN+ EV
Sbjct: 210 PGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 741 PDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 799
           P LP  L +  LNK     +   +  + + GA+   IP HV LNHL+TSSI+   + V+ 
Sbjct: 340 PQLPPQLENVILNKYCTTQD---QVNENNSGALP--IPNHVVLNHLITSSIKHNTLCVSS 394

Query: 800 TTRYEGKFITQVIYAPC 816
             RY+ K++TQ++Y P 
Sbjct: 395 IVRYKQKYVTQILYTPI 411

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 520 IRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           I ++ D+     F  +L L PG +R +F ++  L  S+FLPTATD  G FVN+ EV
Sbjct: 189 IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 28/41 (68%)

Query: 535 ELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEV 575
           +L LP G +R +F ++  L  S++LPTATD  G FVN+ EV
Sbjct: 279 KLQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 779 HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 816
           HV LNHL+T+SI+   + VA   RY+ K+ TQ++Y P 
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [contig
           192] PARTIAL
          Length = 377

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 127/325 (39%), Gaps = 107/325 (32%)

Query: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNR--------------KSIH 46
           MGN+PST   ++   +  S  ++++  + RQ SITSQLF +R              + +H
Sbjct: 1   MGNNPST---ANMQNRRVSQLVNDS--RGRQDSITSQLFPSRTTGRNPEEKKGWKSRVLH 55

Query: 47  KRHSSHANYDNAAIPPRMQLLASQPXXXXXXXXXXXXNNDVSAASEPSPLFKKDYSVAKA 106
            + +   +  +A  P R                    N   SA+  P+P      +   +
Sbjct: 56  GKRAGTTSPSSAPSPFRKDY------SLDSASETASYNFKKSASGNPAPPMC--IAAHAS 107

Query: 107 ADDNETT-----LANLSLYDR----HDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDL 157
           A+D+ +      LA LSL +     H A++P     +P   SPGPS   V+ TK      
Sbjct: 108 AEDSSSLLLRDHLAELSLQNSESQAHVAASP-----APLLQSPGPSSPVVQSTKQ----- 157

Query: 158 STVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXXXX 217
                    E + ++           SS+ +LKK L+E                      
Sbjct: 158 ---------EALFEQ----------LSSMTSLKKMLVEG---------------RIGDQI 183

Query: 218 XXKAGSIDIPIKQTYSKKPSVHAYQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQS- 276
                SIDIP      ++PSV A    Y+                 SD+ D E  +LQ  
Sbjct: 184 NAPPSSIDIP------RRPSV-AVSDTYM-----------------SDDGDDEESLLQGV 219

Query: 277 EDMVLNQSLLQNALKKDIQRLSRVN 301
            D+V+N S+L+NA+K+  +R SR N
Sbjct: 220 NDVVINNSMLENAMKR--KRSSRKN 242

>TBLA0D04210 Chr4 complement(1039847..1041622) [1776 bp, 591 aa]
           {ON} Anc_7.220 YER049W
          Length = 591

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 228 IKQTYSKKPSVHAYQYQYLDPDPTLSDDSQLDKESKS-----DNIDAEAGVLQSEDMVLN 282
           +K  +     +H +++ Y+D  P L DD+Q D E  +     + ID E   L++E + + 
Sbjct: 378 VKNPWKVASPIHKWKFMYIDGKPELKDDNQEDNEGSNFKLLRETIDQERLKLENELIKVV 437

Query: 283 QSLLQNALKKDIQRLSRV 300
           + L     KK I  L+++
Sbjct: 438 EFLKSKTFKKFILLLTKM 455

>Skud_15.445 Chr15 complement(785067..785924) [858 bp, 285 aa] {ON}
           YOR281C (REAL)
          Length = 285

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 758 QGNPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 808
           + +P  E+G KDEG + ++  H++L   L S I   +   A +   E KF+
Sbjct: 121 ESSPTDENGKKDEGGV-YVFVHLSLQSKLQSRILSHLFQSAASKFKEIKFV 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,741,449
Number of extensions: 3595060
Number of successful extensions: 11259
Number of sequences better than 10.0: 66
Number of HSP's gapped: 11430
Number of HSP's successfully gapped: 119
Length of query: 827
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 709
Effective length of database: 39,950,811
Effective search space: 28325124999
Effective search space used: 28325124999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)