Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5985.525ON96596548420.0
Skud_4.6955.525ON95495138460.0
YDR421W (ARO80)5.525ON95095538370.0
Smik_4.6965.525ON94995536710.0
KAFR0E033105.525ON93895422770.0
SAKL0G04884g5.525ON93096821290.0
NDAI0H015805.525ON90993320910.0
NCAS0F010705.525ON90477419730.0
Kpol_1028.825.525ON92595019460.0
ZYRO0D12518g5.525ON88179719080.0
TDEL0A038905.525ON83179718540.0
KNAG0C032505.525ON93694518040.0
KLLA0A01804g5.525ON94580118040.0
KLTH0G03718g5.525ON85793317540.0
TPHA0L003505.525ON85993116840.0
TBLA0D016705.525ON101883616660.0
CAGL0F03025g5.525ON92898515720.0
ADR199C5.525ON94499615330.0
TBLA0E034803.109ON10461011334e-07
SAKL0D00264g8.879ON848431164e-05
NDAI0K001508.879ON953431131e-04
NCAS0H034202.654ON9021731112e-04
KAFR0A03060singletonON8601071102e-04
NDAI0K018002.547ON1210551103e-04
KLTH0E16500g8.879ON833551084e-04
TPHA0B004104.344ON945891076e-04
KNAG0M00120singletonON8811001067e-04
NCAS0C002208.879ON839431068e-04
YMR019W (STB4)2.565ON9491211068e-04
KNAG0J002108.879ON861471050.001
Suva_9.592.231ON9261341030.002
Kwal_27.96888.879ON841421030.002
YML076C (WAR1)4.344ON9441921030.002
KLLA0A06039g1.199ON6571891020.002
Kpol_1001.34.344ON8561351020.002
TDEL0B004808.879ON835421010.003
TBLA0C062306.60ON795461010.003
Skud_15.643.109ON10321181010.003
KAFR0L021308.879ON882421010.003
KNAG0K008203.109ON1050651010.003
TBLA0G011308.879ON1132411000.003
TBLA0E047504.344ON1283431010.003
KNAG0E041004.344ON903901000.004
KAFR0C03660singletonON8471171000.004
Kpol_538.528.879ON90736990.004
NCAS0A125802.547ON70483990.005
TBLA0F012003.109ON108676990.005
KAFR0C013203.109ON1006107990.005
KLLA0E02663gna 1ON110955990.005
KLTH0D16852g4.344ON811139980.006
CAGL0H06875g8.879ON70239980.006
TDEL0G04890singletonON58459980.006
ZYRO0A00440g8.879ON85045980.006
NDAI0C002602.654ON104158980.006
Kwal_27.108527.389ON104658980.006
ZYRO0C18150g1.128ON57149970.008
NDAI0I021906.61ON73546970.009
Ecym_81598.879ON90859970.009
Kwal_56.24566na 2ON75566960.009
YOR172W (YRM1)6.61ON78667960.010
NDAI0G041403.109ON100192960.010
Kpol_455.108.879ON83058960.011
SAKL0E08998g2.231ON82373960.011
KLTH0D00594gna 3ON63143960.011
Smik_17.27singletonON68885950.012
KAFR0I002804.344ON936115960.012
KAFR0B028208.283ON664199950.013
NDAI0B016802.547ON92470950.013
AAL175W8.879ON88341950.015
KLLA0A02585gna 4ON37063930.016
Suva_15.773.109ON1029100950.017
Skud_13.664.344ON93992940.017
NDAI0D00900singletonON86546940.017
Kwal_56.226053.109ON865144940.018
YIL130W (ASG1)2.231ON964136940.018
KLLA0C17050gna 5ON95571940.019
Kpol_1039.112.231ON99246940.020
KAFR0F014901.128ON658120940.020
TPHA0C049808.879ON85242930.023
Kwal_56.230583.264ON77570930.023
NDAI0B038502.231ON93078930.024
YML099C (ARG81)8.879ON88053930.025
Skud_11.3001.199ON86563930.027
NDAI0F00110singletonON50836920.027
NCAS0A150207.512ON80947930.027
Kwal_55.20722singletonON82748930.027
Kpol_1042.66.60ON78046920.028
KAFR0A031807.512ON846103920.029
TDEL0D051503.109ON99643920.029
KLLA0C03201g1.128ON650131920.030
KLLA0F02750g3.109ON114872920.030
NCAS0E023107.56ON71862920.030
KLTH0D01804g7.56ON65259920.034
Smik_15.673.109ON103083920.034
KLLA0D10197g8.879ON85636920.036
Kwal_26.7095na 6ON83873910.037
TBLA0G026102.231ON1000110920.037
KLLA0D12650gsingletonON65148910.040
NCAS0H00780singletonON90944910.040
CAGL0F07909g3.109ON104975910.041
NDAI0D035504.113ON111870910.042
KAFR0B014502.547ON108869910.043
TDEL0G041006.60ON69949910.043
Kwal_34.15751na 7ON62879910.044
KLTH0D07260g2.547ON97970910.045
Suva_13.1862.565ON894134910.046
NDAI0E038507.56ON76839910.046
Suva_15.415na 8ON86759910.046
TBLA0A007302.654ON103745910.047
Skud_13.438.879ON88041910.048
NCAS0C047803.109ON91448910.049
SAKL0D14916gna 3ON632114900.050
CAGL0M02651g8.642ON46244900.050
Kpol_1061.113.264ON733114900.050
Ecym_5001singletonON60742900.050
TBLA0E03050singletonON77949900.051
KNAG0A02300singletonON72991900.051
SAKL0G17908g4.344ON80944900.054
KNAG0F028306.60ON74647900.055
SAKL0A09856g2.547ON102044900.055
KNAG0E041507.17ON113649900.058
ZYRO0B00242gsingletonON63869890.060
Smik_13.368.879ON88041900.061
KLLA0F25630g2.547ON100772900.062
KLLA0F04213g3.264ON76844890.064
TBLA0G00490singletonON91856890.064
NCAS0A061904.344ON89444890.065
Suva_13.498.879ON88236890.066
Kpol_495.213.109ON108551890.070
SAKL0G17622gna 9ON67648890.072
Kpol_1049.19na 8ON94349890.072
KAFR0A066904.113ON99744890.075
NDAI0A069903.109ON97851890.075
NCAS0A067105.322ON769120890.076
Kwal_47.175064.113ON92488890.076
Smik_15.5157.56ON75950890.078
NDAI0A034204.113ON110850890.079
Suva_7.2684.113ON1000179890.079
Kwal_26.81092.547ON97044890.080
NCAS0A03570na 10ON97887890.083
KNAG0A071002.547ON128644890.084
Kwal_47.168624.344ON74343880.085
KLTH0C10098g6.60ON77146880.086
TBLA0C040504.113ON120744890.087
YOR337W (TEA1)7.56ON75953880.089
KLTH0E14454gna 11ON90273880.090
TBLA0A04280singletonON89245880.092
SAKL0A00704gna 12ON71845880.092
KLLA0F09559gsingletonON65846880.093
KLTH0H16170gna 7ON61949880.094
TBLA0A00280singletonON76446880.10
Ecym_1146na 9ON66549880.10
NCAS0A047502.547ON114144880.10
KLTH0E05786gna 13ON81792880.10
SAKL0H00682gna 14ON92257880.11
NCAS0B082001.199ON87549870.11
TBLA0G01100singletonON63339870.11
TBLA0H03910singletonON76748870.12
YLR451W (LEU3)7.512ON886108870.12
ZYRO0G19338gna 15ON65384870.12
CAGL0L01903g2.547ON128744870.12
KNAG0F037207.512ON766338870.12
NCAS0D027206.60ON75757870.13
Suva_10.3646.60ON70762870.13
KNAG0A044808.423ON101343870.13
YKL038W (RGT1)2.547ON117044870.13
NDAI0B015402.565ON80362870.13
Ecym_83278.642ON412105860.14
NCAS0A035804.113ON111366870.14
SAKL0D02596gna 16ON75068870.14
Smik_1.137.17ON104679870.14
KAFR0J017102.231ON84868860.14
KNAG0A02290singletonON80048860.16
KLTH0C10516gna 17ON56151860.16
TPHA0A06090singletonON84747860.16
KLLA0D10153gsingletonON655121860.17
Kwal_23.6425na 12ON73545860.17
KAFR0C039002.654ON81842860.17
Suva_1.147.17ON104578860.17
KNAG0D052407.512ON86971860.17
ZYRO0B14718g4.344ON103544860.18
Skud_1.107.17ON104079860.19
TBLA0D054201.277ON75740850.19
Skud_12.3466.60ON69446850.19
Ecym_53972.231ON82645850.19
CAGL0I07755g3.109ON105344850.20
Skud_11.1902.547ON117144850.20
SAKL0D03586g3.264ON80144850.20
TDEL0G040906.61ON74363850.21
TDEL0B063602.547ON98144850.21
NCAS0B065502.231ON90645850.21
TPHA0A045403.109ON117843850.21
Skud_15.5027.56ON75941850.21
KLLA0D11286gna 18ON678113850.21
KLTH0D16456gna 9ON66160850.22
TDEL0D007304.344ON80642850.22
YAL051W (OAF1)7.17ON104779850.22
AFR171Wna 15ON61296850.22
TPHA0O006001.380ON137245850.22
YKR064W (OAF3)1.199ON86360850.22
NDAI0A010401.199ON99537850.23
TDEL0H007901.199ON82789850.23
Skud_7.2744.113ON108053850.23
KLTH0C07480g3.264ON77554850.23
NCAS0D041906.279ON89039850.23
ABL099W3.264ON80053850.24
Smik_11.2102.547ON116944850.24
Smik_4.2693.264ON778105850.24
Suva_11.1872.547ON117144850.24
SAKL0G02992gna 1ON106151850.24
Ecym_6141na 19ON11453780.25
TDEL0C044802.231ON85245840.25
TBLA0I025408.423ON125943850.26
TPHA0E038301.26ON82251840.26
Kpol_1002.52.547ON95857840.26
Suva_8.3877.56ON75950840.26
TBLA0G01090singletonON82296840.26
KAFR0B07080singletonON67539840.26
KAFR0B00100singletonON67539840.26
Kwal_23.47542.231ON81245840.27
KAFR0G025406.60ON85546840.27
Smik_9.392.231ON101244840.28
KNAG0D034504.121ON688118840.28
TPHA0F013802.231ON89047840.29
KLTH0G09108g2.231ON78245840.29
CAGL0L03377g1.277ON120944840.30
CAGL0C01199g8.423ON92260840.30
KLTH0H01672gna 2ON70145840.30
KLLA0F04609g2.231ON91645840.30
KLLA0B04620g4.344ON91944840.30
Smik_13.644.344ON94444840.31
KLTH0C10032g3.109ON86658840.31
KLLA0C16489gna 2ON72841830.32
Skud_9.372.231ON95444840.32
Kpol_2001.161.199ON80278830.32
NDAI0D031804.344ON98961840.33
SAKL0H25146gna 15ON64546830.33
ACR241C1.199ON79558830.33
CAGL0M12298g7.17ON99468830.34
KLLA0D00484g6.0ON100462830.34
ZYRO0E05676g2.547ON106660830.34
ZYRO0D14058g6.60ON75848830.35
Skud_13.1732.565ON920138830.35
ZYRO0D14080g6.61ON92164830.35
Skud_15.3346.61ON79046830.35
KNAG0G021308.283ON63246830.35
CAGL0H04367g4.344ON94543830.36
KNAG0E017602.231ON90245830.37
TPHA0F025406.60ON79346830.37
SAKL0G07634gsingletonON92239830.37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.598
         (965 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...  1869   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...  1486   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...  1482   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...  1418   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   881   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   824   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   810   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   764   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   754   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   739   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   718   0.0  
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   699   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   699   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   680   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     653   0.0  
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...   646   0.0  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   610   0.0  
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   595   0.0  
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    56   4e-07
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    49   4e-05
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    48   1e-04
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    47   2e-04
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    47   2e-04
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    47   3e-04
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    46   4e-04
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    46   6e-04
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      45   7e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       45   8e-04
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    45   8e-04
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    45   0.001
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    44   0.002
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    44   0.002
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    44   0.002
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    44   0.002
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    44   0.002
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    44   0.003
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    44   0.003
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    44   0.003
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    44   0.003
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    44   0.003
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    43   0.003
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    44   0.003
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    43   0.004
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    43   0.004
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    43   0.004
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    43   0.005
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    43   0.005
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    43   0.005
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    43   0.005
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    42   0.006
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    42   0.006
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    42   0.006
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    42   0.006
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    42   0.006
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    42   0.006
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    42   0.008
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    42   0.009
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    42   0.009
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    42   0.009
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    42   0.010
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.010
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    42   0.011
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    42   0.011
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    42   0.011
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    41   0.012
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    42   0.012
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    41   0.013
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     41   0.013
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    41   0.015
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    40   0.016
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    41   0.017
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    41   0.017
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               41   0.017
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    41   0.018
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    41   0.018
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    41   0.019
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    41   0.020
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    41   0.020
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    40   0.023
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    40   0.023
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    40   0.024
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    40   0.025
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    40   0.027
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.027
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    40   0.027
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    40   0.027
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    40   0.028
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    40   0.029
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    40   0.029
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    40   0.030
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    40   0.030
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      40   0.030
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    40   0.034
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    40   0.034
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    40   0.036
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    40   0.037
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    40   0.037
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    40   0.040
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    40   0.040
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    40   0.041
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    40   0.042
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    40   0.043
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    40   0.043
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    40   0.044
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    40   0.045
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    40   0.046
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      40   0.046
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    40   0.046
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.047
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    40   0.048
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.049
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    39   0.050
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    39   0.050
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    39   0.050
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    39   0.050
TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa] {O...    39   0.051
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    39   0.051
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    39   0.054
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               39   0.055
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    39   0.055
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    39   0.058
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    39   0.060
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    39   0.061
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    39   0.062
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    39   0.064
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                39   0.064
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    39   0.065
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    39   0.066
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    39   0.070
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    39   0.072
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    39   0.072
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    39   0.075
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    39   0.075
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    39   0.076
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    39   0.076
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    39   0.078
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    39   0.079
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    39   0.079
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    39   0.080
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    39   0.083
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    39   0.084
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    39   0.085
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    39   0.086
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    39   0.087
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    39   0.089
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    39   0.090
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    39   0.092
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    39   0.092
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    39   0.093
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    39   0.094
TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON}                 39   0.10 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    39   0.10 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    39   0.10 
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    39   0.10 
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    39   0.11 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    38   0.11 
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    38   0.11 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    38   0.12 
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    38   0.12 
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    38   0.12 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    38   0.12 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    38   0.12 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    38   0.13 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    38   0.13 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    38   0.13 
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    38   0.13 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    38   0.13 
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    38   0.14 
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    38   0.14 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    38   0.14 
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    38   0.14 
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    38   0.14 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               38   0.16 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.16 
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    38   0.16 
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    38   0.17 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    38   0.17 
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    38   0.17 
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    38   0.17 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    38   0.17 
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    38   0.18 
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    38   0.19 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    37   0.19 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.19 
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    37   0.19 
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    37   0.20 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    37   0.20 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.20 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    37   0.21 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.21 
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    37   0.21 
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    37   0.21 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    37   0.21 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    37   0.21 
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    37   0.22 
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    37   0.22 
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    37   0.22 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    37   0.22 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    37   0.22 
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    37   0.22 
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    37   0.23 
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    37   0.23 
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    37   0.23 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.23 
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     37   0.23 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.24 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    37   0.24 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    37   0.24 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    37   0.24 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.24 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    35   0.25 
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    37   0.25 
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    37   0.26 
TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {O...    37   0.26 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    37   0.26 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.26 
TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {O...    37   0.26 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    37   0.26 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   37   0.26 
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    37   0.27 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    37   0.27 
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    37   0.28 
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     37   0.28 
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    37   0.29 
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    37   0.29 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    37   0.30 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    37   0.30 
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    37   0.30 
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    37   0.30 
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    37   0.30 
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    37   0.31 
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    37   0.31 
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    37   0.32 
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    37   0.32 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.32 
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    37   0.33 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    37   0.33 
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    37   0.33 
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    37   0.34 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    37   0.34 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    37   0.34 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    37   0.35 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    37   0.35 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.35 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.35 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    37   0.35 
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    37   0.36 
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    37   0.37 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    37   0.37 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    37   0.37 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.38 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    37   0.38 
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    37   0.38 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.39 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    37   0.39 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    37   0.40 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    37   0.40 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    37   0.40 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.41 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    37   0.42 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    36   0.42 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    36   0.43 
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    37   0.43 
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    36   0.43 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    36   0.43 
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    37   0.43 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    36   0.43 
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    37   0.44 
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    37   0.44 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    36   0.44 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    36   0.44 
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    36   0.45 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    36   0.46 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    36   0.48 
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    36   0.48 
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    36   0.49 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    36   0.49 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    36   0.50 
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     36   0.50 
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               36   0.52 
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    36   0.53 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    36   0.54 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    36   0.55 
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    36   0.55 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    36   0.55 
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    36   0.55 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    36   0.55 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    36   0.56 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    36   0.57 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    36   0.57 
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    36   0.59 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    36   0.61 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    36   0.62 
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    36   0.62 
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    36   0.63 
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    36   0.63 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    36   0.65 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    36   0.65 
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               36   0.67 
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    36   0.68 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    36   0.68 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    35   0.69 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    36   0.70 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    36   0.70 
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    36   0.70 
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   0.70 
TBLA0A07480 Chr1 (1852023..1854782) [2760 bp, 919 aa] {ON} Anc_1...    36   0.71 
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    36   0.73 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    36   0.74 
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    35   0.74 
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    35   0.78 
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    35   0.79 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    35   0.80 
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    35   0.83 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    35   0.83 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    35   0.83 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    35   0.84 
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    35   0.84 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    35   0.84 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 35   0.84 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    35   0.85 
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    35   0.85 
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    35   0.86 
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    35   0.87 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    35   0.88 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    35   0.88 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    35   0.89 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    35   0.91 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    35   0.92 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    35   0.92 
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    35   0.92 
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    35   0.93 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    35   0.94 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    35   0.95 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    35   0.96 
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    35   0.98 
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               35   0.99 
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    35   1.0  
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    35   1.0  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    35   1.0  
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    35   1.0  
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 35   1.0  
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    35   1.0  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    35   1.1  
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    35   1.1  
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    35   1.1  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    35   1.1  
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    35   1.1  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    35   1.1  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     35   1.1  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    35   1.1  
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    35   1.1  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    35   1.2  
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    35   1.2  
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    35   1.2  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.2  
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    35   1.2  
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    35   1.3  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   1.3  
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    35   1.3  
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    35   1.3  
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    35   1.3  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    35   1.3  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   1.3  
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    35   1.4  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    35   1.4  
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    35   1.4  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    35   1.4  
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    35   1.5  
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    35   1.5  
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    35   1.5  
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    35   1.5  
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    35   1.5  
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    35   1.6  
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   1.6  
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    35   1.6  
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    34   1.6  
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    35   1.6  
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    34   1.6  
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    35   1.7  
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    34   1.7  
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    34   1.7  
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    34   1.7  
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    34   1.7  
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    34   1.8  
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    34   1.8  
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    34   1.8  
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    34   1.8  
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    34   1.8  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    34   1.8  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    34   1.9  
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    34   1.9  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    34   1.9  
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    34   1.9  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    34   1.9  
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    34   2.0  
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    34   2.0  
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    34   2.0  
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    34   2.0  
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    34   2.1  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    34   2.1  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    34   2.1  
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    34   2.1  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    34   2.1  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    34   2.1  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    34   2.2  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    34   2.2  
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    34   2.3  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    34   2.3  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    34   2.4  
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    34   2.4  
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    34   2.4  
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    34   2.4  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    34   2.5  
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    34   2.5  
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    34   2.6  
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    34   2.6  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    34   2.6  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    33   2.7  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    34   2.7  
TPHA0D00660 Chr4 complement(130279..131415) [1137 bp, 378 aa] {O...    33   2.7  
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    34   2.7  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    34   2.7  
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    34   2.7  
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    33   2.8  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    34   2.8  
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    33   2.9  
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    33   2.9  
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    33   2.9  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    33   2.9  
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    33   3.0  
KLTH0F00990g Chr6 (77084..79441) [2358 bp, 785 aa] {ON} similar ...    33   3.0  
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    33   3.1  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    33   3.1  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    33   3.2  
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    33   3.2  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    33   3.2  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    33   3.2  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    33   3.2  
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    33   3.2  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    33   3.3  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    33   3.4  
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    33   3.5  
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    33   3.6  
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    33   3.6  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    33   3.7  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    33   3.8  
Kwal_33.13118 s33 (80421..82760) [2340 bp, 779 aa] {ON} YDR520C ...    33   3.8  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    33   3.8  
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    33   3.8  
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    33   3.9  
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    33   3.9  
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    33   4.0  
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     33   4.2  
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    33   4.2  
NDAI0E02270 Chr5 (466651..468141) [1491 bp, 496 aa] {ON} Anc_8.642     33   4.2  
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    33   4.3  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    33   4.4  
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    33   4.6  
SAKL0A06116g Chr1 (554152..555684) [1533 bp, 510 aa] {ON} simila...    33   4.7  
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    33   4.7  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    33   4.8  
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    33   4.9  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    33   5.1  
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    33   5.2  
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    33   5.2  
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    33   5.2  
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    33   5.6  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    33   5.7  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    33   5.9  
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    33   5.9  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    33   5.9  
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    33   6.0  
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    33   6.0  
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     33   6.0  
Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W...    32   6.7  
Kpol_1005.2 s1005 complement(1473..3992) [2520 bp, 839 aa] {ON} ...    32   6.7  
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    32   6.9  
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    32   7.3  
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               32   7.4  
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    32   7.5  
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    32   7.7  
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    32   7.7  
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    32   7.7  
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    32   7.8  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    32   8.1  
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    32   8.2  
Skud_8.127 Chr8 (208145..209683) [1539 bp, 512 aa] {ON} YHR070W ...    32   8.2  
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    32   8.3  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    32   8.5  
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    32   9.4  
Suva_15.193 Chr15 (335911..338250) [2340 bp, 779 aa] {ON} YOR017...    32   9.4  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    32   9.4  
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    32   9.5  
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    32   9.5  
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    32   9.8  
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     32   9.8  
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    32   9.9  

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score = 1869 bits (4842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/965 (93%), Positives = 906/965 (93%)

Query: 1   MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA 60
           MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA
Sbjct: 1   MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA 60

Query: 61  RCKRELKRCLFSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNT 120
           RCKRELKRCLFSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNT
Sbjct: 61  RCKRELKRCLFSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNT 120

Query: 121 DNETLFKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSS 180
           DNETLFKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSS
Sbjct: 121 DNETLFKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSS 180

Query: 181 CQPSTDEGLKPLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRK 240
           CQPSTDEGLKPLSRSLSAASDTNTPIE                SQLIEEIGKVRPIPTRK
Sbjct: 181 CQPSTDEGLKPLSRSLSAASDTNTPIENLTVALATTLNANRTTSQLIEEIGKVRPIPTRK 240

Query: 241 IEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVS 300
           IEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVS
Sbjct: 241 IEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVS 300

Query: 301 ARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEW 360
           ARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEW
Sbjct: 301 ARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEW 360

Query: 361 NPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVR 420
           NPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVR
Sbjct: 361 NPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVR 420

Query: 421 LAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXX 480
           LAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRF           
Sbjct: 421 LAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDNDGNENNENY 480

Query: 481 XXXXRFYLDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKD 540
               RFYLDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKD
Sbjct: 481 LGNERFYLDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKD 540

Query: 541 DTNLAQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSV 600
           DTNLAQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSV
Sbjct: 541 DTNLAQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSV 600

Query: 601 FSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFS 660
           FSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFS
Sbjct: 601 FSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFS 660

Query: 661 LALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIR 720
           LALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIR
Sbjct: 661 LALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIR 720

Query: 721 SIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQ 780
           SIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQ
Sbjct: 721 SIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQ 780

Query: 781 RYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTS 840
           RYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTS
Sbjct: 781 RYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTS 840

Query: 841 NAECIFDPVGKXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSE 900
           NAECIFDPVGK                PFKTGLNSFVEQTNDITAMLLNNELIQGPSLSE
Sbjct: 841 NAECIFDPVGKTSAEETSNNLNNSTELPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSE 900

Query: 901 EVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFAXXXXXXXXXXXXR 960
           EVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFA            R
Sbjct: 901 EVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFANSNDTDIDTDSSR 960

Query: 961 PAAHQ 965
           PAAHQ
Sbjct: 961 PAAHQ 965

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score = 1486 bits (3846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/951 (77%), Positives = 779/951 (81%)

Query: 15  KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
           KR SSEN     PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELK C FSS 
Sbjct: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSFSST 63

Query: 75  REAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWK 134
           R   +  SP+MI   SK+  SKSEQ + N   S   +DM LSGK T NET FKSEG+KWK
Sbjct: 64  RGETNGTSPNMITAASKTFLSKSEQQIRNRSTSPITADMTLSGKETGNETSFKSEGVKWK 123

Query: 135 LELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSR 194
            ELSSMQN LEFLAQAAGTVAKEGAKEII+D+S T  P V+ L +S Q +TD GLK LSR
Sbjct: 124 FELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPLVDPLDTSHQSATDGGLKRLSR 183

Query: 195 SLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLT 254
             SAAS T TP E                SQLI EI  VRP PTRKIEDF+YIGP NLLT
Sbjct: 184 GDSAASATCTPHENVTAMLAASLNANRTTSQLIREISGVRPSPTRKIEDFDYIGPDNLLT 243

Query: 255 KEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNG 314
           KEEAIELIEAFFLTMHPFFPNIP QLHDPKELA+YPILFCAILTVSARYH FDTLGL NG
Sbjct: 244 KEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHRFDTLGLYNG 303

Query: 315 ENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYAN 374
           ENG RH+EVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH KWSDYAN
Sbjct: 304 ENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWSDYAN 363

Query: 375 DPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRI 434
           DPELNNVNVRG K+I TR+DEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSS+I
Sbjct: 364 DPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSKI 423

Query: 435 FIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILPN 494
           FIVTHISETTSAMNMNQRS+LAESFSVLNLNL +F               +FYLDEILPN
Sbjct: 424 FIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFDSDGKENNENYFGNEKFYLDEILPN 483

Query: 495 DESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPL 554
           DE K+RWK V E+    SDNEK +LTDWEREFLNDEYVLYYSNK DDTNLAQNH PPFPL
Sbjct: 484 DEIKKRWKGVFEDSADASDNEKYLLTDWEREFLNDEYVLYYSNKNDDTNLAQNHTPPFPL 543

Query: 555 RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYRE 614
           RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLS+FSPLMEGWLSNYRE
Sbjct: 544 RFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYRE 603

Query: 615 VLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM 674
           VLVPLSDVPFSLADRKNK+QV +NIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM
Sbjct: 604 VLVPLSDVPFSLADRKNKKQVFDNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNM 663

Query: 675 SEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTG 734
           +EIV SA+YVELAY+SAKEIL SAKRVSRQ MLK+MPVRWVIRIIRSIAFIVKCYLTLTG
Sbjct: 664 NEIVTSARYVELAYRSAKEILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTG 723

Query: 735 SEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 794
           SE+ATNPDARNILKLSAISVDETFDL+RDTAVTLKEATPDELHLCQRYAAILMYLCTEMK
Sbjct: 724 SELATNPDARNILKLSAISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK 783

Query: 795 LRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKXXX 854
           LRK SHLERP   R+   PL+S+    LEG ++ K  TF +  G +  +  F+   K   
Sbjct: 784 LRKSSHLERPSLLRSSTTPLESNHGFSLEGVDVTKKSTFYRDIGGNKTDSKFETPEKLPV 843

Query: 855 XXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDIGL 914
                          K  +NSFVEQ NDITA LLNNEL QGPSLSEEVTDWF ASEDIGL
Sbjct: 844 DEIGDNLNNSNDLSGKAIVNSFVEQNNDITAALLNNELFQGPSLSEEVTDWFGASEDIGL 903

Query: 915 EFVEPWTELIEQRYMQCGDGDNNNFENLYNLFAXXXXXXXXXXXXRPAAHQ 965
           EFVEPWTELIEQRYMQCGDGDNNNFENLYNLF             RP   +
Sbjct: 904 EFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNTNDIDNETDSSRPVTRK 954

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score = 1482 bits (3837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/955 (76%), Positives = 790/955 (82%), Gaps = 5/955 (0%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           MS  KR S  N     PKRRRTYQACI+CRSRKVKCDLGPVDNPH PPCARCKRELK+C+
Sbjct: 1   MSAKKRPSG-NAAFELPKRRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCI 59

Query: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEG 130
           FSSN+   + L P+ IN  S  +  KS+Q + ND  S   SD+PLS K   +E  FKSEG
Sbjct: 60  FSSNKGTSNDLPPNSINAISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISSEKSFKSEG 119

Query: 131 MKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLK 190
           MKWKLELSSMQN LEFLAQAAGTVAKEGAKEIIK++STT  P  +SL ++ + +TDEGLK
Sbjct: 120 MKWKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKSSLDATNKSATDEGLK 179

Query: 191 PLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPA 250
            LS+S S    TNT  E                SQL+EEIGKVRP PTRKI+DF+YIGP 
Sbjct: 180 RLSKSDS----TNTLYENTADMLNHTLNTNRKTSQLMEEIGKVRPPPTRKIDDFDYIGPD 235

Query: 251 NLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLG 310
           +LLTKEEAIELIEAFFLTMHPFFPNIP QLHDPKELA+YPILFCAILTVSARYHPFDTLG
Sbjct: 236 SLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTVSARYHPFDTLG 295

Query: 311 LDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWS 370
           LDNGE+G RH+EVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH KWS
Sbjct: 296 LDNGEDGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWS 355

Query: 371 DYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN 430
           DYANDPELNNVN RG K+I+TR+DEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN
Sbjct: 356 DYANDPELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN 415

Query: 431 SSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDE 490
           SS++FIVTHISETTSAMNMNQRS+LAESFSVLNLNLG+                +FYL+E
Sbjct: 416 SSKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNEDYLGNEKFYLNE 475

Query: 491 ILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMP 550
           ILP++ESK RWK+V EN E D DNEK  LTDWEREFLNDEYVLYYSNKKDDTNLAQNH+P
Sbjct: 476 ILPDEESKLRWKRVFENSENDHDNEKNFLTDWEREFLNDEYVLYYSNKKDDTNLAQNHIP 535

Query: 551 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLS 610
           PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPL+EGWLS
Sbjct: 536 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLS 595

Query: 611 NYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKIS 670
           NYRE+LVPLSDVPFSLADRKNK+Q+ +NIDRINGESIITDFNYCQLYIFSLALQVDGK S
Sbjct: 596 NYRELLVPLSDVPFSLADRKNKKQIFDNIDRINGESIITDFNYCQLYIFSLALQVDGKTS 655

Query: 671 RLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYL 730
           RLNM+EIV SA+YVELAY+SAKEILSSAKRVSRQ MLKYMPVRWVIRIIRSIAFIVKCYL
Sbjct: 656 RLNMNEIVTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWVIRIIRSIAFIVKCYL 715

Query: 731 TLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLC 790
           TLTGSE+ATNPDARNILKLSAISVDETFD+IRDTAVTLKEATPDELHLCQRYAAILMYLC
Sbjct: 716 TLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLC 775

Query: 791 TEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVG 850
           TEMKLRKKS+LERPP  R G  PL+S+ ES LEG +L K P F K  G +  E  F+P  
Sbjct: 776 TEMKLRKKSYLERPPLLRDGTTPLESNRESSLEGQDLTKKPIFSKRIGYNKTETTFEPSE 835

Query: 851 KXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASE 910
           +                  K  ++ FVEQ NDIT  LLNNEL QGPSLS+EVTDWF ASE
Sbjct: 836 RPLTEEINSNSQNSNDTSSKGIVDPFVEQNNDITTALLNNELFQGPSLSDEVTDWFGASE 895

Query: 911 DIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFAXXXXXXXXXXXXRPAAHQ 965
           DIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLF             RP   +
Sbjct: 896 DIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFVNSNNINNDINNSRPITRK 950

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score = 1418 bits (3671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/955 (74%), Positives = 772/955 (80%), Gaps = 6/955 (0%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           MS  KR S ENT    PKRRRTYQACINCRSRKVKCDLGPVDNPH PPCARCKREL+ CL
Sbjct: 1   MSLKKRFS-ENTTSALPKRRRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECL 59

Query: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEG 130
           FSS +   ++ SP M+N   +S        +PN       S+M LS K T++ETLFKS+G
Sbjct: 60  FSSQKVVKNSTSPHMVNTICQSKGE-----IPNHSRRLISSEMALSEKGTNDETLFKSDG 114

Query: 131 MKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLK 190
           +KWKLELSSMQN LEFLAQAAGTVAKEGAKE IKD S T  P  +SL +  Q + ++ LK
Sbjct: 115 VKWKLELSSMQNALEFLAQAAGTVAKEGAKETIKDRSATPRPSESSLDTPHQSAANKELK 174

Query: 191 PLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPA 250
            LS S   AS TNTP E                SQLI+EI + RP+PTR+I+DFEYIGP 
Sbjct: 175 TLSISECDASATNTPHENITDTLAAALNSNQKMSQLIKEISRARPMPTRRIDDFEYIGPD 234

Query: 251 NLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLG 310
           NLLTKEEAIELIEAFFLTMHPFFPNIP QLHDPKELA+YPILFC+ILTVSARYHPFDTLG
Sbjct: 235 NLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCSILTVSARYHPFDTLG 294

Query: 311 LDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWS 370
           LDNGENG RH+EVHDKLW+YCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH KWS
Sbjct: 295 LDNGENGIRHIEVHDKLWIYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHYKWS 354

Query: 371 DYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN 430
           DYANDPELNNV VR  K+I+T++DEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN
Sbjct: 355 DYANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN 414

Query: 431 SSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDE 490
           SS+IFIVTHISETTSAMNMNQR +LAESFSVLNLN+ +F               +FYL+E
Sbjct: 415 SSKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKFDDDGNKGNENYLGNEKFYLNE 474

Query: 491 ILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMP 550
           ILP+DESK+RWKKV ++ E D D+EK +LTDWEREFLNDEYVLYYSNKKDDTNLAQN MP
Sbjct: 475 ILPDDESKKRWKKVFKDSEDDDDSEKNILTDWEREFLNDEYVLYYSNKKDDTNLAQNPMP 534

Query: 551 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLS 610
           P PLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPL+EGWLS
Sbjct: 535 PSPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLS 594

Query: 611 NYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKIS 670
           NYREVLVP+SDV F LADRKNK+QV +NI+R+NGE+IITDFNYCQLYIFSLALQVDGK S
Sbjct: 595 NYREVLVPISDVSFLLADRKNKKQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTS 654

Query: 671 RLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYL 730
           RLNM+EI+ SA+YVELAY+SAKEILSSAKRVSRQ MLKYMPVRW IRIIRSIAFIVKCYL
Sbjct: 655 RLNMNEIMTSARYVELAYRSAKEILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYL 714

Query: 731 TLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLC 790
           TLTGSE+ATNPDARNILKLSAISVDETFD+IRDTAVTLKEATPDELHLCQRYAAILMYLC
Sbjct: 715 TLTGSELATNPDARNILKLSAISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLC 774

Query: 791 TEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVG 850
           TEMKLRKKS+ ERPP S  G  PL+S+ ES  EG +  K PTF K   ++ AEC  +   
Sbjct: 775 TEMKLRKKSYTERPPLSTNGTTPLESNCESSPEGVDFTKKPTFPKNIRSNKAECNSESSK 834

Query: 851 KXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASE 910
           K                  K   N FVEQ ND T  LLNNEL QGPSLSEEVTDWF ASE
Sbjct: 835 KSPMEEIDSNLNNPNNLSSKVIFNPFVEQNNDTTTTLLNNELFQGPSLSEEVTDWFGASE 894

Query: 911 DIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLFAXXXXXXXXXXXXRPAAHQ 965
           DIGL FVEPWTELIEQRYMQCGDGD NNFENLYNLF             RP   +
Sbjct: 895 DIGLGFVEPWTELIEQRYMQCGDGDINNFENLYNLFVNSNDIDNDIGSSRPITRK 949

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
           Anc_5.525 YDR421W
          Length = 938

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/954 (49%), Positives = 615/954 (64%), Gaps = 50/954 (5%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           MST+ +G S   + T  K RR+Y+AC+NCR+RKVKCDLGP DNPH PPC RCKRE + CL
Sbjct: 1   MSTSPQGKS---LKTESKWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECL 57

Query: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEG 130
           F+S R+    +    +++T+  ++   E       ++S  S   L   +  N      + 
Sbjct: 58  FTSRRKKKDDVISGTVSLTNVPSAITQEDDNDRIQLNSGSSKGALFSNSPKNPN--TQDQ 115

Query: 131 MKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLK 190
            KWK  L SMQNTLEFLA AAG+V+KE  + +        T   +S   + + S D  + 
Sbjct: 116 SKWKYGLGSMQNTLEFLATAAGSVSKESNRRL--------TTARHSHQYAKETSEDFRVD 167

Query: 191 PLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPA 250
             S S      T+T  +                  LIEE+ +VRP P +K+ D +YIGP+
Sbjct: 168 DSSPSSERKDITDTSEQSVIAPLLKECGTQRATVSLIEELSRVRPKPNKKLADIDYIGPS 227

Query: 251 NLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLG 310
           NLL+++EA ELI+A+FLTMHPFFPNIP QL DP EL  YPIL CAILT+S+RYHPF   G
Sbjct: 228 NLLSEQEARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHPFSEFG 287

Query: 311 LDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWS 370
             NGEN  R++EVH+ LW YCQ+LISQT+WAEASTRSIGTVLAFIIFTEWNPR IH + +
Sbjct: 288 FYNGENNKRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQIHWRRT 347

Query: 371 DYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIEN 430
           DYAN  E      +     ++++D++GLTG+GAIRRSDRMSWMLTGSAVRLAQDMGFIE 
Sbjct: 348 DYANSAE------KDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDMGFIET 401

Query: 431 SSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXX---XXXXXRFY 487
           S++IF+ +HIS+T ++MNMNQR  L+E+FSV+    GR                   +FY
Sbjct: 402 STKIFVASHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVGNEKFY 461

Query: 488 LDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQN 547
           L+++L N+ES+ERW +VLE L+ ++D +   LTD EREFLNDEYVLYY+N+ D+  + Q 
Sbjct: 462 LEQMLQNEESRERWTRVLERLQHNNDKKNGPLTDLEREFLNDEYVLYYANRNDE--MVQQ 519

Query: 548 HMP-PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLME 606
           H+  PFPL+FSF QRAKIE+IRI+ IAY+TIY +K KRKL + DQ HNL+VL + SPL+E
Sbjct: 520 HLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSNDQVHNLAVLGILSPLIE 579

Query: 607 GWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVD 666
           GW + YR +L   S  P+S+  RKNKR V    + IN ESI++D+ YCQLYI+SLALQVD
Sbjct: 580 GWYATYRNLLKISSGQPYSIEIRKNKRAVHELGEEINRESILSDYYYCQLYIYSLALQVD 639

Query: 667 GKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIV 726
            K  +L ++E  KSAKYVELAY +AKEIL S+ RV R  MLKYMPVRWV+RI+R+++F+V
Sbjct: 640 VKGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLKYMPVRWVMRIVRAVSFLV 699

Query: 727 KCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAIL 786
           KCYLTLTG     N +A+ ILKL  IS+DET   IR  A+ LKEA+PDELHLC RY+AIL
Sbjct: 700 KCYLTLTGGGGVPNSEAQTILKLCCISLDETIHTIRLAALILKEASPDELHLCVRYSAIL 759

Query: 787 MYLCTEMKLRKK-------SH---LERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKT 836
           +YLC EM L+ K       SH   +      + G    K++ +S ++      G T D  
Sbjct: 760 LYLCKEMNLKSKRNQKLLVSHGILINESRNRQMGSRRTKATQDSDID-----LGSTDDSK 814

Query: 837 AGTSNAECIFDPVGKXXXXXXX--XXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQ 894
              SN E + + +                    P +    S V    D T   L+N+   
Sbjct: 815 NIQSNNELLPNNISTTNGLTTSLFNTEEMRSETPNQRIPTSAVA---DNTPNNLDNDGTN 871

Query: 895 G----PSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 944
                PSL +E  DWFS S DIGL+FVEPWTEL+EQR++Q GDG NN FE LYN
Sbjct: 872 NPTNFPSLPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGDG-NNIFEELYN 924

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/968 (46%), Positives = 607/968 (62%), Gaps = 86/968 (8%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           M+  KR   E      PK RRTYQAC+NCR+RKVKCDLGPVDNPH PPC RCKRE K C+
Sbjct: 1   MNNKKRTLFETQQIQPPKWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECI 60

Query: 71  F--SSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKS 128
           F  S+ R  +   + S I   + +A++   + + +    +T        +  D +     
Sbjct: 61  FTESNKRGGLRVANVSAIAENTANATASMSKAITSVFQGNTSE----GSQQPDFKRENSI 116

Query: 129 EGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEG 188
           + +    EL++MQ+ LEFLA+AAG+VAKE +++++ D ST        L S     TD  
Sbjct: 117 DPLPINSELTTMQDALEFLAKAAGSVAKEDSRDLV-DASTK----YEELESQSNSRTDTP 171

Query: 189 LKPLSRSLSA--ASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEY 246
           +   S   S   ++  N P E                  LIE++  VRP P+R++ D EY
Sbjct: 172 ISSGSAQDSTRNSNSANIPDEACIAPLLRPHGLGRPTIPLIEKLSSVRPKPSRRLTDIEY 231

Query: 247 IGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPF 306
           IG   +L++EEA++LI+ FFLTMHPFFP++P QL +P ELAQYPIL CAILT+S+RYH F
Sbjct: 232 IGTLKMLSEEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSF 291

Query: 307 DTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIH 366
           D + + NGE+  R+VE+H++LW+YCQ+LISQT+WAEASTRSIGTVLAF++FTEWNPR+IH
Sbjct: 292 DEVNMYNGESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIH 351

Query: 367 CKWSDYANDPELNNVNVRGGKHI----------NTRRDEEGLTGVGAIRRSDRMSWMLTG 416
            +WSDYAN+P+LN+V+ R   ++          N+++  +GLTG+ A+RRSDRM+WMLTG
Sbjct: 352 WRWSDYANNPDLNDVSKRDLSNVACSSSSSTACNSQQHGDGLTGLSAMRRSDRMAWMLTG 411

Query: 417 SAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXX 476
           +AVRLAQDMGF+  SS+IF  THISET +AMNMNQRS+L++S + +NLN           
Sbjct: 412 TAVRLAQDMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINLN----------G 461

Query: 477 XXXXXXXXRFYLDEILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYS 536
                    +YL +IL +D SKERW K L+ L + S   +  + D EREF+NDEYVLYYS
Sbjct: 462 YEDDVENESYYLGQILKSDGSKERWSKFLKKLGSSSTRGR--MNDIEREFVNDEYVLYYS 519

Query: 537 NK------------KDDTNLA-QNHMPPFPLRFSFAQRAKIEIIRILSIAYETIYCEKNK 583
           +K             DD N   Q    P+ L+FSF QRAKIE++RI+SI YETIY  + K
Sbjct: 520 DKDGAPAHADEYTMNDDKNRKKQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGK 577

Query: 584 RKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRIN 643
            KL +  Q HNL++LS+ SPL+E W + Y+ +L P S    + A    K+ +    ++++
Sbjct: 578 LKLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAACNTAMCSEKKYIFELTEKVD 637

Query: 644 GESIITDFNYCQLYIFSLALQVD---GKISRLNMSEIVKSAKYVELAYKSAKEILSSAKR 700
            ES+I+D+ YCQLYI+SLALQVD    K  +L M+EI K A+YVELAY +AKEIL+SA R
Sbjct: 638 RESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIR 697

Query: 701 VSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDL 760
           V +  MLKYMPVRWV RI+RS+AF+VKCYLTLTGS IATNP+A  IL LS I  +E    
Sbjct: 698 VHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATNPEANTILTLSVIPTEEIIQT 757

Query: 761 IRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERPPTSRTGIAPLKSSDES 820
           I+  A+TL+EA+PDELHLC RY+ ILMYLCTEMKLR + +  +PP  R       S  E 
Sbjct: 758 IQRAAITLREASPDELHLCTRYSTILMYLCTEMKLRSRPN-PQPPVPR-------SISEQ 809

Query: 821 PLEGANLVKGPTFDKTAGTSNAECIFDPVGKXXXXXXXXXXXXXXXXPFKTGLNSFVEQT 880
           P + +                 E  F+  GK                P    +NS  E T
Sbjct: 810 PEQIS----------------VETTFNFCGKNETHEKGQGSQQRGPLP-PPRMNSLPETT 852

Query: 881 NDITAMLLNN----ELIQGPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDN 936
           N   A  ++N    +  Q   L  +V DWFS S++IGL+FVEPWTE+IEQ+++   + +N
Sbjct: 853 N--FAFNVDNFFSPQGAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFI--SNDNN 908

Query: 937 NNFENLYN 944
             FENLYN
Sbjct: 909 KTFENLYN 916

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/933 (46%), Positives = 589/933 (63%), Gaps = 67/933 (7%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           K +R Y+AC NC+ RKVKCD+GP++NPH PPCARC+RE K C+F + +     L  S I 
Sbjct: 19  KWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKADLGTSKIP 78

Query: 88  IT-------SKSASSKSEQGVPNDLMSSTPSDMP-LSGKNTDNETLFKSEGMKWKLELSS 139
            T       S ++ SK       DL++  P  +P  S  N  + T       KWK+ L+S
Sbjct: 79  STTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPSNPISPT-------KWKIGLTS 131

Query: 140 MQNTLEFLAQAAGTV---AKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSL 196
           MQN+LEFLA+AAG V   +   A    ++ ++   P   SL        +E L  ++ SL
Sbjct: 132 MQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPKATSL------PQEESLMNMTSSL 185

Query: 197 SAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKE 256
            +     +PI                   LI+++  VRP P RK+ D +YIGP  LL++ 
Sbjct: 186 HSDLLNISPIGKLQHKSLP----------LIDKLNIVRPTPRRKLTDIDYIGPNRLLSES 235

Query: 257 EAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLG--LDNG 314
           +AIELI+ FFLTM PFFPNIP QL +PKELAQYPIL CAILT+S+RYH FDT    ++NG
Sbjct: 236 DAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHSFDTFADSINNG 295

Query: 315 ENGTR-HVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYA 373
           +N  R H++VH+KLW+YCQ+LISQTIWAEASTRSIGT+LAFIIFTEWNPR+IH  WSDYA
Sbjct: 296 QNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNPRAIHWNWSDYA 355

Query: 374 NDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSR 433
           +DP LN+++ R  +    +R+EEGLTG+ AIRRSDRM+WML+G+AVRLAQD G I  +++
Sbjct: 356 SDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLAQDTGLIRTNTK 415

Query: 434 IFIVTHISETTSAMNMNQRSVLAESFS---VLNLNLGRFXXXXXXXXXXXXXXXRFYLDE 490
           + I THIS+T +AMNMNQRS L+ SF+     +L+  R+                FYL +
Sbjct: 416 VAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVNE----NFYLTQ 471

Query: 491 ILPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMP 550
           IL N ESKERWKK+    + D++     L+D E EFLNDEY LY+S + +D++      P
Sbjct: 472 ILQNKESKERWKKISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKEDNDSS----QRP 527

Query: 551 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLS 610
           P PL+F+F QRAK+E++RI+++ YETIY E  +++L + DQR NL+VL++ SPL++ W S
Sbjct: 528 PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDDQRRNLAVLNILSPLIDSWYS 587

Query: 611 NYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKIS 670
           NY  +L   +  P S    K K++       I+GE++I+D+ YCQLYIFSLALQVD   +
Sbjct: 588 NYNSLLKTDAVRPVSPGMHKRKQEAFKMSQNISGETMISDYYYCQLYIFSLALQVDVGQN 647

Query: 671 RLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYL 730
           +L ++EI + A YVE AY +AKEIL SA RV +  MLKYMPV+WV+RI+RS+AFIVKCYL
Sbjct: 648 KLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKYMPVKWVMRIVRSVAFIVKCYL 707

Query: 731 TLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLC 790
           TLT    ++NP+AR IL LSAISVDET   I+DTA+ LKEA PDELHL  RY+AIL+YLC
Sbjct: 708 TLTSGSFSSNPEARTILSLSAISVDETIQTIQDTAIILKEAAPDELHLSTRYSAILLYLC 767

Query: 791 TEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVG 850
            EMK + +S      + ++     KSS  +PL   +++   + DK +     + +     
Sbjct: 768 REMKSKHES------SQQSKGYDSKSSSNAPLSD-DVITNQSGDKMS----EDILLKSHA 816

Query: 851 KXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASE 910
           +                  K  L+       D T   LN        L  +V +WF+ S 
Sbjct: 817 EVAAKDPRTSQENIELQMNKPNLDGKFASDMDFTTDNLN-------ELPGDVANWFTTSG 869

Query: 911 DIGLEFVEPWTELIEQRYMQCGDGDNNNFENLY 943
           +IGLEFVEPWTE+IEQ Y+Q GD  N  F++LY
Sbjct: 870 NIGLEFVEPWTEMIEQMYLQSGDA-NTTFDDLY 901

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/774 (50%), Positives = 523/774 (67%), Gaps = 27/774 (3%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           K +R+++ACI+CR RKVKCDLGP++NPH PPC RC+RE K C+FSS    M + + S +N
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85

Query: 88  ITSKSAS-SKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEF 146
             +  A+ +  ++ +  D  S+  S    +       T  +    KWKLEL+SMQN+LEF
Sbjct: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRLPREKWKLELASMQNSLEF 145

Query: 147 LAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTPI 206
           LA+AA +VA +   E  K+ +           +     T E   P+ +  S   +  TP+
Sbjct: 146 LAKAADSVAHQSNPESFKETAKLA-------KNGASNDTSENDTPVQQQDSPNENYLTPL 198

Query: 207 EXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFF 266
                             QL + I  +RP  ++ + D E+IGP+ LL++EEA ELI+ FF
Sbjct: 199 ------TTPHNSRRSALPQLEKSIS-IRPKSSQTLSDMEFIGPSKLLSEEEARELIDLFF 251

Query: 267 LTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENG--TRHVEVH 324
           LTM+PFFP+IP QL D  EL +YPIL CAILT+S+RYHPFD     NG  G   R++ VH
Sbjct: 252 LTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRYHPFDEFDGYNGTPGRQKRNIHVH 311

Query: 325 DKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVR 384
           +KLW+YCQ+LISQT+WAEASTRSIGT+ AFIIFTEWNPR+IH KWSDYAN+PE  ++  R
Sbjct: 312 EKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWNPRAIHWKWSDYANNPEQYDMTKR 371

Query: 385 GGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETT 444
                   +DE+GLTG+ AIRRSDRM+WMLTG+AVRLAQD+G IE S+++F+ THISE+ 
Sbjct: 372 ESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRLAQDIGAIETSAKVFVATHISESY 431

Query: 445 SAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILPNDESKERWKKV 504
           +A+NMNQ  +L++SF+  NL+                   R YL++IL NDESK RW  +
Sbjct: 432 TAINMNQGLILSQSFNERNLD--------GIDNLNGVDNERLYLEQILQNDESKARWNGI 483

Query: 505 LENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQRAKI 564
           L+ L+ +    +  L D EREFLNDEY LYY++  +DT   Q+     PL+F+  Q+AK+
Sbjct: 484 LKLLDNEVGISEEYLQDVEREFLNDEYTLYYADHDEDTQ--QHTQQIIPLKFTSTQKAKL 541

Query: 565 EIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPF 624
           E++RIL + YETIY EK  ++L +TDQRHNL+VL++ +PL+E W +NYR +L        
Sbjct: 542 ELLRILILGYETIYYEKGDQRLVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIREGEVL 601

Query: 625 SLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYV 684
           SL  R+NKR+      +IN E++I+D+ YCQLYI+SLALQVD + ++L ++EI + A +V
Sbjct: 602 SLNQRRNKRKAFEMSRQINTETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFV 661

Query: 685 ELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDAR 744
           E AY +AKEIL SA RV +  MLKYMPVRWV+RI+RS+AFIVKCYLTLT S+++TNP+A 
Sbjct: 662 EKAYIAAKEILESAGRVHKLNMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSDLSTNPEAN 721

Query: 745 NILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKK 798
            IL+LSAISVDET   I+  A+TLKEA PDELHLC RY+AILMYLC EMKLR K
Sbjct: 722 TILRLSAISVDETIQTIQTAAITLKEAAPDELHLCTRYSAILMYLCREMKLRDK 775

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%)

Query: 894 QGPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLY 943
           +GPSLS  VTDWF+   DIGL+FVEPWTE+IEQRY+Q GD  N +FE LY
Sbjct: 841 EGPSLSNNVTDWFNVGGDIGLDFVEPWTEMIEQRYLQSGDV-NTSFEELY 889

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/950 (44%), Positives = 579/950 (60%), Gaps = 61/950 (6%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           MS +KR  SE +     K RR+Y+AC+NCRSRK+KCDLGP+DNPH PPC RCKRE + C+
Sbjct: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60

Query: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDM---PLSGKNTDNETLFK 127
           F   +           ++T+K  + K  + +   ++SS   D+    L+G  +    L +
Sbjct: 61  FPVTKRR---------DVTAKINNMKGSE-LERSIISSILPDVDKKSLNGGGSAGSDLKQ 110

Query: 128 SEGMK------WKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSC 181
           +   K      W+ ++S+MQ  LEFLA A G ++K   + ++      T    N      
Sbjct: 111 NNIRKKPTDSNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTL-IENEDADDS 169

Query: 182 QPSTDEGLKPLSRSLSAASDTNTPIEXXXX-XXXXXXXXXXXXSQLIEEIGKVRPIPTRK 240
            P+ D   + +SRS     D+NTP                   S L+  I  +RP PTR 
Sbjct: 170 NPNNDNS-EDVSRS-----DSNTPKSRNSIFSLIHDDTASKVISPLMGTIESIRPKPTRN 223

Query: 241 IEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVS 300
           + D EYIGP  LLT++EA  LI  FFLTMHP+FP IP QLH+P EL +YPIL CAILTVS
Sbjct: 224 LSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYPILLCAILTVS 283

Query: 301 ARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEW 360
           +RY+ F+ + ++N     R++ VH+KLW YCQ+LIS TIWAEASTRSIGT+LAF++FTEW
Sbjct: 284 SRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGTILAFLLFTEW 343

Query: 361 NPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVR 420
           NPR+IH  WSDY N+PEL         +++  + E+  TG  A+R SDRM+WM TGSAVR
Sbjct: 344 NPRAIHWTWSDYGNNPELTCFTKNNENNMSEFKGEKT-TGFEAMRHSDRMAWMFTGSAVR 402

Query: 421 LAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXX 480
           LAQDM FI+N+ +IF+ THISET +AMN+NQRS L++S S +NL++ R            
Sbjct: 403 LAQDMHFIDNNYKIFMATHISETFNAMNVNQRSTLSDSLSNINLSITRSHGKNNDDEEGH 462

Query: 481 XXXXRF-----YLDEILPNDESKERWKKVLENLEADSDNEK-CVLTDWEREFLNDEYVLY 534
                F     YL++IL +D+SKE+W K L+ + ++  +E   V+TD ERE+LNDEY+LY
Sbjct: 463 IFAENFGNEQYYLEQILKHDKSKEKWIKFLKEINSNKSSENSTVITDAEREYLNDEYILY 522

Query: 535 YSNKKDDTNLA-QNHMP-----PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLAT 588
           Y N   +T     NH       P+PL+F+   +AKIEI+RI+SIAYETIY  KNKR LA 
Sbjct: 523 YQNNNPETQPTWGNHSVTSTSLPYPLKFASFHKAKIEILRIMSIAYETIYSAKNKRVLAF 582

Query: 589 TDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESII 648
            +QR NL+VLS+FSPL+E W SN+  +L      P  ++  K+K  V      I  ES+I
Sbjct: 583 NNQRQNLAVLSIFSPLIESWYSNHHGLLKLFECAPCDMSKYKDKNTVQKLSQAIEKESLI 642

Query: 649 TDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLK 708
            D+ YCQLYI+SLAL+VD K + LN+SEI KSAKYV +AY +AKEIL+SA RV++  +L+
Sbjct: 643 GDYYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAYNAAKEILTSAVRVNKLKLLR 702

Query: 709 YMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTL 768
           Y+PVRWV RI+RS+AFIVKC+L LT SE + N +   I++LS I VDE  +LI  T+VTL
Sbjct: 703 YLPVRWVTRILRSVAFIVKCFLLLTESETSENSEINAIIRLSGIPVDEALELIETTSVTL 762

Query: 769 KEATPDELHLCQRYAAILMYLCTEMKLRKKS-HLERPPTSRTGIAPLKSSDESPLEGANL 827
            +A+PDELHLC+RY++IL+Y+C E++ + ++ ++     ++   A +K            
Sbjct: 763 NDASPDELHLCKRYSSILLYMCKELRNKTQNLYMNEGVAAKQENADVK------------ 810

Query: 828 VKGPTFDKTAGTSNAECIFDPVGKXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAML 887
           V   + +  +   N++   +P                         +  +EQ    T +L
Sbjct: 811 VGNKSLENLSSIENSQEPIEPFIMNEHPQTELPINTTEQIAIVGNEHHGIEQ----TPIL 866

Query: 888 LNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNN 937
             N +    S   EV DWFS+S DIGLEFVE WTE+IEQ Y++  DGD N
Sbjct: 867 NPNSM----SFQGEVIDWFSSSADIGLEFVESWTEMIEQMYLRSSDGDQN 912

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/797 (48%), Positives = 520/797 (65%), Gaps = 42/797 (5%)

Query: 13  TTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
           +T    S  + PT  K RR Y+ACI+CR++K+KCD+GP+DNPH PPC RC+RE K C+  
Sbjct: 4   STTNPESSGSNPT--KWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILP 61

Query: 73  SNREAMHT--------LSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNET 124
            N+   +T        +   ++ + +KS S +S       L+S T +  P +G  ++N  
Sbjct: 62  ENKRRGNTDTEFKLGKIENGLVGVMNKSESEQS-------LLSQTRAPPP-NGSTSNNLD 113

Query: 125 LFKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPS 184
           L      KWK E+ +M N LEFLA+AAG+V+KE   E+   ++ +     N   ++    
Sbjct: 114 LVDP---KWKFEIGTMYNALEFLAKAAGSVSKEEPIEMKSPQNRSDLGVGNMPDTALNGV 170

Query: 185 TDEGLKPLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDF 244
             + +  L       SD     E                + LIE++  +RP  ++K+ D 
Sbjct: 171 MSDNIGNLD-----ISD-----ESFLAPLTTANGSQRAAAPLIEKLSSMRPKSSKKLIDV 220

Query: 245 EYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYH 304
           +YIGP+ LL+++EA  LI+ FFLTMHPFFP+IP QL DP EL +YPIL CAILT+SARY+
Sbjct: 221 DYIGPSKLLSEDEATRLIDIFFLTMHPFFPHIPLQLQDPDELVRYPILLCAILTISARYN 280

Query: 305 PFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRS 364
           PF  LG  +GE   R++EVH++LW+YCQ+LISQTIWAEASTRSIGTVLAF++FTEWNPR+
Sbjct: 281 PFGELGFYDGEAHNRNIEVHERLWIYCQRLISQTIWAEASTRSIGTVLAFLLFTEWNPRA 340

Query: 365 IHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQD 424
           IH KWSDYAN+PELN+V  R     NT RD E  TG+ A+RRSDRM+WML G+AVRLAQD
Sbjct: 341 IHWKWSDYANNPELNDVTKRETHGANTPRDTETFTGMAAVRRSDRMAWMLIGAAVRLAQD 400

Query: 425 MGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXX 484
           M FI+ SS+IF+ THI+E  +AMN+NQ+S+L+ES S +N  +                  
Sbjct: 401 MSFIDTSSKIFVATHIAEAHTAMNLNQKSILSESLSEVNREV--------LERLDDIGNE 452

Query: 485 RFYLDEILPNDESKERWKKVLENL-EADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTN 543
            FYL+ IL  DESKERW   L+N+ E         LTD EREFLNDEYVLYY N ++D +
Sbjct: 453 NFYLEHILQKDESKERWTNFLQNVSEGRRAKGTGPLTDMEREFLNDEYVLYYVNARNDAS 512

Query: 544 LAQNHMPPFPLRFSFAQRAKIEIIRILSIAYETIY--CEKNKRKLATTDQRHNLSVLSVF 601
              +   PFPL+FS  QRAKIE++RIL+I YE+IY   EK+K +L   + + NL++L + 
Sbjct: 513 SKSSLTLPFPLKFSHPQRAKIELLRILTIGYESIYYESEKDKTQLINGNPKRNLALLEII 572

Query: 602 SPLMEGWLSNYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSL 661
           S L+E W + Y+++L+P +  P SL   +NKR V     +I+ ES+  D+NYCQLYI+SL
Sbjct: 573 STLIEKWHATYKDLLIPANATPCSLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSL 632

Query: 662 ALQVDGKISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRS 721
           ALQ D K   L M EI KSA+YVELAY++A+ IL SA+R+    ML+YMPVRWV RI+R+
Sbjct: 633 ALQNDVKNMDLKMPEIRKSARYVELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRA 692

Query: 722 IAFIVKCYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQR 781
           +AF+VKCYL LT   +A NP A  IL+L+ I  +ET  +I   AVTL+EA PDE+HL  R
Sbjct: 693 VAFLVKCYLVLTKDGLAANPVAGTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMR 752

Query: 782 YAAILMYLCTEMKLRKK 798
           Y+ IL +LC E+K+R +
Sbjct: 753 YSKILKFLCAEVKMRTQ 769

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 26/31 (83%)

Query: 900 EEVTDWFSASEDIGLEFVEPWTELIEQRYMQ 930
           E+  D F+AS+DIGL+FV+ WTE+IE RYMQ
Sbjct: 838 EDPFDLFAASDDIGLDFVDTWTEMIENRYMQ 868

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/797 (47%), Positives = 517/797 (64%), Gaps = 36/797 (4%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           K RR+Y+AC+NCR RK+KCD+GP+D PH PPC RCKRE K C F  +R+       S+  
Sbjct: 14  KWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK------SVFK 67

Query: 88  ITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEFL 147
              ++   + +  V   ++ +   D+       +  +  K +G KW+ E+SSMQN LEFL
Sbjct: 68  RQHRTNGLELQDEVEKHVVITHEVDVGGPSDRIERHSRNKIDG-KWRFEISSMQNALEFL 126

Query: 148 AQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTPIE 207
           A+AAG+VAKE       D        ++    S   S+ + L P S   S A     P+E
Sbjct: 127 AKAAGSVAKE-------DNQLHEIKQIDPSQVSRDDSSWKDLTPTSFEASRAG-IMAPLE 178

Query: 208 XXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFFL 267
                             LI+++  VRP P  K+ + E+IG ++ LT+EE I+L++ FFL
Sbjct: 179 ADEGSSRKAVP-------LIKKLSSVRPKPCIKLSNLEFIGGSDQLTEEEVIKLVDVFFL 231

Query: 268 TMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVHDKL 327
           TM+PFFP+IP QL DP+ELA+YP+L C+I+TVSARYH F  +GL +     R++EVH++L
Sbjct: 232 TMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHSFCDIGLKDNMQNNRNIEVHEQL 291

Query: 328 WVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVRGGK 387
           W+YCQKLISQTIWAEASTRSIGTVLAF++FTEWNPR+IH KWSDYAN  +  +       
Sbjct: 292 WIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANSGDSKD----RSN 347

Query: 388 HINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETTSAM 447
             +  RD E LTG+ AIRRSDRM+WMLTG+AVRLAQDMGF E SS+IF  THISET +AM
Sbjct: 348 DFSISRDSERLTGMAAIRRSDRMAWMLTGNAVRLAQDMGFNETSSKIFTATHISETHTAM 407

Query: 448 NMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILPNDESKERWKKVLEN 507
           N+ QRS L ES + +NL   +F               +FYL++IL ND+SK+RW + L +
Sbjct: 408 NVGQRSTLTESLNEINLGSIKFPRNNSVGNE------QFYLEKILENDDSKDRWTRFLHD 461

Query: 508 LEAD-SDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQRAKIEI 566
           +  D + +++  LTD EREFLNDEYVLYY+   D  +   +++ PFPLRFS  QRAKIE+
Sbjct: 462 IRDDYAHHDEGPLTDIEREFLNDEYVLYYTADGDSKHRDSSNLLPFPLRFSKIQRAKIEL 521

Query: 567 IRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDVPFSL 626
           +RI+++ +E IYC K+K++    D   NLS+L + SPL+E W  +Y ++L P    P ++
Sbjct: 522 LRIITVGFEAIYCTKDKQQSLFNDPTRNLSLLHLISPLIESWYKSYHDLLEPAEGKPCTV 581

Query: 627 ADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYVEL 686
              +NKR+V   + +I+ ES+I ++ YCQLYI+S ALQVD K  +L + EI +SAKYVEL
Sbjct: 582 DLCRNKREVHYVVRKIDRESLICEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVEL 641

Query: 687 AYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNI 746
           AY +AK +L+SA R+ R  +LK MPVRWV RI++S+AFIVKCYLTL G+ +  NP A  I
Sbjct: 642 AYNAAKMLLTSATRLHRLNLLKCMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLANTI 701

Query: 747 LKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERPPT 806
           LKL+ I  ++    I   A+ LKEA+PDELHLC RY+ ILM LC+EM+   + +    PT
Sbjct: 702 LKLTVIPAEDILKTIHTAALILKEASPDELHLCMRYSTILMSLCSEMR-ESEDYTTDSPT 760

Query: 807 SRTGIAPLKSSDESPLE 823
             T     + +D SP++
Sbjct: 761 PGTTFG--QDNDPSPIQ 775

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 1/44 (2%)

Query: 898 LSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 941
           L  +V DWFS S++IGLEFVE W E+IEQRY+Q G   + N  N
Sbjct: 783 LPNDVVDWFSTSDEIGLEFVESWAEMIEQRYLQ-GSSYSQNLGN 825

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/945 (42%), Positives = 550/945 (58%), Gaps = 61/945 (6%)

Query: 31  RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN----REAMHTLSPSMI 86
           R ++AC NCR +KV+CD GP DNPH PPCARCKRE K C F++     ++ +   + + I
Sbjct: 21  RGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGKEQDMVTGEATNGI 80

Query: 87  NITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEF 146
                    K+E  +P   ++ +P  +  +     NE    +    WKLEL+SM NTL F
Sbjct: 81  PTVDTVPVKKNELALPALAVTVSPG-LIQNRSEMGNEA---NPNTGWKLELTSMHNTLAF 136

Query: 147 LAQAAGTVAKEGAKEIIKDE--STTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNT 204
           LAQAAGTV+    K ++K    S  +TP +    S     T  G          AS    
Sbjct: 137 LAQAAGTVSNTLNKGLMKKTLPSDRSTPSLEI--SRLGSKTPTGF---------ASSLGL 185

Query: 205 PIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEA 264
            +                  QLIE+    +    + ++D + IG   LL+++EA   I+A
Sbjct: 186 GMPSNPTKTLLQEIETQNKVQLIEKSKNTKSKVPKTLKDIKCIGENGLLSEQEATAFIDA 245

Query: 265 FFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVH 324
           FF TMHPFFP IP QL DP EL +YPIL CAILT+S RYH F   G DNG+   R+ EVH
Sbjct: 246 FFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSFSEFGFDNGDYNKRNFEVH 305

Query: 325 DKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYAND-----PELN 379
           +KLW  CQ ++S+TIW EASTRSIGTVLAFI+FTEWNPR IH K SDYAND      EL+
Sbjct: 306 EKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIHWKKSDYANDDDEAVSELS 365

Query: 380 NVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTH 439
           N             + E LTG  AIRRSDRM+WMLTGSAVRLAQDMGF+E ++++ + TH
Sbjct: 366 N------------DEAEELTGTKAIRRSDRMAWMLTGSAVRLAQDMGFMETNAKVCVATH 413

Query: 440 ISETTSAMNMNQRSVLAESFSVLNLNLGRFXX---XXXXXXXXXXXXXRFYLDEILPNDE 496
           IS+  ++MNMNQ+ VL+ +F+VL      +                  + ++ ++L N  
Sbjct: 414 ISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSHESTCSEQAFMKQMLENTN 473

Query: 497 SKERWKKVLENLEAD-----SDNEKCV-LTDWEREFLNDEYVLYYSNKKDDTNLAQNHMP 550
           S  RW+ +L +L+ +       NE    L+D EREFLNDE++LYYS ++   N      P
Sbjct: 474 SHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYSLERRSDN---QETP 530

Query: 551 PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLS 610
           PFPL+FS+AQ+AKIE+  I+ + Y+TIY ++ ++KLA+ +Q HNLSVLS+ SPLMEGW +
Sbjct: 531 PFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASNNQLHNLSVLSILSPLMEGWHN 590

Query: 611 NYREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKIS 670
            Y+ +L+  S  P++   R +KR +      I+ ESII D+ Y QLYI+SLALQ D K +
Sbjct: 591 VYKNLLIAPSANPYTTTTRGDKRAMYELSKNIDSESIICDYRYSQLYIYSLALQADFKRA 650

Query: 671 RLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYL 730
            L +SEI ++AKYVE+A+ +AKEI+ SA RV +  +LKYMPVRWV+R++R+++F+VKC L
Sbjct: 651 ELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLLKYMPVRWVMRLVRAVSFLVKCCL 710

Query: 731 TLTGSEI----ATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAIL 786
            L  + I    ++  + R ILKL +ISV +T + I+  A+TLKEATPDELHL  RY+AIL
Sbjct: 711 ILNATSIGGGGSSEAEVRTILKLCSISVKDTANTIKMAAMTLKEATPDELHLSMRYSAIL 770

Query: 787 MYLCTEMKLRKKSHLERP----PTSRTGIAP-LKSSDESPLEGANLVKGPTFDKTAGTSN 841
           +YLC E++  K S  + P     T++  I+P  +  D     G+      T   TA    
Sbjct: 771 LYLCRELESEKDSSKKIPFPNNATTKYAISPTYEGRDGEIAAGSAGGCANTAHITANRLR 830

Query: 842 AECIFDPVGKXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEE 901
              + D                          N          A     + + G SL +E
Sbjct: 831 TVPLSDINETTGRNTEDTANNNIVNGSLNGDRNHLGTTEGTGAASQSTTDRLTG-SLPDE 889

Query: 902 VTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLF 946
           VT+WFS + +IGLEFVEPWT++IEQR++Q G G N+ FE LY  F
Sbjct: 890 VTNWFSGNAEIGLEFVEPWTDMIEQRFLQSGTG-NDVFEELYQYF 933

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
           similar to uniprot|Q04052 Saccharomyces cerevisiae
           YDR421W ARO80 Zinc finger transcriptional activator of
           the Zn2Cys6 family activates transcription of aromatic
           amino acid catabolic genes in the presence of aromatic
           amino acids
          Length = 945

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/801 (46%), Positives = 516/801 (64%), Gaps = 34/801 (4%)

Query: 17  GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS-SNR 75
           G+   T P     +R Y+AC+NC+ RKVKCDLGP DNPH PPC RCKRE + C+F+ + R
Sbjct: 5   GNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKR 64

Query: 76  EAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGK-NTDNETL--FKSEGMK 132
                   S++++  +SA          D+++S      L  + +TD + L     + + 
Sbjct: 65  GGFRVAKQSLVSLKEESAGKSMA-----DVITSVIQGQTLKKELDTDLDRLQTHTKDDIS 119

Query: 133 WKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDE-GLKP 191
              +  ++QN   FLA+AAG+VAKE  ++ + D +T       +   S QPS    G K 
Sbjct: 120 INTDPPTLQNAFYFLAKAAGSVAKEDLRDQV-DAATKYDEIEPTDAVSRQPSVSSYGNKQ 178

Query: 192 LSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPAN 251
            + S+  +S      +                  LIE++  VRP P+ K+ D EYIGP  
Sbjct: 179 ATGSMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLSSVRPKPSMKLGDIEYIGPYQ 238

Query: 252 LLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGL 311
           LLT+ EA + I+AFFLTMHPF P IP QL D  ELA+YP+L C ILT+SARYH    LGL
Sbjct: 239 LLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISARYHTLHDLGL 298

Query: 312 DNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSD 371
           +  +N T HVE+H++LW+YCQ+L+SQT+WAEASTRSIGT+LAF+IFTEWNPR+IH K SD
Sbjct: 299 NEIDN-TVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWNPRAIHWKGSD 357

Query: 372 YANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENS 431
           YAN P+++++  R     +  +  + LTG+ A+RRSDRMSW+LTG+AVRLAQD+  IE S
Sbjct: 358 YANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRLAQDLNVIEFS 417

Query: 432 SRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEI 491
           S+IF++THI ET +AMN+N+RS L+ES S + LN                   +F+L+ I
Sbjct: 418 SKIFVMTHICETHTAMNLNKRSSLSESLSEVRLN---------GFEDNDLDNEQFFLERI 468

Query: 492 LPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPP 551
           L ND+SKERW + LE +   S  +K  LTD EREFLNDEY+LY+ N ++    +    P 
Sbjct: 469 LQNDKSKERWARFLERVGERS--KKGSLTDIEREFLNDEYLLYHYNTENPNTQSD---PE 523

Query: 552 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSN 611
           F L+FS  QR K+E+++I+S+ YE +Y      KL++ D+   LS+LSV SPL+EGW + 
Sbjct: 524 FRLKFSKIQRGKVELLKIVSLGYENVY----NGKLSSHDRHQRLSMLSVLSPLIEGWYNI 579

Query: 612 YREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGK--- 668
           Y+ +LVP      S+A   NK  V    +++  ES+I+D+ YCQLYI+SLALQ D +   
Sbjct: 580 YKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQLYIYSLALQWDHQDTS 639

Query: 669 ISRLNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKC 728
            S+L ++EI KSA+YVELAY +AKEIL+SA+RV +  MLKYMPVRWV+RI+RSI F++KC
Sbjct: 640 TSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMPVRWVMRIVRSIVFMIKC 699

Query: 729 YLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMY 788
           YLTLTG+ I  NP+A  IL +S +  DE    I+ TA+ L+ A PDELHLC RY+ ILMY
Sbjct: 700 YLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILRAAAPDELHLCSRYSTILMY 759

Query: 789 LCTEMKLRKKSHLERPPTSRT 809
           LCTEMK R K +++ PP  R+
Sbjct: 760 LCTEMKHRCKPNMQ-PPVPRS 779

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 37/52 (71%), Gaps = 2/52 (3%)

Query: 895 GPSLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLYNLF 946
           G  L  ++ DWF+ + +IGL+FV PWTE++E++++     D++++EN +N F
Sbjct: 891 GGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFV--NKVDDSSYENWFNDF 940

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/933 (41%), Positives = 545/933 (58%), Gaps = 118/933 (12%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF--SSNREAMHTLSPSM 85
           K RR Y+AC+NCRSRK +CDLGP D+P  PPC RCKRE K C+F  +S R     +  ++
Sbjct: 16  KYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGGRKRIEWTV 75

Query: 86  INITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLE 145
              T  +A+++ E         +    +P++   T  +T    EG     EL+SM N LE
Sbjct: 76  DGNTDVNATARFE---------AEDKYIPVA---TLKDTTSIKEG-SLTPELNSMHNALE 122

Query: 146 FLAQAAGTVAKEGAKEIIKD-ESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNT 204
           FLA+AAG+ AKE ++  I   E    T    + H    P+          S S  +   T
Sbjct: 123 FLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREESPNQHA-------SGSKRASLAT 175

Query: 205 PIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEA 264
           P                   +LIE++   +P     + D EYIG   LLT++EA  LI+ 
Sbjct: 176 P------------------GKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDL 217

Query: 265 FFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVH 324
           FFL MHPFFP IPFQL   +EL +YPIL CAILT+SARYH F    +  GE  +R++EVH
Sbjct: 218 FFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEVH 277

Query: 325 DKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVR 384
           D+LW+YCQ+LISQ++WAEASTRS+GT+LAF++FTEWNPR+IH  W+DYAND  L++++ R
Sbjct: 278 DRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDISRR 337

Query: 385 GGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETT 444
                  R D   LTG+GA+RRSDRM+WMLTG+AVRLAQDMGF+ NS +IF   HI+ET 
Sbjct: 338 DYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALHITETQ 397

Query: 445 SAMNMNQRSVLAESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILPNDESKERWKKV 504
           +AMNMNQRS+L++S + ++LN                      ++EI  N++SK RWK  
Sbjct: 398 TAMNMNQRSILSQSLAEVSLN----------GHDGDSGLSSACIEEIFRNEDSKRRWKSY 447

Query: 505 LENLEADSDNEKCV-LTDWEREFLNDEYVLYYSNK----KDDTNLAQNHMPPF----PLR 555
            +  + DS   K V   D E+EFL DEY  +++      +D +NL  +          L 
Sbjct: 448 TQ--QRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLL 505

Query: 556 FSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREV 615
           F+  QRAK+E++RI+SI YE IY +    KL   D +H L+VL + +P+++GW + Y+ +
Sbjct: 506 FTPRQRAKVELLRIMSIGYEAIYYKDT--KLTLIDHKHKLAVLGILAPMIKGWHNTYKHL 563

Query: 616 LVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDG---KISRL 672
           LVP +         +NK    +   +I+ ES+I+D+ YCQLYI+SLALQ++    K  + 
Sbjct: 564 LVPFAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKP 623

Query: 673 NMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTL 732
           N++E+ KSAKYVELAY +AKE+L SA RV +   LKYMPVRW  RIIR++AF+V+CY+TL
Sbjct: 624 NINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMTL 683

Query: 733 TGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTE 792
           TGS + ++P A  IL +  IS +E  ++I+  A+TL+EA+PDELHLC R++ +LM+LCTE
Sbjct: 684 TGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFLCTE 743

Query: 793 MKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGKX 852
           MK ++ S  +     R+    L +  ++P       + PT   T   + A   F      
Sbjct: 744 MKRKQHSEPQNSELRRSSSHSLHNPTDAP------ARMPT---TPAENYAATDF------ 788

Query: 853 XXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPS-LSEEVTDWFSASED 911
                               + +F+E  +              PS L  E+ DWF  S+D
Sbjct: 789 -------------------AIPAFLETPH--------------PSHLPSELEDWFCTSDD 815

Query: 912 IGLEFVEPWTELIEQRYMQCGDGDNNNFENLYN 944
           +GL+FVEPW E++EQ+++   +  N  FENLYN
Sbjct: 816 VGLDFVEPWAEMLEQQFI--NNDKNMTFENLYN 846

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/931 (41%), Positives = 532/931 (57%), Gaps = 84/931 (9%)

Query: 17  GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
           GS  N   +  K +R+++AC  CR RK+KC+LGP+DNPH PPC RCKRE + C+F     
Sbjct: 2   GSKSNRTSS-KKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 77  AMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLE 136
              +LSP  IN          + G  N L           G N         E   W+ +
Sbjct: 61  KSRSLSPKDINY--------GDDGDDNKLKFIHYQQGDNKGANNKEIQNMALEDSAWESD 112

Query: 137 LSSMQNTLEFLAQAAGTVAK-EGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRS 195
           +SSMQN LE+LA AA +V++ E  K      ++  +  VNS         D   + + + 
Sbjct: 113 VSSMQNALEYLASAAKSVSQFENHKP-----TSKLSDMVNSYSKD-----DMTQENIIKE 162

Query: 196 LSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTK 255
           L   ++   P                  S LI ++ ++R  P +K+ D  YIG   LLT+
Sbjct: 163 LFEKTELKNP-----------------ASSLIAQLSRIRTKPHKKLSDIVYIGDDKLLTE 205

Query: 256 EEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGE 315
           EEA  LIE FF  +HPFFP IP QLH+P++L +YPIL CA++T+SARY+ F  L L   E
Sbjct: 206 EEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITISARYNNFGDLDLKTRE 265

Query: 316 NGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYAND 375
           +   ++ +H+KLW+YCQ+LIS+TIWAEASTRSIGT+LAF++FTEWNPR+IH  WSDYAND
Sbjct: 266 SPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTEWNPRAIHWNWSDYAND 325

Query: 376 PELNNVN-VRGGKHINTRRDEEGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRI 434
            E  N N +     IN+ +  E +TG  A+R SDRM+WMLTGSAVRLAQDM FI+ S++I
Sbjct: 326 SETINFNELNEFDPINSYKG-ESITGFEAMRHSDRMAWMLTGSAVRLAQDMKFIDTSNKI 384

Query: 435 FIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRF---XXXXXXXXXXXXXXXRFYLDEI 491
           F+ THI+ET +AMN+N RS L+ES S +N++  +                   ++YL++I
Sbjct: 385 FLATHIAETYNAMNVNLRSSLSESLSNVNIHSKKIDPVKIIDGKKSERYFGNEKYYLEQI 444

Query: 492 LPNDESKERWKKVLENLEADSDNEKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPP 551
             N + +E    +LEN+  +  N K    D ER+FLNDEY+L+YSN  D T   QN    
Sbjct: 445 FKNAKDRESSYDLLENILRERRNAKA-FPDNERDFLNDEYILFYSNPDDAT---QNDELD 500

Query: 552 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSN 611
            PL F+  QRAKIE+++I+SI YETIY EK +R     +Q+ NL++L++FS L++ W  N
Sbjct: 501 TPLDFTVIQRAKIELLKIMSIGYETIYLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVN 560

Query: 612 YREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 671
           Y E+L P   +   L   K   Q +  I  I  ES+I D+ YCQLYI+SL+LQV+ + S+
Sbjct: 561 YNELLSPEETLDPVLNASKMGLQSMTQI--IENESLICDYYYCQLYIYSLSLQVEDEESK 618

Query: 672 LNMSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLT 731
           L + E+ +SAKYV +AY SAKEIL+SAKR+    MLK++PVRWVIRI+R+I+FIVKCY+T
Sbjct: 619 LKLKELSQSAKYVSIAYSSAKEILNSAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCYVT 678

Query: 732 LTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCT 791
            T  +     +  ++L LS I VDE+ +LI   AV LKE+TPDELHLC RY+ IL+ L  
Sbjct: 679 ATDKDSMNYKELNSLLSLSGIPVDESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYR 738

Query: 792 EMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFDPVGK 851
           E+K+     L           P + + ++ LE A   +      T   S ++    P+  
Sbjct: 739 ELKM---DTLSTQQAHGNDSMPERLTADTTLENAIRTEF----TTTSNSGSQVELTPLSN 791

Query: 852 XXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASED 911
                            F T +  +   + DI                            
Sbjct: 792 KLATLPIDRNTTPPYASFPTEVVDWFSTSADI---------------------------- 823

Query: 912 IGLEFVEPWTELIEQRYMQCGDGDNNNFENL 942
            GLEFVEPWTE+IEQRY++ G+  N +F++L
Sbjct: 824 -GLEFVEPWTEMIEQRYIKSGNTQNKDFDDL 853

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
           Anc_5.525 YDR421W
          Length = 1018

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/836 (43%), Positives = 510/836 (61%), Gaps = 86/836 (10%)

Query: 14  TKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73
           +KR S + +     + RR+Y+ACINCR +KVKCDLGP++NPH+PPC RCKRE + C+F  
Sbjct: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68

Query: 74  NREAMHTLSPSMINITSKSASSKSEQGVPN----------DLMSSTPSDMPLSGKNTDNE 123
             + + T       + +++ S    Q VPN          D++    S +  + ++  N 
Sbjct: 69  PLKKLGT-------VENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNN 121

Query: 124 TLFKSEGMK-----------WKLELSSMQNTLEFLAQAAGTVAKEGA------------K 160
            +  S+  +            K+  ++M+N LEFLA AAG  A+E              K
Sbjct: 122 DISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFEK 181

Query: 161 EIIKDESTTTTPFVNSLHSSCQPS----TDEGLKPLSRSLSAASDTNTPIEXXXXXXXXX 216
           E+  D  +  +P   S  S+        +DE +  L     + ++TN             
Sbjct: 182 ELNDDHISIDSPATQSTTSTDSVKHLDLSDESIASL---FLSENETN------------- 225

Query: 217 XXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNI 276
                  + LIE +   RPI  RK+ D++YIG + ++++ EAI+LI AFFLTMHPF+P +
Sbjct: 226 ---RKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYL 282

Query: 277 PFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLIS 336
           P QL DP ELA+YPIL C ILT+S+R+H F+ LG  NG N  RH++VH+KLWVYCQK+IS
Sbjct: 283 PDQLQDPHELARYPILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMIS 342

Query: 337 QTIWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEE 396
           QT+WAEASTRS+GTVLAF++FTEWNPR+IH KW+DYAN+P+LN+ +       +  +  +
Sbjct: 343 QTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGK 402

Query: 397 GLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLA 456
             TG+GAIRRSDRM+WML G++VR+AQDMGFIENSS +F+ TH SET  AMN+ QRS L 
Sbjct: 403 RTTGLGAIRRSDRMAWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLN 462

Query: 457 ESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILP-NDESKER--WKKVL-ENLEADS 512
           ES +    + GR                 FY++ I   N +  ER  WK  L EN+E   
Sbjct: 463 ESLNDTYYSQGRMSSYRNKQQQTLKNEI-FYIENIFSENFKITERNYWKSQLQENIENKI 521

Query: 513 D-NEKCVLTDWEREFLNDEYVLYYSNKKDDT-NLAQNHMP-------PFPLRFSFAQRAK 563
           D ++K  L+D  R FLNDE+ L+YSN  D T +  +N+ P       P P+  S +Q+A 
Sbjct: 522 DIDDKIALSDKVRGFLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQAN 581

Query: 564 IEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDV- 622
           IE++RI S AY+TIY     +KL++ +Q HN+S+L +F+PL+  W   + ++L P SDV 
Sbjct: 582 IELLRIFSTAYKTIYSRNQNQKLSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQP-SDVC 640

Query: 623 -PFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQV--DGKISRLNMSEIVK 679
            P +L +R NKR V      I GES+I D+NYCQLYIFSLALQ+  DG+I  L ++EI K
Sbjct: 641 EPINLNNRNNKRVVKEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEI--LTVNEITK 698

Query: 680 SAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGS--EI 737
           S+ Y+ LAY+SAKE + S +RV    MLKYMPVRW+ R+IR+ AF+VKCYL++ G+  E+
Sbjct: 699 SSTYINLAYQSAKEYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQEL 758

Query: 738 ATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEM 793
            +  +   I KL   S +E  +LI+ +A+ L  ++PDELHLC RY++I+M    EM
Sbjct: 759 NSISEINMIFKLGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)

Query: 897  SLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 941
            S + E  DWFSAS DIGLEFVE WTE++EQRYM+  D DN  F N
Sbjct: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK--DDDNLLFNN 1018

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/985 (37%), Positives = 551/985 (55%), Gaps = 125/985 (12%)

Query: 12  STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           STT  G S ++     K + T+ AC+ C+ +K+KCDLGP D P +PPCA C+R    C F
Sbjct: 16  STTPVGGSSSSQGQ--KHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFF 73

Query: 72  SSNREAMHTLS------------------PSMIN-ITSKSASSKSEQGVPNDLMSSTPSD 112
           ++ +  +  L                    SM+N IT    + ++  G  N  +++  + 
Sbjct: 74  NAPKVKIGKLGNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNL 133

Query: 113 MPLSGKNTDNETL-------------FKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGA 159
           + L  +N +  +L              KS+   WKLEL+SMQ+ LEFLA+A         
Sbjct: 134 VGLKNQNLEGVSLNSPNTALIEACDRVKSD-TAWKLELTSMQSALEFLAKATK------- 185

Query: 160 KEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTPIEXXXXXXXXXXXX 219
              ++++     PF  S  S    +T E     +R LS   + N                
Sbjct: 186 ---LRNDYKNNEPF-GSTRSDAASTTSE-----TRDLSEKDNGNESDSTTNSTSKDTSTR 236

Query: 220 XXXXSQLIEEIGKVRP-IPTRKIEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPF 278
               S     I  ++P +PT    +++ +G   L+T +EA  L+  FF  MHPF+P IP 
Sbjct: 237 SSYPS-----IEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPL 291

Query: 279 QLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQT 338
            L D  EL +YP+L   IL +SARY+PFD +G DNG  G R+V +H+KLW +CQ+L+SQT
Sbjct: 292 HLQDFDELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQT 351

Query: 339 IWAEASTRSIGTVLAFIIFTEWNPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGL 398
           +W++ASTRSIGT LAF++FTEWNPR+IH + SD A+    NNV+       +++ D +GL
Sbjct: 352 VWSQASTRSIGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDNNVS-------SSKEDPDGL 404

Query: 399 TGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAES 458
            G+  ++RSDRM+WM TG+A+RLAQ+M  +EN+++I+   +I+E   A NMN +  L ES
Sbjct: 405 GGIATVKRSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGES 464

Query: 459 FSVLNLNLGRFXXXXXXXXXXXXXXXRF-YLDEILPNDESKERW---KKVLENLEADSDN 514
              ++  +  F                  ++  +  N ES ++W   K   + L+ ++ +
Sbjct: 465 LVSIDGGMKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKWAIHKAYSDKLKEENPD 524

Query: 515 EKCVLTDWEREFLNDEYVLYYSNKKDDTNLAQNHMPPFPLRFSFAQRAKIEIIRILSIAY 574
              ++ D E EFLNDEY + Y +  ++++  +N     P+ ++  Q+A++E++RI++I Y
Sbjct: 525 ---LIIDLETEFLNDEYSINYLD--ENSSFLKN-----PIPYTTYQKAQLELLRIVTITY 574

Query: 575 ETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSD---VPFSLADRKN 631
           +TIY EK K+++++ DQ+ NL +L V SP++  W  NY +++ P+SD   V  SL D   
Sbjct: 575 QTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSK 634

Query: 632 KRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISRLNMSEIVKSAKYVELAYKSA 691
            ++  N    I GES I+D+ YCQLY FSLALQV+ K S+L ++E++KSA++VE AY++A
Sbjct: 635 FKRTAN----IRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAA 690

Query: 692 KEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGSEIATNPDARNILKLSA 751
           KEIL SA RV +  MLKYMPVRWV+RI+RS +FIVKCY+TL    +ATN +A++ILKLS 
Sbjct: 691 KEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNSEAKSILKLSG 750

Query: 752 ISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMKLRKKSHLERPPTSRTGI 811
           I VD+T  +IR  AV LKE+TPDELHL  +++ ILM+LC E+  RK+             
Sbjct: 751 ILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKR------------- 797

Query: 812 APLKSSDESPLEGANLVKGPTFD------KTAGTSNAECIFDPVGK---XXXXXXXXXXX 862
                 +E+ + G  L   P+ +      ++   SN + I     +              
Sbjct: 798 -----DNENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQ 852

Query: 863 XXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFSASEDIGLEFVEPWTE 922
                  K G NS +++    TA            L E+V DWFSAS +IGL+FVEPWTE
Sbjct: 853 GTANSTRKVGPNS-IDEIGQFTAY-----------LPEDVIDWFSASNNIGLDFVEPWTE 900

Query: 923 LIEQRYMQCGDGDNNNFENLYNLFA 947
           LIEQ+Y+Q  DG   +F+ L++ FA
Sbjct: 901 LIEQKYIQNKDG-FQDFDQLFDEFA 924

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/996 (38%), Positives = 522/996 (52%), Gaps = 155/996 (15%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF-------------SSN 74
           K RR Y+AC+NCR+RKV+CDLGPVD P  PPC RC RE K C+F             + N
Sbjct: 24  KWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTELRRGRNRRIRVAKN 83

Query: 75  REAMHTLSPSMINITSK----SASSKSEQGVPNDL-MSSTPSDMPLSGKNTDNETLFKSE 129
             A H      I + +     S+++    G P  L   S PS    S +  D+++    E
Sbjct: 84  DRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGRDDQSSNSDE 143

Query: 130 G-------MKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDES----------TTTTP 172
                   +    E +++ NTLEFL +AAG+VAK+  + +    +          + T  
Sbjct: 144 PEFSERPELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLLSSSTAVGKHSAAICESITLQ 203

Query: 173 FVNSLHSSCQPSTDEGLKPLSRSLSAASDTNTPIEXXXXXXXXXXXXXXXXSQLIEEIGK 232
             N LH+    S   G +        A+ + TP E                    E    
Sbjct: 204 LYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQE--------------------EPEST 243

Query: 233 VRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPIL 292
             P+    + + EY+GP N LT EE I L E FF+T +PFFP+IP  + DP+ELA+YPIL
Sbjct: 244 KYPL----LRNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELARYPIL 299

Query: 293 FCAILTVSARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTVL 352
            C +L++SARYH F+ +GL N  + TR+++VH+ LW YCQ++ISQT+W EASTRSIGTVL
Sbjct: 300 LCGVLSISARYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSIGTVL 359

Query: 353 AFIIFTEWNPRSIHCKWSDYANDPELNNVNVRGGK----HIN-----TRRD--------E 395
            F+IFTEWNPR+IH K +DYAN  +  N      K    H       T R+        +
Sbjct: 360 VFLIFTEWNPRAIHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRRFVLAD 419

Query: 396 EGLTGVGAIRRSDRMSWMLTGSAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVL 455
           +G +G+ A+RRS RM+WML G+AVRLAQDM FI  SS+IF+ TH SET  AMNM Q S L
Sbjct: 420 QGSSGLSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQNSTL 479

Query: 456 AESFSVLNLNLGRFXXXXXXXXXXXXXXXRFYLDEILPNDESKERWKKVLENLEADSDNE 515
             S S++N N+                      +  +P+ E++ER+K VL+ L       
Sbjct: 480 --SHSLMNANI------------IGSESSTAISNPPMPS-ETEERYKSVLQRLGKHVPRG 524

Query: 516 KCVLTDWEREFLNDEYVLY-----------YSNKKDDTN-------------LAQNHMPP 551
           +  L+    EFL DE +LY           Y +  D T              L +     
Sbjct: 525 RG-LSQLYNEFLEDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSLLERGGQQV 583

Query: 552 FPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSN 611
           F    SFAQRAKIE++RI+S+ YETIY   N  KL   ++ H LSVL + SP +E W + 
Sbjct: 584 F---LSFAQRAKIELLRIMSVGYETIY--SNHAKLVLREKHHILSVLGLLSPQIENWYTQ 638

Query: 612 YREVLVPLSDVPFSLADRKNKRQVLNNIDRINGESIITDFNYCQLYIFSLALQVDGKISR 671
           Y  +LVP    PF+     ++   L+ + RI+ ESII D+ YCQLYI+SLAL VD +  R
Sbjct: 639 YNSLLVPAGGAPFNPTADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTVDFRKPR 698

Query: 672 LN----MSEIVKSAKYVELAYKSAKEILSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVK 727
                 +  ++KSA+YVELAY +A+E+L SA RV R  MLKYMP RWV RI+ ++AFIVK
Sbjct: 699 HPNASWLDRLMKSARYVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGAVAFIVK 758

Query: 728 CYLTLTGSEIATNPDARNILKLSAISVDETFDLIRDTAVTLKEATPDELHLCQRYAAILM 787
           CYLT+     A++ +A  IL LSAI  DE  + I+  A+TL+EA+PD++HLC +Y+ ILM
Sbjct: 759 CYLTMAAHLTASH-EASAILTLSAIPPDEVVNTIQRAAITLREASPDDVHLCNKYSTILM 817

Query: 788 YLCTEMKLRKKSHLERPPTSRTGIAPLKSSDESPLEGANLVKGPTFDKTAGTSNAECIFD 847
           YLC+EMKLR       PP  R+                  ++ P F+ +A  + A  IF 
Sbjct: 818 YLCSEMKLRNWP-TPTPPLPRS-------------VSGEPIRVPVFECSA--TPAARIFS 861

Query: 848 PVGKXXXXXXXXXXXXXXXXPFKTGLNSFVEQTNDITAMLLNNELIQGPSLSEEVTDWFS 907
           P                          S      D T+            L  E+ DW  
Sbjct: 862 PPHHPAESQTTGGTDPPPLPDHTLAAPSSDPAPFDTTS-----------HLPWELIDWLH 910

Query: 908 ASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFENLY 943
            S++IGL+FVEPWT++IE R M+ G  DN +  +LY
Sbjct: 911 TSDEIGLDFVEPWTDVIE-RLMESGP-DNIDTNSLY 944

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 13/101 (12%)

Query: 7   TVPFMSTTKRGSS-----ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCAR 61
           T+P ++++++ S+     +N +   P +RR  +AC NCR RK+KCD   +D P    C+ 
Sbjct: 129 TIPKLTSSEKNSNKPTSNDNFISQHPYKRRVVKACYNCRRRKIKCD--AID-PSKNKCSN 185

Query: 62  CKRELKRCLFSSNREAMHTLSPSMINITSKSASSKSEQGVP 102
           C +  K C FS N E       +  NI+  S ++K ++  P
Sbjct: 186 CLKLNKICSFSENDEI-----NTPFNISHNSTNNKKQKSNP 221

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          P+R +T+  C  CRSRKVKCDLG       P C RC+R    C
Sbjct: 11 PRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 6/43 (13%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          P+R +T+  C  CRSRKVKCDL        P C+RC+R   +C
Sbjct: 3  PRRAKTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {ON}
           Anc_2.654
          Length = 902

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 73/173 (42%), Gaps = 20/173 (11%)

Query: 21  NTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHT 80
           NT P+  KRR    ACI CR R +KC  G        PCARC +   +C +    + +  
Sbjct: 15  NTEPS-SKRRPKSLACILCRKRHIKCSGG-------NPCARCIKHDLKCEYIEPSKKIVV 66

Query: 81  LSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFK---SEGMKWKLEL 137
               +  +    A+ K E      L+S + +  PL GK+ DN TL     +EG   +L L
Sbjct: 67  SLKYLQQLQDSLANMKRENVRLQSLVSRSKTGSPLQGKD-DNATLKDENTNEGASRRLPL 125

Query: 138 SSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLK 190
           +        L Q +  +  E     ++D   T T     L+++   ST   +K
Sbjct: 126 TG-------LLQESSQMT-EFNNNTVEDRQKTGTAITKKLNTNENGSTSSNMK 170

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {ON} 
          Length = 860

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 49/107 (45%), Gaps = 7/107 (6%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           +++R    C+ CRSRK+KCD         P C RCK++ K C + S   +  T+     N
Sbjct: 7   RKQRPSYVCLECRSRKLKCD------KARPYCNRCKKDGKVCAYESENASQITIPDDSSN 60

Query: 88  ITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWK 134
            T K ++S ++     +    + S +     N  N T+F  E  K K
Sbjct: 61  HTLKLSTSFTDISTDGNSNIDSGSTLTFHSHNLGN-TVFDLEYFKHK 106

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 17  GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           GS+ N   T  KR +  +AC  CR +K+KCD     N     C+ C+R  ++C F
Sbjct: 72  GSNTNNTTTVKKRTKASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTF 122

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 15 KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          KR SS        +R +T+  C  CRSRKVKCDLG       P C RC +    C
Sbjct: 2  KRQSSAGGKAKEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 1  MVAFNTTVPFMSTTKRGSSENTVPT------FPKRRRTYQACINCRSRKVKCDLGPVDNP 54
          MV FNT +  +S           PT      + KR+R   ACI C S K KC    ++N 
Sbjct: 1  MVVFNTGLTNISGVDSDDVRLLKPTAIDPDLWQKRKRNTVACITCHSSKQKCVPSDLNNI 60

Query: 55 HAPPCARCKRELKRCLFSSNREAMHTLSP 83
             PC RC +  ++C F  ++   +  +P
Sbjct: 61 FWKPCIRCLKSKRQCTFDLSKRTRNRRTP 89

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query: 19  SENTVPTFP------KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
           +EN   TF       K +RT   CI C+S+K++C      N   P C+RC+R  K C + 
Sbjct: 12  TENCTYTFAMAGKSQKSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHCHYG 65

Query: 73  SNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSD 112
           ++ + + T +  +++  + S ++ S Q +P+  ++  PSD
Sbjct: 66  AHTQIL-TPAEELLDNGTISLTNTSSQ-LPSFYLTPRPSD 103

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          P+R +T+  C  CRSRKVKCDL        P C RC +    C
Sbjct: 12 PRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 51/121 (42%), Gaps = 21/121 (17%)

Query: 1   MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA 60
           M A   T   + T+   S EN       R R  +AC  C+ RKVKCD          PC 
Sbjct: 56  MTAIGNTDDALDTSTAASKENG----KGRLRVQKACELCKKRKVKCDGN-------NPCL 104

Query: 61  RCKRELKRCLF---SSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSST------PS 111
            C +  K C +   ++NR+       S +   SK+ +  SE   P DL+S +      PS
Sbjct: 105 NCSKHQKECRYDFKATNRKRRRRQVASAVRDVSKTYAETSE-SFPRDLLSKSNIIINAPS 163

Query: 112 D 112
           D
Sbjct: 164 D 164

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 23 VPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          V   P+R +T+  C  CRSRKVKCDL        P C RC++    C
Sbjct: 10 VKARPRRAKTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 14/134 (10%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS-NREAMHTLSPSMI 86
           KRRR  +AC  CR +KVKCD          PC  C      C +    +   ++ +  M+
Sbjct: 13  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNSGML 65

Query: 87  NITSKSASSKSEQGV-----PNDLMSST-PSDMPLSGKNTDNETLFKSEGMKWKLELSSM 140
            + +    S S         PN L+SS  P   PL G +T   +   S+  ++K + + +
Sbjct: 66  ALGNAVGPSSSVVVATATLNPNKLLSSVKPEKSPLPGSSTIPGSSNMSKPRRYKTKSTRL 125

Query: 141 QNTLEFLAQAAGTV 154
           Q+T++   Q    V
Sbjct: 126 QSTIDKYKQVLDEV 139

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
          YML099C (ARG81) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          336] FULL
          Length = 841

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +R +T+  C  CRSRKVKCDLG       P C RC++    C
Sbjct: 15 RRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLEC 50

>YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON}
           WAR1Homodimeric Zn2Cys6 zinc finger transcription
           factor; binds to a weak acid response element to induce
           transcription of PDR12 and FUN34, encoding an acid
           transporter and a putative ammonia transporter,
           respectively
          Length = 944

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 86/192 (44%), Gaps = 33/192 (17%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS----SNREAMHTLSP 83
           K +R   AC+ C S K KC+   V++ +  PC RC +  K C F     + +    + SP
Sbjct: 68  KTKRNSFACVCCHSLKQKCEPSDVNDIYRKPCRRCLKHKKLCKFDLSKRTRKRKPRSRSP 127

Query: 84  S-----MINITSKS-ASSKSEQGVPND---LMSSTPSDMPLSGKNTDNETLFKSEGMKWK 134
           +     M+N+++KS   + SE+    D    ++S PSD P + +  ++ T+         
Sbjct: 128 TPFESPMVNVSTKSKGPTDSEESSLKDGTSYLASFPSD-PNAKQFPNSRTV--------- 177

Query: 135 LELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSR 194
             L  +Q +L  L          GA+E    E+T+T     + H+        G  P + 
Sbjct: 178 --LPGLQQSLSDLWSTLSQPPSYGAREA---ETTSTGEITTNNHTKSN-----GSVPTNP 227

Query: 195 SLSAASDTNTPI 206
           ++ A++D +T I
Sbjct: 228 AVLASNDEHTNI 239

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W
          Length = 657

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 73/189 (38%), Gaps = 36/189 (19%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           KR R    C+NCR RK KCD G       P C+ C +  + C++S +             
Sbjct: 13  KRHRPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVYSED------------- 53

Query: 88  ITSKSASSK------SEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQ 141
            T ++AS K       + G+P + ++  P  + L  K +   + F   G+   + +    
Sbjct: 54  -TDENASKKVRYEYMDDLGLP-EFINMAPKGLHLLSKRS--ASWF--NGLFSDIAICDRD 107

Query: 142 NTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSL-----HSSCQPSTDEGLKPLSRSL 196
             L         + K  +K I + E  T     NSL     ++  + S D+    ++R  
Sbjct: 108 PYLRITNAVIDILRKSASKGIDRSERDTVLQLPNSLKTVTMYNRSEKSEDQLYHQIAREF 167

Query: 197 SAASDTNTP 205
           SA      P
Sbjct: 168 SALRSAPIP 176

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 57/135 (42%), Gaps = 20/135 (14%)

Query: 1   MVAFNTTVPFMST-TKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPC 59
           +   N+  P +S  T+  SSE     + KR+R   ACI+C + K KC    +D+    PC
Sbjct: 36  ITGVNSDDPRLSVPTRINSSE-----WEKRKRNTFACISCHASKQKCVPSDLDDIFLKPC 90

Query: 60  ARCKRELKRCLFSSNREA-----------MHTLSPSMINITSKSASSKSEQGVP---NDL 105
            RC R  K C F  ++              H+ S   ++   K +S   +  +      L
Sbjct: 91  QRCFRSKKICAFDLSKRTRKRKSRSIGPLKHSASSEEVSNQVKISSQSMQHSITLQDQSL 150

Query: 106 MSSTPSDMPLSGKNT 120
           M    +++P S +N 
Sbjct: 151 MKQNLANIPYSNQNV 165

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 6/42 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          KR +T+  C  CRSRKVKCDL        P C RC++    C
Sbjct: 20 KRAKTFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 6/46 (13%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73
          KRR+  +AC+ CR RK+KCDL        P C +C      C++++
Sbjct: 6  KRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIYTN 45

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 8/118 (6%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
           ++R  +AC +CR RK++CD   VD P    C+ C +    C F    E +       + I
Sbjct: 129 KKRVSKACDHCRKRKIRCD--EVD-PQTDKCSNCVKFQSVCTFKHRDEILQ--KKRKLEI 183

Query: 89  TSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKL--ELSSMQNTL 144
               AS KS Q   N++ S   S +P +  N   E+      ++  +  ++S +QN L
Sbjct: 184 KQHLASEKSPQS-QNNVSSYASSSLPGNNDNGRFESFNSGASLESNIINKISGVQNNL 240

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON}
          Anc_8.879 YML099C
          Length = 882

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +R +T+  C  CR+RKVKCDL        P C RC+R   +C
Sbjct: 14 QRAKTFTGCWTCRARKVKCDLT------RPSCTRCERSGLKC 49

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 15  KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
           +  SS N     P ++R   AC +CR RK+KC  GP+ N     C+ C +    C F  +
Sbjct: 127 QYSSSSNGASVIPAKKRVSMACDHCRKRKIKC--GPI-NTVENKCSHCIKYNAECTF-QH 182

Query: 75  REAMH 79
           R+AM 
Sbjct: 183 RDAMQ 187

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON}
          Anc_8.879 YML099C
          Length = 1132

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          R RTY  C  CRSRK+KCD         P C RC +   +C
Sbjct: 9  RNRTYSGCWTCRSRKIKCD------QQKPQCKRCLKANLKC 43

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           +R T+ AC++C S KVKC    +D+ +  PC RC +  K C F
Sbjct: 116 KRNTF-ACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNGKVCTF 157

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.344
           YML076C
          Length = 903

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS---SNREAMHTLSPS 84
           K +R   AC+ C S K KC     ++ +  PC RC R+ K+C F      R+     S S
Sbjct: 51  KNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFDLSKRTRKRRRGNSNS 110

Query: 85  MINITSKSASSKSEQGVPNDLMSSTPSDMP 114
               ++ S+ S    G P  L S + + +P
Sbjct: 111 EREQSTLSSPSGPGSGTPPSLFSQSSNQVP 140

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 18/117 (15%)

Query: 26  FPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSM 85
           F K R +Y  C+ CR++K+KCD         P C RC +  ++C++  N         SM
Sbjct: 6   FRKIRPSY-VCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLDSLHENSM 58

Query: 86  INITSKSASSKSEQGVPNDLM----SSTPSDMPLS-------GKNTDNETLFKSEGM 131
            + ++   S  S  G  N  +     S+P  + L+       GK  DN  L+    M
Sbjct: 59  RSHSNNQISPASSSGHSNATLIENSISSPEALTLTLDTSRIKGKQADNLDLWDPRDM 115

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 6/36 (16%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          +R+++  C  CRSRKVKCDL      + P C RC R
Sbjct: 10 KRKSFNGCWTCRSRKVKCDL------NRPKCQRCDR 39

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
           {ON} 
          Length = 704

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           KR++  +AC  C  R++KCD     NP    C+ C++  ++CLF  NR  M    P+   
Sbjct: 36  KRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLF--NRIPMKR-GPAKGY 88

Query: 88  ITSKSASSKSEQGVPNDLMSSTP 110
           I S+  S      +   L S+ P
Sbjct: 89  IRSRKGSVTMSPRINVSLTSALP 111

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 25  TFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPS 84
           T+  ++R  +AC +CR RK+KCD  PVD P    C+ C +    C+F  NR+   T + +
Sbjct: 130 TYYSKKRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVF-DNRKRKATNANT 185

Query: 85  MINITSKSASSKSEQG 100
             N   K+ + KS + 
Sbjct: 186 NSNKLLKTMNPKSHES 201

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 44/107 (41%), Gaps = 16/107 (14%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS---------SNREAMH 79
           +RR  +AC +CR RK+KC  GP+ NP    C  C +    C F+          N  A  
Sbjct: 96  KRRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTFTHQPSNQKRQDNGGASQ 152

Query: 80  TLSPSMINITSK----SASSKSEQGVPNDLMSSTPSDMPLSGKNTDN 122
             + S IN+       S +   + G P    + +PS   L     DN
Sbjct: 153 GTAASHINVAQPESLVSIAEAQKVGKPRKNAAGSPSMQNLRNSQYDN 199

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 24 PTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPP--CARCKRELKRCLF-SSNR 75
          P   KR+   +AC+ CR RK+KCD     +P   P  C  C R    C+F +SNR
Sbjct: 15 PDSRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVFVASNR 69

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 56/139 (40%), Gaps = 20/139 (14%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF---------------- 71
           K +R   AC NC S+K KC    V + +  PC RC +  K C F                
Sbjct: 104 KPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRKLCKFDLSRRTRRRRRESDTS 163

Query: 72  ---SSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKS 128
                +R++   L+P+     ++  ++ S   +P   M+   +  P +   T+     +S
Sbjct: 164 VEAQGSRDSPQYLAPTADRPVAEPEAAHSALPLPPLSMARVAAPAPKAPTQTEAAAQGES 223

Query: 129 EGMKWKLELSSMQNTLEFL 147
           E  +     SS+Q  L+ L
Sbjct: 224 ESKRRHFR-SSLQRELQLL 241

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 31 RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +TY  C  CR+RKVKCDL        P C RC+R   +C
Sbjct: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584
          aa] {ON} 
          Length = 584

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 23 VPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTL 81
          V   P++R ++  C  C+ RK+KCD G       P C  C R  K C +   +EA +++
Sbjct: 4  VSGTPRKRYSHNGCKECKRRKIKCDEGK------PVCWHCDRLEKSCQYLQVKEAEYSV 56

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 850

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 25 TFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          T  KR +T+  C  CRSRKVKCDL        P C RC++    C
Sbjct: 29 TKSKRGKTFTGCWTCRSRKVKCDL------RRPHCQRCEKSGLVC 67

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 15 KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          K    ++ VP  P++     ACI CR R VKC       P+  PC RC +   +C +S
Sbjct: 22 KEEGHQDIVPPIPRKSN---ACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYS 69

>Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa]
           {ON} YBL066C (SEF1) - putative transcription factor
           [contig 33] FULL
          Length = 1046

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 12  STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
           S  K GS+E+   + P   R   +C +CR  K+KC+    DN  A PC+RC+R    C
Sbjct: 76  SQEKNGSAESKAVSVPTGHRPVTSCTHCRQHKIKCNAN--DNFPA-PCSRCERMGLHC 130

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNR 75
          PKR R   AC NCR +K KCD          PC  CK     C++S  R
Sbjct: 19 PKRLRVSHACDNCRLKKKKCD-------GQQPCKLCKNSENECIYSDRR 60

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
          KRR+  ++C+ CR RK+KCD         P C +CK R+L  CL++
Sbjct: 15 KRRKQIKSCMFCRKRKLKCDKA------KPMCGQCKERKLPDCLYT 54

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 12 STTKRGSSENTVPTFPK-RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          S +++  + N V T  + R +T+  C  CR RKVKCDLG       P C RC++    C
Sbjct: 21 SGSRKHKAGNGVCTARRPRAKTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON}
          [contig 161] FULL
          Length = 755

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 6  TTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRE 65
          TT P +ST   G+S   +   PKR R+   C  CR R+ KCD         P C  C + 
Sbjct: 5  TTQPAIST---GNSATALMLRPKRNRSRAGCFTCRLRRKKCDEA------RPKCGTCSKH 55

Query: 66 LKRCLF 71
          + +C++
Sbjct: 56 MLKCIW 61

>YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}
          YRM1Zn2-Cys6 zinc-finger transcription factor that
          activates genes involved in multidrug resistance;
          paralog of Yrr1p, acting on an overlapping set of
          target genes
          Length = 786

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 14 TKRGS-------SENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RE 65
          +KRGS       SE TV    KRR+  ++C  CR RK++CD         P C+ CK R 
Sbjct: 2  SKRGSLQDRASPSEETVKKAQKRRKPIKSCAFCRKRKLRCD------QQKPMCSTCKTRG 55

Query: 66 LKRCLFS 72
             CL++
Sbjct: 56 RSGCLYT 62

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 18  SSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREA 77
           ++E+ +   P ++R  +AC  CR RK+KCD     +     C+ C +    C FS+  + 
Sbjct: 85  NNESNILNHPPKKRASKACDLCRRRKIKCD---AFDDRLKKCSNCIKYHSECTFSNQNKR 141

Query: 78  MHTLSPSMINITSKSASSKSEQGVPNDLMSST 109
                  +I    +S  S+S+  + + LM ST
Sbjct: 142 ----KGDLIEKAEESKRSRSKADIASALMQST 169

>Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON}
          (12074..14566) [2493 nt, 831 aa]
          Length = 830

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 12 STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          S  +R  ++N   ++ KR +T+  C  CRSRK+KCDL        P C +C      C
Sbjct: 3  SKIERSQAKNNKNSY-KRIKTFTGCWTCRSRKIKCDLT------KPSCRKCTNSRIEC 53

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 7/73 (9%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           KRRR  +AC  CR +KVKCD          PC  C      C ++   +   + +P  I 
Sbjct: 7   KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRGGSCAPQTIT 59

Query: 88  ITSKSASSKSEQG 100
           +   + ++K  Q 
Sbjct: 60  VRKPAKTAKQLQA 72

>KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserved
          hypothetical protein
          Length = 631

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 6/43 (13%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          PKR+R+   C+ CR+R+ KCD       + P C  C+R   +C
Sbjct: 5  PKRKRSVHGCLTCRTRRKKCD------ENKPVCGGCERNFVQC 41

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 16/85 (18%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLS----- 82
           +R +  +AC+NCR +K KCD         P C +C+     C++   +   +++S     
Sbjct: 8   RRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVYLGEKADKNSISIPNSI 61

Query: 83  ----PSMIN-ITSKSASSKSEQGVP 102
               P  IN + SK  S KSE+  P
Sbjct: 62  LDTTPFDINHVGSKDNSCKSEEANP 86

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
           Anc_4.344 YML076C
          Length = 936

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 11/115 (9%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           K +R   AC+ C S K KC     ++ +  PC RC R+   C F  ++         M +
Sbjct: 46  KTKRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLSKRIRKKRKMGMAS 105

Query: 88  ITSKSASSKS------EQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLE 136
           I + + +S +         V ND++S++ S  P S +N+D    F  E  + K++
Sbjct: 106 IDNSAKTSPAVIDNSPSNSVVNDILSNS-SQTPPSVQNSD----FSVENKRTKID 155

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {ON}
           Anc_8.283 YLR098C
          Length = 664

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 85/199 (42%), Gaps = 41/199 (20%)

Query: 15  KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
           KR  S+   PT P RR    ACI CR R+ KCD+         PC+ C +   RC+F+  
Sbjct: 2   KRPVSDERKPT-PSRR---LACITCRQRRRKCDM-------QEPCSICIKFGTRCVFTGE 50

Query: 75  --REAMHTLSP--------SMINITSKSASSKSEQGVPNDLMSSTPSD---MPLSGKNTD 121
             R++ H+ S         +++  + +     + +    ++++S P D   +P + +   
Sbjct: 51  DLRKSRHSASYVKTLENRIALLESSFRRLKESTNEEEKMNIINSVPLDDISVPANNETGG 110

Query: 122 NETLFKSEGMKWKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSC 181
           N T  K +          + NT+ F +            ++ K +S+ T P  NS+    
Sbjct: 111 NGTYIKDQNY--------IDNTISFPSSTKS--------DLNKTKSSETFPTKNSVLPIT 154

Query: 182 QPSTD-EGLKPLSRSLSAA 199
           +P        PL+R+++ A
Sbjct: 155 KPDLPLRATSPLNRNMNHA 173

>NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON}
          Anc_2.547
          Length = 924

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 12/70 (17%)

Query: 11 MSTTKRGSSENTVPTFPK--------RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 62
          ++ T   S+ N  PT PK        R +  +AC  C  R+++C+   V N     CA C
Sbjct: 18 LNDTMNMSNSNNEPTSPKSLTETSKKRSKVSRACDQCHKRRIRCNYNKVTN----MCAGC 73

Query: 63 KRELKRCLFS 72
          KR  + CLF+
Sbjct: 74 KRIGEHCLFT 83

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 6/41 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          R +T+  C  CR RKVKCDLG       P C RC++    C
Sbjct: 37 RAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 11/63 (17%)

Query: 11 MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
          M    R S+E  +PT   +RR  +AC  CR  K KCD          PC+RC +E K C 
Sbjct: 1  MVNGSRSSAE--LPTI--KRRVSKACDACRKSKTKCD-------GERPCSRCLKENKLCT 49

Query: 71 FSS 73
          +S+
Sbjct: 50 YSN 52

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 17/100 (17%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
           ++R  +AC +CR RK++CD   VD P    C+ C +    C F    E +         +
Sbjct: 126 KKRVSKACDHCRKRKIRCD--EVD-PQTNKCSNCVKFQSACTFKHRDEILRKKR----KL 178

Query: 89  TSKSASSKSEQGV---PNDLMSSTPSDMPLSGKNTDNETL 125
            +K  S KS Q      N ++SS P+       NT NET 
Sbjct: 179 ETKQNSDKSPQAQSNGSNHVISSMPN-------NTANETF 211

>Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {ON}
           YML076C (REAL)
          Length = 939

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 14/92 (15%)

Query: 10  FMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
           F   TK  ++EN      K +R   AC+ C S K KC+    ++ +  PC RC +  K C
Sbjct: 54  FTYPTKLETTENG-----KIKRNSFACVCCHSLKQKCEPSDTNDIYRKPCQRCLKHKKLC 108

Query: 70  LFS----SNREAMHTLSPS-----MINITSKS 92
            F     + +    + SP+     M+NI++KS
Sbjct: 109 KFDLSKRTRKRKPRSRSPTSFESPMVNISTKS 140

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73
          +R+R    CI C+++K++CD         P C+RC+R  + C++ S
Sbjct: 23 RRQRRSHVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYES 62

>Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089C
           (HAL9) - 1:1 [contig 184] FULL
          Length = 865

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 55/144 (38%), Gaps = 34/144 (23%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
           R+R  +AC +CR RK+KC  GPV NP    C  C +    C F  + E            
Sbjct: 22  RKRVPKACDHCRKRKIKC--GPV-NPITGTCENCNKFNTSCTFRHHDEI----------- 67

Query: 89  TSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTLEFL- 147
                   S      DL            + +DNE   K    +   E SSM+  LE L 
Sbjct: 68  --------SRHRKFTDL-----------KRASDNEPKVKKAAAELSPETSSMEQKLEKLE 108

Query: 148 AQAAGTVAKEGAKEIIKDESTTTT 171
           +Q AG       ++ +K ES   T
Sbjct: 109 SQLAGLYELISRQQAVKSESLHYT 132

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 27/136 (19%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC---------KRELKRCLFSSNREAM 78
           KRRR  +AC  CR +KVKCD          PC  C         K+  KR   S N   +
Sbjct: 13  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPTKRTQNSGNSGVL 65

Query: 79  H----TLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMP-LSGKNTDNETLFKSEGMKW 133
                T  PS   + + +AS+      PN L+S+  ++   L G +T   +   S+  K+
Sbjct: 66  TLGNVTTGPSSSTVVAAAASN------PNKLLSNIKTERAILPGASTIPASNNPSKPRKY 119

Query: 134 KLELSSMQNTLEFLAQ 149
           K + + +Q+ ++   Q
Sbjct: 120 KTKSTRLQSKIDRYKQ 135

>KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON}
           conserved hypothetical protein
          Length = 955

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN----REAMHTLSP 83
           KR+R   +C+ C  RK+KCD         P C  C +    CL+  N    R   H +S 
Sbjct: 38  KRQRQILSCVACHKRKIKCDRA------KPVCESCGKNGWECLYFLNARVSRGGKHNIST 91

Query: 84  SMINITSKSAS 94
              ++T+  AS
Sbjct: 92  GTEDVTASEAS 102

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          PKRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 27 PKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYN 65

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 50/120 (41%), Gaps = 24/120 (20%)

Query: 27  PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMI 86
           P R R ++ACI CR +K +CD          PC+ C R    C      E  +T  P   
Sbjct: 23  PTRLRVFKACIACRKKKRRCD-------GKSPCSHCARTSIIC------EYTNTARP--- 66

Query: 87  NITSKSASSKSEQGVPND--LMSSTPSDMPLSGKNTDNETLFKS--EGMKWKLELSSMQN 142
               +S S      V ND  L+ ST S    S K +D    +K+  E +     L S+QN
Sbjct: 67  ----RSHSIAFANDVSNDIHLIDSTTSSRSHSPKLSDKVNPYKTLIERLYSGASLESLQN 122

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          KR +T++ C  CR RK+KCDL        P C +C+     C
Sbjct: 15 KRAKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 7   TVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKREL 66
           TV   +T+  G+   TV    KR+ +   C  C+ R++KCD G    P    CAR  RE 
Sbjct: 124 TVAGQATSSSGADGKTV----KRKYSRNGCTECKRRRMKCDEG---KPTCWQCARLNREC 176

Query: 67  KRCLFSSNRE 76
              + + NR+
Sbjct: 177 VYVIRTKNRK 186

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS--SNREAMH--TLSP 83
           KRRR  +AC  CR +KVKCD          PC  C      C ++  + R   H  T +P
Sbjct: 31  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTKRSLQHLTTYAP 83

Query: 84  SMINITSKSASSKSEQGV 101
           S  N +S S   ++   V
Sbjct: 84  SKTNNSSSSPLKQTTNQV 101

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
          ARG81Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type, involved in
          the regulation of arginine-responsive genes; acts with
          Arg80p and Arg82p
          Length = 880

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 6/53 (11%)

Query: 17 GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          G S    P    R +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 2  GISSKNGPKKMGRAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKRCLFSSNREAMHTLSPSM 85
          KR R    C NC+ RK KCD          PC  C R  ++  C++ S+R       P++
Sbjct: 11 KRHRITVVCTNCKKRKSKCD-------RIKPCGTCVRLGDMDSCVYLSDRLGQRETGPTL 63

Query: 86 INI 88
            I
Sbjct: 64 TGI 66

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 6/36 (16%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          R R+Y  C  CR+RKVKCD         P C RCK+
Sbjct: 13 RNRSYSGCWTCRARKVKCDT------QRPKCCRCKQ 42

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 26 FPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCARCKRELKRCLF 71
           P  RR Y AC+ CR +K KCD     N  AP PC++C R+   C+ 
Sbjct: 10 IPMGRRKY-ACVECRQQKSKCDA----NDKAPNPCSKCARKGVPCIL 51

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
          (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
          P+  R    C+ CR+RK+KCD         P C RCK+ L  C ++++
Sbjct: 6  PRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYAND 47

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343
          bp, 780 aa] {ON}
          (9848..11548,11550..11612,11615..12193) [2343 nt, 781
          aa]
          Length = 780

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFS 72
          +RR+  ++C  CR RK+KCD G       P C +C  REL  C+++
Sbjct: 28 RRRKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYT 67

>KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {ON}
           Anc_7.512 YLR451W
          Length = 846

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 22/103 (21%)

Query: 5   NTTVP---FMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCA 60
           NT  P   F  +    SS  +V     R+R + AC+ CR +K KCD     +  AP PC+
Sbjct: 6   NTNQPTSMFTGSDGNTSSNMSVANTAARKRKF-ACVECRQQKSKCDA----HERAPEPCS 60

Query: 61  RC-------------KRELKRCLFSSNREAMHTLSPSMINITS 90
           +C             +R  KR    +  E    L+ +++N+TS
Sbjct: 61  KCAKKGVPCVLKKDFRRTYKRARNEAIEEKFRELTKNLVNLTS 103

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           ++R  +AC +CR RK+KCD  PV NP    C+ C +    C F
Sbjct: 111 KKRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTF 150

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {ON}
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206C and some similarities with YIL130W
           uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
           Proposed transcriptional activator member of the Gal4p
           family of zinc cluster proteins
          Length = 650

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 20/131 (15%)

Query: 6   TTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRE 65
           T +P +S      S N +   P R +   AC +C+ RKV+CD          PCA C   
Sbjct: 8   TDIPNVSVLATEPSTNQLE--PVRHKVKHACSSCKERKVRCD-------GQSPCASCINA 58

Query: 66  LKRCLFSSNREAMH----------TLSPSMINITSKSASSKSEQGVP-NDLMSSTPSDMP 114
             +C +  N + +            LS + +   S   SS++ QGV    +  S   D+ 
Sbjct: 59  RVKCEYVMNMKPLKKKRKVSFIRSNLSKNELKGGSSVISSQNAQGVDYKKVFHSLFPDVD 118

Query: 115 LSGKNTDNETL 125
           LS  N   E+L
Sbjct: 119 LSQSNLCTESL 129

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 8  VPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKC-DLGPVDNPHAPPCARCKREL 66
          +P +++   G     V T P ++R  +AC  CR RK+KC DL PV    +  C+ C +  
Sbjct: 11 IPAITSHAEG-----VTTKPAKKRVSKACDRCRRRKIKCDDLDPV----SGKCSNCIKYK 61

Query: 67 KRCLFSSNREAM 78
            C F  + E +
Sbjct: 62 VPCTFHYHEEMI 73

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%), Gaps = 11/62 (17%)

Query: 17 GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          G+  + +  +PKR+R   AC NCR R+ KCDL         PCA C R    C  + N E
Sbjct: 20 GNELDILDDYPKRKRL--ACSNCRRRRKKCDLN-------FPCANCIRLGLNC--NVNEE 68

Query: 77 AM 78
           M
Sbjct: 69 DM 70

>KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa]
          {ON} similar to uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
          mediated Activation Ty1 enhancer activator and to
          YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
          CHA4 Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain; DNA-binding transcriptional
          activator or CHA1
          Length = 652

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 11 MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +++T  GSSE+     P   +   AC NCR R+ KCD+G        PCA C +    C
Sbjct: 9  LTSTNAGSSEDFSSGSPLLSQKRLACSNCRRRRKKCDMG-------YPCASCVKMKLDC 60

>Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {ON}
           YOL089C (REAL)
          Length = 1030

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 8/83 (9%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
           ++R  +AC +CR RK++CD   VD  +   C+ C +    C F    E +       + I
Sbjct: 129 KKRVSKACDHCRKRKIRCD--EVDQ-YTKKCSNCVKFESPCTFKHRDEILK--KKRKLEI 183

Query: 89  TSKSASSKSEQG---VPNDLMSS 108
              SA  KS Q    VPN + SS
Sbjct: 184 KQNSAPDKSPQAQNNVPNSVSSS 206

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa]
          {ON} similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 856

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 6/36 (16%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          R +T+  C  CRSRKVKCDL        P C RC++
Sbjct: 7  RVKTFTGCWTCRSRKVKCDL------RRPGCERCEK 36

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query: 12 STTKRGSSENTVPTFPKRR-RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
          S +  GS+ +  P F K R R    C NC+ RK+KCD         P C RC +    C+
Sbjct: 5  SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKA------RPSCGRCSKLELECV 58

Query: 71 --FSSNREAMHTL 81
            F  N++    L
Sbjct: 59 YDFQENKDGRRGL 71

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 44/110 (40%), Gaps = 21/110 (19%)

Query: 6   TTVPFMSTTKRGSSENTVPTFP---KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 62
           TT P  +T    S  +     P   KRRR  +AC  CR +KVKCD          PC  C
Sbjct: 33  TTTPIHTTLNIHSINSNTQGNPIQLKRRRVTRACDECRKKKVKCD-------GQQPCIHC 85

Query: 63  KRELKRCLF---SSNREAMHTLSP--------SMINITSKSASSKSEQGV 101
                 C +   S+ R   ++ +P        SM N+T  S  S +   +
Sbjct: 86  TVYSYECTYNQPSTRRNNSNSSTPISTMVNSHSMTNLTMMSNQSNTNSNI 135

>KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]
          {ON} conserved hypothetical protein
          Length = 651

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 30 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREA 77
          +R+ + C+ CR R  KCD         P C+ CK    RC++  N EA
Sbjct: 26 KRSSRGCLTCRDRHKKCD------EKKPLCSGCKENFLRCVWRDNEEA 67

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          ++ R    C+ CRS+KVKCD         P C RC++  K C++
Sbjct: 7  RKARPSFVCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVY 44

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 29  RRRTYQACINCRSRKVKCD-LGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           +RR+ +AC +CR RK++CD + PV N     C+ C +    C F  + E + T    M  
Sbjct: 34  KRRSTKACDHCRKRKIRCDEVNPVTN----KCSNCVKFKVECTFKFHEE-LQTKKKRMYE 88

Query: 88  ITSKSASSKSEQGVP 102
           + +   ++K  +  P
Sbjct: 89  LKAIEKANKKAKKRP 103

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 12/70 (17%)

Query: 11 MSTTKRGSSENTVPTFPKRRR-----TYQACINCRSRKVKCDLGPVDNPHAPPCARCKRE 65
          ++T K  S+   VPT  K+ R       +AC NCR RK+KC           PCA C+  
Sbjct: 33 VTTVKATSTSLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCT-------GKTPCATCEAY 85

Query: 66 LKRCLFSSNR 75
             C++S+ R
Sbjct: 86 QCLCIYSTQR 95

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON}
          Anc_2.547 YKL038W
          Length = 1088

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 3  AFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 62
          A N      S T+  ++ +   +  +R +  +AC  CR +KVKCD G  D+     C  C
Sbjct: 30 ARNNNTHMTSNTEEANNASRSSSNKRRTKASRACDQCRKKKVKCDNG--DDRSV--CTNC 85

Query: 63 KRELKRCLF 71
          +R  ++C F
Sbjct: 86 QRNGEKCTF 94

>TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa]
          {ON} Anc_6.60 YLR266C
          Length = 699

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 9/49 (18%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPP-CARC-KRELKRCLFSSN 74
          +RR+  ++C  CR RK+KCD       HA P C +C +R+L  CL++ +
Sbjct: 10 RRRKIVRSCTFCRRRKLKCD-------HAKPMCNQCLERKLPNCLYTDD 51

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE-----AMHTLS 82
           K+ R    C  CR RK+KC      N   P C+RC +   +C+++  R      A+ +L 
Sbjct: 7   KKNRISHVCDACRIRKLKC------NKQKPSCSRCVKHDLQCVYTPYRREGDPSAIESLQ 60

Query: 83  PSMINITSKSASSKSEQGV 101
             ++++  + AS+ S   +
Sbjct: 61  KELLHLKQQLASAHSSNSL 79

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 13/70 (18%)

Query: 11 MSTTKRGSSENTVPTFP---------KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCAR 61
          MS ++R S      T P         +R +T +AC  CR +K +CD     +   P C+ 
Sbjct: 1  MSASRRESEPKEAETSPEAGGAASDRRRSKTSRACDQCREKKTRCDF----SDERPICSA 56

Query: 62 CKRELKRCLF 71
          C+R  K C F
Sbjct: 57 CQRMGKTCTF 66

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
           (REAL)
          Length = 894

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 52/134 (38%), Gaps = 23/134 (17%)

Query: 1   MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA 60
           M A       + T    S+EN+      R R  +AC  C+ RKVKCD          PC 
Sbjct: 1   MTAIGNIDDALPTNTAASNENS----KTRLRVQKACELCKKRKVKCDGN-------KPCL 49

Query: 61  RCKRELKRCLFS---SNREAMHTLSPSMINITSK---------SASSKSEQGVPNDLMSS 108
            C +  K C +    +NR      + S I   +K         S    +   VP+D +SS
Sbjct: 50  NCSKHQKECRYDFKVTNRRRRRRQATSPIQNVNKEYTEADGVFSRDISASVNVPSDCLSS 109

Query: 109 TPSDMPLSGKNTDN 122
           +  + P S  +  N
Sbjct: 110 SAGNSPYSNSHYSN 123

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 9/39 (23%)

Query: 26 FPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
           PKR+R   AC NCR R+ KCDL       + PCA C R
Sbjct: 51 LPKRKRL--ACTNCRKRRKKCDL-------SYPCASCVR 80

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 28 KRRRTYQACINCRSRKVKCD-LGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSM 85
          +R R    CI C+SRK+KCD L PV       C RC++  K+C + +    + T   +M
Sbjct: 8  RRPRPSFVCIPCKSRKLKCDRLRPV-------CTRCRKTSKQCTYENEPSLLKTPRSTM 59

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON}
          Anc_2.654 YKL015W
          Length = 1037

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          K+R+  +ACI CR R +KC       P   PC +C      C FS
Sbjct: 51 KKRKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFS 88

>Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          R +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON} 
          Length = 914

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
           ++R  +AC +CR RK+KCD   VD P    C+ C +    C F   R+
Sbjct: 99  KKRVSKACDHCRKRKIKCD--KVD-PSTGKCSNCLKYNANCTFKRGRD 143

>SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]
           {ON} conserved hypothetical protein
          Length = 632

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 45/114 (39%), Gaps = 16/114 (14%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
           ++RT   C+ CR RK KCD         P C  C+R   +C +          S   I  
Sbjct: 5   KKRTITGCLTCRKRKKKCD------EVKPVCTGCQRNFLQCEWPD-------YSDGRIRR 51

Query: 89  TSKSASSKSEQGVPNDLM---SSTPSDMPLSGKNTDNETLFKSEGMKWKLELSS 139
             K + +   +  P  L+   +S   D+  +    D +   +   +KW+ EL +
Sbjct: 52  RRKESDNLKPEQTPRKLLLERNSRQPDLQFNITKCDCQEFVRYGRLKWQFELYT 105

>CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa]
          {ON} similar to uniprot|P19541 Saccharomyces cerevisiae
          YPL133c
          Length = 462

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 8/44 (18%)

Query: 24 PTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KREL 66
          P   K+++ Y++CI CR   V CD       H  PC+RC KRE+
Sbjct: 4  PAAKKQKKLYKSCIFCRRSHVNCD-------HQRPCSRCIKREI 40

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (44%), Gaps = 26/114 (22%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           +++T + S  N V    KR+ +   C  C+ R++KCD         P C +C R      
Sbjct: 98  VTSTIKDSKGNVV----KRKYSRNGCAECKRRRMKCD------ETKPTCWQCSR------ 141

Query: 71  FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSS---TPSDMPLSGKNTD 121
              NRE ++ L+P      +K  + KS + +  +  SS   TPS + L    TD
Sbjct: 142 --LNRECVYVLNPK-----NKKRNGKSTENIVEEHCSSTVVTPSKIELRNTYTD 188

>Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to
          Ashbya gossypii AGL206C
          Length = 607

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +R+RT   C++CR RK KCD         P C  C+R   RC
Sbjct: 3  QRKRTVTGCLSCRRRKKKCD------EQKPVCKGCQRNFIRC 38

>TBLA0E03050 Chr5 complement(764239..766578) [2340 bp, 779 aa]
          {ON} 
          Length = 779

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 28 KRRRTYQ--ACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
          K+  TY    C  C+   VKCD       + P C RC++  K C++SSN
Sbjct: 3  KKSSTYSRLGCEECKKAHVKCD------ENRPRCGRCQKTYKACIYSSN 45

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
          extends into a gap in the genome sequence
          Length = 729

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 13/91 (14%)

Query: 15 KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFSS 73
          KR +++       K+R+  + C  CR RKV+CD G       P C+ CK R    C++  
Sbjct: 4  KRSATDPATQDTRKKRKHIRTCTFCRQRKVRCDQG------RPLCSSCKARGFSECIYLE 57

Query: 74 NREAM---HTLSPSM---INITSKSASSKSE 98
          + +     + LS S+   INI+ + +S + E
Sbjct: 58 DADITNEDYELSLSIIPRINISQQISSLQKE 88

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON}
          similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 809

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          K +R   AC NC S K KC    ++N +  PC RC +  + C F
Sbjct: 56 KPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKF 99

>KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 7/47 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFSS 73
          +RR+  + C+ CR RK+KCD         P C++C+ R L  CL+++
Sbjct: 22 RRRKEVRNCLFCRKRKLKCDRA------KPKCSQCRNRNLPTCLYTN 62

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD+   DN   P C+ C +   RC F
Sbjct: 28 KRSKVSRACDQCRKKKIKCDVSE-DN---PVCSGCFKVGDRCTF 67

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          KR R    C NCR  K+KCD         P C RC ++  +C++   R+
Sbjct: 42 KRNRISFVCQNCRKSKMKCD------REKPECTRCLKQGIKCVYDEERQ 84

>ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserved
          hypothetical protein
          Length = 638

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 6/69 (8%)

Query: 19 SENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAM 78
          ++N     P +RR+   C++CR R+ KCD         P C  C R    C++  +    
Sbjct: 7  TQNQYNGIPTKRRSVTGCLSCRRRRKKCD------ETRPNCKACIRNFLECMWPQDHNVK 60

Query: 79 HTLSPSMIN 87
           +L  ++ N
Sbjct: 61 QSLPFALSN 69

>Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}
          YML099C (REAL)
          Length = 880

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          R +T+  C  CR RKVKCDL        P C RC++    C
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL------RHPHCQRCEKSNLPC 48

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 7/72 (9%)

Query: 6   TTVPFMSTTKRGSSENTVPTFP----KRRRTYQACINCRSRKVKCDL--GPVDNPHAPPC 59
           +TVP    T+R S  + V T      +R +  +AC  CR +K+KCD   G   NP    C
Sbjct: 83  STVPEPDNTRRDSVSSNVSTATTESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQ-SC 141

Query: 60  ARCKRELKRCLF 71
             C++  ++C F
Sbjct: 142 TGCRKIGEKCSF 153

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           KR+ +   C+ C+ R++KCD G       P C +C R  ++C++
Sbjct: 147 KRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 38.9 bits (89), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 18 SSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
          SS    P   KRR T ++C  CR RK+KCD         P C+ C+ R    C++S
Sbjct: 17 SSAVNKPPRKKRRSTIKSCSFCRRRKLKCD------KSKPLCSTCRARNFTECIYS 66

>NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON}
          Anc_4.344 YML076C
          Length = 894

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          K +R   AC+ C S K KC    V++ +  PC RC R  + C F
Sbjct: 54 KLKRNTFACVRCHSLKQKCVPSDVNDIYLKPCQRCSRNKQVCKF 97

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
          YML099C (REAL)
          Length = 882

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 6/36 (16%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          R +T+  C  CR RKVKCDL        P C RC++
Sbjct: 14 RAKTFTGCWTCRGRKVKCDL------RRPHCQRCEK 43

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 21  NTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           N   T  ++RR  +AC  CR RK+KCD   + N     C+ C +    C F
Sbjct: 108 NVSTTKVQKRRVARACDRCRKRKIKCD--EIKNLKVNKCSNCVKYGAECTF 156

>SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]
          {ON} conserved hypothetical protein
          Length = 676

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          RRRT + C+NC+  KV+C           PC RC++   RC +  N +
Sbjct: 7  RRRT-KPCMNCKRNKVRCQY-----IETLPCVRCQKHNLRCFYPENEQ 48

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          K+ R  + C+ C+ RK++CD         P C RCKR    C +  + E
Sbjct: 7  KKPRPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTYDHDSE 49

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          +RR+  +AC NCR RK+KC           PC  C+    +C+F
Sbjct: 15 RRRKVNRACDNCRKRKIKCS-------ETTPCTNCQIYQCKCVF 51

>NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON}
           Anc_3.109
          Length = 978

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 26  FPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
           FPK+R T +AC  CR RK+KC    VD P    C  C +   +C F  + E
Sbjct: 147 FPKKRGT-RACDYCRKRKIKC--SAVD-PKTKKCPNCDKNNMKCTFKFHME 193

>NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON}
           Anc_5.322 YDR303C
          Length = 769

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (41%), Gaps = 31/120 (25%)

Query: 21  NTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKR--CLFSSN---- 74
           N +PT  ++ +   ACI CR RK+ CD G       P C  C + LKR  C++       
Sbjct: 4   NNIPT--RKPKKNPACIQCRKRKIGCDRG------HPKCGNCIK-LKRAQCIYPDEFHTA 54

Query: 75  ----REA-----MHTLSPSMINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETL 125
               RE      + TLSP+  NI     +  +     N +   TP + P    NTD   L
Sbjct: 55  SELLREMEKASPLQTLSPASRNINPNKPTLVNG----NHVYIQTPGNTP---SNTDQNKL 107

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           KR +  +AC NCR RK+KC         A PC  C+     C +S    A  +     +N
Sbjct: 11  KRSKVSRACNNCRRRKIKC-------TGAQPCLNCQTYRCECTYSIPSPASLSSGDVALN 63

Query: 88  ITSKS-ASSKSEQGVPNDLMSSTPSDMP 114
               +  ++ S  G P+  M + PS +P
Sbjct: 64  FRDTTLKTTTSNMGAPSSNMGA-PSSVP 90

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 8/50 (16%)

Query: 15 KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          + G++ NT P      R   AC NCR+R+ KCDLG        PC  C R
Sbjct: 50 RSGTAVNT-PVDGNSNRKRLACTNCRNRRKKCDLG-------FPCGNCSR 91

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAM 78
          R++  +AC+NCR RK+KC           PC+ C      C+F   ++ +
Sbjct: 10 RKKVVKACLNCRRRKIKC-------TGTFPCSNCAAYQCECVFDETKDII 52

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 71/179 (39%), Gaps = 44/179 (24%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS----SNREAMHTLSPS 84
           R +  +AC NCR RK+KC+ G        PCA C+  L  C F+    SNR  +     +
Sbjct: 36  RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYLCECTFTTRHGSNR--IKNFQKA 86

Query: 85  MINITSKSASSKSEQ-----GVPN-DLMSSTPSDMPLSGKNTDNETL------------- 125
            +N+   +   K E       VPN  L +  P  +    K+ +N  L             
Sbjct: 87  NLNLEGATVQVKEETDSSSGSVPNPQLCADGPCSIDQPPKSYENCKLDGGSSSSSGNKDD 146

Query: 126 -------FKSEGMKWKLELSSMQNTLEFLAQAAG-----TVAKEGAKEIIKDESTTTTP 172
                  F  +  K++  L+S+Q  L+ L + A        A E  +  I D +++  P
Sbjct: 147 EDSNRNGFYEDDSKFQATLASLQGALKNLKEIAHLGPHIATAIENVESQINDLTSSWEP 205

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          +R +T +AC  CR +K +CD    +    P C  C+R  K C F
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDEN----PVCTSCQRMSKTCTF 70

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {ON} 
          Length = 978

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMIN 87
           K+ R+ +AC NCR RK+KC           PC  C+     C+F    E ++ ++P  +N
Sbjct: 10  KKLRSSRACSNCRRRKIKCS-------GIQPCPNCEIYGCLCVF----EPVNGMTP--MN 56

Query: 88  ITSKSASSKSEQGVPNDLMSSTPSDMP 114
            +SK + ++   G  N + S  P   P
Sbjct: 57  FSSKPSETEFHHG--NSMHSVKPKTEP 81

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD   + N     C  C+R  +RC F
Sbjct: 47 KRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSF 86

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa]
          {ON} YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          +R T+ AC NC ++K KC    V + +  PC RC++  K C F
Sbjct: 54 KRNTF-ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTF 95

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa]
          {ON} weakly similar to uniprot|Q6B2M3 Saccharomyces
          cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
          transcription factor that activates genes involved in
          multidrug resistance paralog of Yrr1p acting on an
          overlapping set of target genes
          Length = 771

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFS 72
          +RR+  ++C  CR RK+KCD         P C  C +R+L  C+++
Sbjct: 60 RRRKVIKSCTFCRQRKMKCD------QQKPMCGSCVERKLSECIYT 99

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 7/44 (15%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          R +  +AC NCR RK+KC           PCA CK     C+FS
Sbjct: 10 RSKVSKACDNCRRRKIKC-------SGERPCAGCKTYNCECIFS 46

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
          enhancer activator required for full levels of Ty
          enhancer-mediated transcription; C6 zinc cluster
          DNA-binding protein
          Length = 759

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 12 STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          +  + G+  NT+      R+   AC NCR+R+ KCDLG        PC  C R
Sbjct: 47 ANVRSGTGANTLTNGGSTRKRL-ACTNCRNRRKKCDLG-------FPCGNCSR 91

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 20/73 (27%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS-------------SNR 75
          R+R  +AC  CR++K+KCD          PC+ CK+  + C ++             SNR
Sbjct: 7  RKRVSKACDACRAKKIKCD-------GCDPCSNCKKVSQECGYTYVVKKRQKPPTRVSNR 59

Query: 76 EAMHTLSPSMINI 88
          + +  LS  ++ +
Sbjct: 60 KILADLSQRLVRL 72

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          K+ R  + C+ CR RKVKCD         P C RC +    C ++
Sbjct: 7  KKPRPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTYT 45

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
          similar to uniprot|P35995 Saccharomyces cerevisiae
          YKL222C Hypothetical ORF and similar to uniprot|Q12340
          Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLF 71
          KRR+  ++C+ CR RK+KCD         P C+ C  R L  C++
Sbjct: 11 KRRKVIKSCLFCRKRKLKCD------HKKPKCSTCAARNLPECVY 49

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
           KRR+  ++C  CR RK+KCD         P C  CK R L  C+++
Sbjct: 82  KRRKVIKSCTFCRKRKLKCD------RKRPMCTGCKMRGLSECVYT 121

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          KR R    C  CR RK+KCD         P C+RC +    C+++  R+
Sbjct: 7  KRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYNPYRQ 49

>TBLA0A00280 Chr1 (45618..47912) [2295 bp, 764 aa] {ON} 
          Length = 764

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 8/46 (17%)

Query: 26 FPKRRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          F K+  TY    C+ C+    KCD         P C RCKR  K+C
Sbjct: 3  FQKKGLTYSKHGCLQCKKAHAKCD------ETKPVCDRCKRTFKKC 42

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 6/49 (12%)

Query: 23 VPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          V  +  +RRT + C NC+  KVKC+          PC+RC R    C F
Sbjct: 2  VGIYDSKRRT-KPCSNCKQNKVKCEYN-----EGLPCSRCTRNGLECYF 44

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 241 IEDFEYIGPANLLTKEEAIELIEAF--FLTMHPFFPNIPFQLHDPKELAQYPILFCAILT 298
           + DF +    ++LTK++A EL+  F    + H F   I   LH        P+L  AI T
Sbjct: 148 VNDFRF---DHVLTKQQAQELLALFDKNCSNHLFHYTIG-DLHIDDLWVNSPLLLAAICT 203

Query: 299 VSARYHP 305
           V++RYHP
Sbjct: 204 VASRYHP 210

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           KR +  +AC  CR +K+KCD     +     C+ C+R  ++C F
Sbjct: 67  KRTKASRACDQCRKKKIKCDF----SEEKTLCSNCQRNGEKCTF 106

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 37/92 (40%), Gaps = 18/92 (19%)

Query: 11 MSTTKRGSSENTVPTFPKR----RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKREL 66
          M+   R       P   KR    R+T QACI+CR RKVKC+          PC+ CK   
Sbjct: 22 MAQDSRPPQVMATPRVTKRAYTIRKTPQACISCRRRKVKCN-------GCRPCSSCKTNG 74

Query: 67 KRCLFSSNREAMHTLSPSMINITSKSASSKSE 98
            C       A  T S   +NI  K     SE
Sbjct: 75 LEC-------AYDTPSLEQVNIKGKPHIDTSE 99

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 6/57 (10%)

Query: 20 ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          E +V    KR R    C+ CR RK+KCD         P C +C  +   C++   R+
Sbjct: 9  EYSVGKVQKRNRLSFVCLECRRRKIKCD------KQRPCCIQCAEQGLTCVYDIERQ 59

>NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON}
          Anc_1.199
          Length = 875

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKRCLFSSN 74
          KR R    C NC+ RK KCD G        PC+ C R  +  RC++ S+
Sbjct: 16 KRNRPTVVCTNCKKRKSKCDRG-------RPCSTCARLGDGDRCIYVSD 57

>TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa]
          {ON} 
          Length = 633

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 7/39 (17%)

Query: 34 QACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLF 71
          Q C+NC+ + VKCD         P C+RC  R +K C +
Sbjct: 10 QGCLNCKKKHVKCD------EKKPKCSRCLSRNIKHCKY 42

>TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa]
          {ON} 
          Length = 767

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSN 74
          P  R +   CINC++  +KCD         P C+ C ++ K C + +N
Sbjct: 10 PIARYSKHGCINCKTSHIKCD------EEKPQCSNCAKKSKACTYENN 51

>YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}
           LEU3Zinc-knuckle transcription factor, repressor and
           activator; regulates genes involved in branched chain
           amino acid biosynthesis and ammonia assimilation; acts
           as a repressor in leucine-replete conditions and as an
           activator in the presence of alpha-isopropylmalate, an
           intermediate in leucine biosynthesis that accumulates
           during leucine starvation
          Length = 886

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 22/108 (20%)

Query: 10  FMSTTKRGS----SENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCARC-- 62
           F++T++ GS    SE    T    R+   AC+ CR +K KCD     +  AP PC +C  
Sbjct: 7   FVATSQSGSEMSHSETRNRTGMNARKRKFACVECRQQKSKCDA----HERAPEPCTKCAK 62

Query: 63  -------KRELKRCLFSSNREAMHT----LSPSMINITSKSASSKSEQ 99
                  KR+ +R    +  EA+      L+ ++ N+TS     K E+
Sbjct: 63  KNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNLTSDEILKKIEE 110

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 6/84 (7%)

Query: 20  ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMH 79
           + TV    KR+ +   C  C+ RKVKCD         P C +C    K+C++        
Sbjct: 5   KKTVTIRKKRKYSKLGCNECKKRKVKCD------EQKPECWQCSHLGKKCVYDQPSNGPP 58

Query: 80  TLSPSMINITSKSASSKSEQGVPN 103
             S   IN +S+   S      PN
Sbjct: 59  YKSVKFINASSEDIYSIQSIYGPN 82

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR    +AC  CR +K+KCD     N     C  C+R  +RC F
Sbjct: 8  KRTNVSRACDQCRRKKIKCDR----NQERNICTSCQRNGERCKF 47

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.512
           YLR451W
          Length = 766

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 66/338 (19%), Positives = 119/338 (35%), Gaps = 71/338 (21%)

Query: 25  TFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPS 84
           T  K +R   AC+ CR +K KCD          PC+RCK++   C      +     +  
Sbjct: 7   TLMKSKRRKYACVECRQQKSKCDYT---TKFPEPCSRCKKKGIICAVKQGFKRTKKRA-- 61

Query: 85  MINITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDNETLFKSEGMKWKLELSSMQNTL 144
               T+++   K EQ      + +  +D P+S  +     L +       ++L    NT 
Sbjct: 62  ----TAEAIERKIEQ------LKNHIADGPVSVDD-----LIRLAKEDEDVDLGQFDNT- 105

Query: 145 EFLAQAAGTVAKEGAKEIIKDESTTTTPFVNSLHSSCQPSTDEGLKPLSRSLSAASDTNT 204
            F  +    +  E    +    S   TP  N+L++    + + GL  LSRSLSA     +
Sbjct: 106 AFTREQLHILRSEARTPV----SRAMTPLTNALNT----TVNNGL--LSRSLSAEECKCS 155

Query: 205 PIEXXXXXXXXXXXXXXXXSQLIEEIGKVRPIPTRKIEDFEYIGPANLLTKEEAIELIEA 264
           P                      + +G +                   ++ E+  +L + 
Sbjct: 156 P----------------------KSLGDI------------------YMSSEDIADLFQE 175

Query: 265 FFLTMHPFFPNIPFQLHDPKELAQYPILFCAILTVSARYHPFDTLGLDNGENGTRHVEVH 324
           F    H F P +       K  +  P LF  I+    R+       +       + +   
Sbjct: 176 FATNYHQFLPVVDLSKGAEKIFSLSPCLFWVIMLTGLRHRSGSIETMTKLSTLVKSILAE 235

Query: 325 DKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTEWNP 362
             +    Q   +++     +  S+ +V AF+++T W P
Sbjct: 236 ITISPIIQYTPTESDEPLLNVASVYSVQAFLLYTFWPP 273

>NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa]
          {ON} 
          Length = 757

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 17 GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFS 72
          GSS      F +RR+  ++C  CR RK+KCD       + P C +C  R+   C+++
Sbjct: 2  GSSSTQNIGFKRRRKPIKSCAFCRGRKLKCD------KNKPICNQCLMRKHPTCIYT 52

>Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa]
          {ON} YLR266C (REAL)
          Length = 707

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 12 STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCL 70
          S T  GSS        KRR+  ++C  CR RK+KC      +   P C +C  R+L +C+
Sbjct: 9  SFTNEGSSPIDSDKKGKRRKVIKSCTFCRKRKLKC------SQVRPMCQQCSIRKLPQCI 62

Query: 71 FS 72
          ++
Sbjct: 63 YT 64

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 31  RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73
           ++   CINC+ R+VKCD G       P C +C      C++ S
Sbjct: 92  KSKTGCINCKKRRVKCDEG------KPACKKCTNMSLSCVYIS 128

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD           C+ C+R   RC F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGVCSNCQRNGDRCSF 78

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa]
          {ON} Anc_2.565
          Length = 803

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS-----NREAMHTLS 82
          +R R  +AC  C+ RKVKCD          PC+ C +  K C +++     N +   +LS
Sbjct: 17 QRLRVQRACAICKKRKVKCD-------GMKPCSNCIKRSKDCTYTTAYKIPNMKYSPSLS 69

Query: 83 PS 84
          PS
Sbjct: 70 PS 71

>Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar to
           Ashbya gossypii ACR107W
          Length = 412

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 17/105 (16%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFSSNREAMHTLSPSM- 85
           +RR+  +AC+ CR   + CD          PC+RC KR++     S    A+ + +  + 
Sbjct: 15  RRRKVSKACVFCRRSHMICD-------DQRPCSRCIKRDIGHLCQSEKVHAIISTASGVN 67

Query: 86  ---INITSKSASSKSE-----QGVPNDLMSSTPSDMPLSGKNTDN 122
              IN     A+SK+E     Q VP+ L+ + P+      K  +N
Sbjct: 68  GIDINEIQSQATSKAEQNFDVQAVPDHLLPTLPAQYQPVNKTGNN 112

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMINI 88
          R++  +AC NCR RK+KC           PC+ C      C+F   +E   + +PS +  
Sbjct: 30 RKKVSKACANCRRRKIKC-------TGTYPCSNCAAYQCECIFDDLKE--DSSNPSTVGG 80

Query: 89 TSKSAS 94
          T++  +
Sbjct: 81 TTQKVT 86

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 16/68 (23%)

Query: 30 RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSP------ 83
          +R+   C+ CR RK KCD         P C  CKR L  C++ +  EA  T  P      
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVWVN--EAQGTAQPEFEKKD 81

Query: 84 --SMINIT 89
            S IN T
Sbjct: 82 GESFINFT 89

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 1   MVAFNTTVPFMSTTKRGSS---ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP 57
            + FN + P +      +S   EN+     KR R    C  CR  K KCD         P
Sbjct: 28  FLGFNNSTPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRKSKTKCD------REKP 81

Query: 58  PCARCKRELKRCLFSSNRE 76
            C+RC +   +C++  +++
Sbjct: 82  ECSRCIKHGLKCVYDVSKQ 100

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 10/68 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF---SSNREAMHTLSPS 84
          KRRR  +AC  CR +KVKCD          PC  C      C +   S    +  T S S
Sbjct: 10 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKRTNSSVTGSMS 62

Query: 85 MINITSKS 92
            NI+S++
Sbjct: 63 ATNISSQN 70

>KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON} 
          Length = 800

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFSSNR 75
          RR+  ++C  CR RK+KCD         P C+ C+ R L  C+++ N+
Sbjct: 15 RRKPVKSCAFCRQRKLKCD------HQRPLCSSCRARGLSSCVYALNK 56

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
          to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
          Transcriptional repressor involved in the control of
          multidrug resistance negatively regulates expression of
          the PDR5 gene member of the Gal4p family of zinc
          cluster proteins
          Length = 561

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 9/51 (17%)

Query: 23 VPTFP--KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          +P+ P  KR+R  +AC+ CR RK +CD        A PC  C     +C +
Sbjct: 5  IPSVPHKKRQRARKACVPCRQRKRRCD-------GANPCGMCVSYAYKCHY 48

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
          {ON} 
          Length = 847

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 23 VPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          +P   K+RR    C  CR++KVKCD         P C +CK     C
Sbjct: 1  MPMAMKKRRLNNGCWTCRTKKVKCD------SKKPFCDKCKDSGLHC 41

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
           similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 20/121 (16%)

Query: 27  PK-RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAM-----HT 80
           PK R +  ++C+ C+ RK KCD        AP C+ C ++   C+++ N ++        
Sbjct: 2   PKSRNKPTRSCLMCQRRKKKCD------RKAPSCSACLKKGYECIYNVNLQSQLVDGTKQ 55

Query: 81  LSPSM----INITSKSASSKSEQGVPNDL----MSSTPSDMPLSGKNTDNETLFKSEGMK 132
           LS S     I I +     KS++   N L     +S+     L+   T    L KS  M 
Sbjct: 56  LSKSQLIAKIGILTSQLREKSDKNTGNPLTKLWYTSSKYGRVLTYGPTSVRCLIKSSRMG 115

Query: 133 W 133
           W
Sbjct: 116 W 116

>Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON}
          YKL222C - Hypothetical ORF [contig 17] FULL
          Length = 735

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLF 71
          KRR++ + C+ CR RK+KCD       + P C  C  R L  C++
Sbjct: 28 KRRKSIKQCLFCRKRKLKCD------KNRPVCGTCASRGLTECVY 66

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          K++R   AC+ CR R +KC       P+  PC +C +   +C
Sbjct: 26 KQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKC 60

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 9/78 (11%)

Query: 2   VAFNTTVPFMSTTKRGSS---ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPP 58
           + FN + P +      +S   EN+     KR R    C  CR  K KCD         P 
Sbjct: 29  LGFNKSTPGLEGEHSSTSPAPENSEMQNRKRNRISFVCQACRKSKTKCD------REKPE 82

Query: 59  CARCKRELKRCLFSSNRE 76
           C RC +   +C++  +++
Sbjct: 83  CGRCTKHGLKCVYDVSKQ 100

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 10/71 (14%)

Query: 6  TTVPFMSTTKRGSSENTV----PTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP-PCA 60
          TTVP ++     SSE+ +     T   RR+ + AC+ CR +K +CD        AP PC 
Sbjct: 15 TTVPDLTMQSSKSSEDGMCSDEGTKVYRRKKF-ACVECRQQKSRCDAS----EKAPGPCT 69

Query: 61 RCKRELKRCLF 71
          +CK++   C+ 
Sbjct: 70 KCKQKGVTCVL 80

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           K +R   ACI+C S K KC     ++ +  PC RC +  K C F
Sbjct: 100 KLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRF 143

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 9/79 (11%)

Query: 1   MVAFNTTVPFMSTTKRGSS---ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP 57
            + FN   P +      +S   EN+     KR R    C  CR  K KCD         P
Sbjct: 28  FLGFNNATPGLEAEHSSTSPAPENSETHNRKRNRISFVCQACRKSKTKCD------REKP 81

Query: 58  PCARCKRELKRCLFSSNRE 76
            C RC +   +C++  +++
Sbjct: 82  ECGRCIKHGLKCVYDVSKQ 100

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 6/40 (15%)

Query: 25  TFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
           T P  RR  QAC  CR +K+KCD G +     P C  C++
Sbjct: 90  TIPTGRRHSQACDRCRLKKIKCD-GLI-----PHCTNCRK 123

>Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa]
          {ON} YLR266C (REAL)
          Length = 694

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
          KRR+  ++C  CR RK+KC      N   P C +C  R+L +C+++
Sbjct: 16 KRRKIIKSCAFCRKRKLKC------NQVRPMCQQCVLRKLPQCIYT 55

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKC     DN H  PC  C      C ++
Sbjct: 14 KRRRITRACDECRKKKVKC-----DNRH--PCIHCTVYSYECTYN 51

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           ++RR  +AC  CR RK KCD     +P+   C+ C +    C+F
Sbjct: 170 EKRRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIF 210

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD           C+ C+R   RC F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCSNCQRNGDRCSF 78

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           KR+ +   C  C+ R++KCD G       P C +C R  + C++
Sbjct: 156 KRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVY 193

>TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa]
          {ON} Anc_6.61 YOR172W
          Length = 743

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFSSNREAMHTLSPSMIN 87
          RR+  ++C  CR RK++CD         P C+ C +R    C++ S   +     P  + 
Sbjct: 32 RRKLIKSCAFCRKRKLRCD------QKKPICSTCSQRRFSTCIYPSYDASEQIFGPEPVQ 85

Query: 88 ITS 90
          I S
Sbjct: 86 IPS 88

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
          {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR RK+KCD     +     C  C +   RC F
Sbjct: 41 KRTKASRACDQCRKRKIKCDF----SEEKGICTSCSKNADRCAF 80

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 66

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           ++R  +AC +CR RK+KCD     +P+   C+ C +    C F
Sbjct: 246 KKRVSRACDHCRKRKIKCD--EKRDPNTNKCSNCIKYNSECTF 286

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 7/41 (17%)

Query: 24 PTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          P      R   AC NCR+R+ KCDLG        PC  C R
Sbjct: 58 PVHGSSTRKRLACTNCRNRRKKCDLG-------FPCGNCSR 91

>KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {ON}
           conserved hypothetical protein
          Length = 678

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 27/113 (23%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRE----- 65
           M+    G S   +     R+RT ++CI C S K KCD         P C RC ++     
Sbjct: 1   MTNNLAGKSAKEIKEQIVRKRTPKSCIRCYSIKRKCD------HKKPSCTRCFKKSLPCE 54

Query: 66  -------LKRCL--FSSNREAMHTLSPSMINITSKSASSKSEQGVPNDLMSST 109
                  L+RCL   S+ R  +H  +P+       S SS +E    ND + +T
Sbjct: 55  YFTEEHVLERCLQRQSNLRSVIHQKAPA-------SRSSTNETISENDTLPTT 100

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
          {ON} conserved hypothetical protein
          Length = 661

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMH-TLSPSMIN 87
          RRRT + C NC+  KVKC         + PC RC R   +C F+ N    + TLS   IN
Sbjct: 7  RRRT-KPCTNCKKNKVKCLYQD-----SLPCERCARHQLQCHFAENNSLRNETLSVHEIN 60

>TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {ON}
           Anc_4.344 YML076C
          Length = 806

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 30  RRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           +R   AC++C S K KC      + +  PC RC R  K C F
Sbjct: 70  KRNSFACVSCHSLKQKCVPSDPHDIYRKPCERCLRNFKLCKF 111

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 9/79 (11%)

Query: 1   MVAFNTTVPFMSTTKRGSS---ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAP 57
            + FN   P +      +S   EN+     KR R    C  CR  K KCD         P
Sbjct: 28  FLGFNNPTPGLEAEHSSTSPAPENSETHNRKRNRILFVCQACRKSKTKCD------REKP 81

Query: 58  PCARCKRELKRCLFSSNRE 76
            C RC +   +C++  +++
Sbjct: 82  ECGRCVKHGLKCVYDVSKQ 100

>AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; No
           homolog in Saccharomyces cerevisiae
          Length = 612

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 10/96 (10%)

Query: 29  RRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTLSPSMI 86
           RR  Y    C  C+ RKVKCD         P C +C    KRC++  N   +     +++
Sbjct: 13  RRSKYSKNGCSECKRRKVKCD------ETKPACWQCSHLGKRCVYMVNNSKIRFKEINVL 66

Query: 87  NITSKSASSKSEQGVPNDLMSSTPSDMPLSGKNTDN 122
           ++  +   +  +    N   SS P+ + +  +  DN
Sbjct: 67  SLRGRERVTDKKACARNGTGSSDPARVTM--REVDN 100

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 18  SSENTVPTFP-KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCAR 61
           S+++T P    KR R   +C  CR RKVKCD      PH  PC++
Sbjct: 63  STDDTKPKMKRKRNRIPLSCTICRKRKVKCDKT---RPHCDPCSK 104

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKRCLFSSNREAMHTLSPSM 85
          KR R    C NC+ RK KCD          PC  C R  ++  C++ ++       SPS+
Sbjct: 11 KRHRITVVCTNCKKRKSKCD-------RTKPCGTCVRLGDVDSCVYLTDSSGQPESSPSL 63

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa]
          {ON} Anc_1.199
          Length = 995

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 7/37 (18%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          KR R+   C NC+ RK KCD        + PC  CKR
Sbjct: 64 KRHRSTVVCTNCKKRKSKCD-------RSRPCGTCKR 93

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {ON}
           Anc_1.199 YKR064W
          Length = 827

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 37/89 (41%), Gaps = 11/89 (12%)

Query: 17  GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKRCLFSSN 74
           G  + +     KR R    C NCR RK KCD          PC  C R  +   C++   
Sbjct: 3   GKEDQSQQPVRKRNRLTVVCSNCRRRKSKCD-------RQTPCGNCVRLGDKDTCVYI-- 53

Query: 75  REAMHTLSPSMINITSKSASSKSEQGVPN 103
           +EA    +   + IT K  +SK +  V N
Sbjct: 54  KEAKGDRNSMDLRITKKLPTSKRKNSVTN 82

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 8/53 (15%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHTL 81
          R +  +AC NCR RK+KC+ G        PCA C+     C F+S R+  H +
Sbjct: 36 RSKVSKACDNCRKRKIKCN-GKF------PCASCEIYSCECTFTS-RQGGHRI 80

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 18  SSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           +S N+     KR+ +   C  C+ R++KCD G       P C +C R  + C++
Sbjct: 131 ASSNSNGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVY 178

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 34 QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          QAC NCR +K+KC      +   P C++C +   +CL+S
Sbjct: 18 QACDNCRLKKLKC------SKETPKCSKCLKNGMKCLYS 50

>ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR034C (LYS14)
          Length = 800

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 24  PTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
           P   KR+ +   C  C+ R++KCD G    P    C+R  RE K  L + N++
Sbjct: 185 PKRTKRKYSRNGCTECKRRRMKCDEG---KPICWQCSRLNRECKYILNARNKK 234

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD           C  C+R   RC F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSF 78

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 23/105 (21%)

Query: 5   NTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
           N+ V    T K+G   NTV    KR+ +   C  C+ R++KCD         P C +C R
Sbjct: 123 NSAVTSTVTDKKG---NTV----KRKYSRNGCSECKRRRMKCD------ETKPTCWQCAR 169

Query: 65  ELKRCLF----------SSNREAMHTLSPSMINITSKSASSKSEQ 99
             + C++          +SN + +       IN+ +   S +  Q
Sbjct: 170 LNRHCIYVLNPKNKKRRTSNAQKVKEFGKHSINLDNDHFSDRKRQ 214

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON}
          YKL038W (REAL)
          Length = 1171

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KR +  +AC  CR +K+KCD           C+ C+R   RC F
Sbjct: 39 KRTKASRACDQCRKKKIKCDY----KDEKGLCSNCQRNGDRCSF 78

>SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON}
          conserved hypothetical protein
          Length = 1061

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 9/51 (17%)

Query: 27 PKRRRTYQACINCRSRKVKCD------LGPVDNPHAPPCARCKRELKRCLF 71
          PKR+   +AC+ CR +K+KCD      LG  D      C+ C     +C+F
Sbjct: 10 PKRKVARRACLTCREKKIKCDGEVRASLGGSD---PGICSNCAASGSKCVF 57

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
          similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 34.7 bits (78), Expect = 0.25,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 17 GSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          G SE  +    K ++  ++C+ CR  KVKCD   +  P   PC+ C ++   C
Sbjct: 17 GHSEGYIHDTWKMKKPLRSCVRCRKNKVKCD-SAIRRPK--PCSSCLKKGVSC 66

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 12 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 49

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
             ++   C+NC+ R+VKCD G       P C +C      C++
Sbjct: 196 HNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMKLDCVY 232

>TPHA0E03830 Chr5 complement(805860..808328) [2469 bp, 822 aa] {ON}
           Anc_1.26 YDR520C
          Length = 822

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 26  FPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
           F K+RRT+ +C  CR  K +CD  P+       C RC      C  ++ RE
Sbjct: 104 FRKKRRTF-SCDTCRKFKTRCDFEPL----VGKCHRCNMLQINCSLTTERE 149

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 16  RGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
           R SS  +       ++  +AC  CR RK+KCD     N     C+ C R   RC F+
Sbjct: 55  RSSSTGSAKGSIGGKKATRACDQCRKRKIKCDYDNDKN----VCSSCNRNGDRCQFN 107

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
          (REAL)
          Length = 759

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 15 KRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR 64
          + G+  NT P      R   AC NCR+R+ KCDLG        PC  C R
Sbjct: 50 RSGTVINT-PDNASNTRKRLACTNCRNRRKKCDLG-------FPCGNCSR 91

>TBLA0G01090 Chr7 complement(275031..277499) [2469 bp, 822 aa] {ON} 
          Length = 822

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 37/96 (38%), Gaps = 16/96 (16%)

Query: 15  KRGSSENTVPTFPKRRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
           K   S+  +   PK R  Y    C  C+   +KCD         P C+RCK     C + 
Sbjct: 3   KNNRSKKYLTNLPKNRAVYSRHGCFRCKKMHLKCD------EAKPVCSRCKNTQNLCQYQ 56

Query: 73  S--------NREAMHTLSPSMINITSKSASSKSEQG 100
           S        + ++ + + P  IN +  S S +   G
Sbjct: 57  SEFIISTVNSTKSSNLIPPMTINSSKNSISVRPANG 92

>KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa]
          {ON} 
          Length = 675

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 7/39 (17%)

Query: 34 QACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLF 71
          ++C+ CR RK+KCD         P C +C KR+L +C++
Sbjct: 2  KSCVFCRKRKLKCD------KTKPVCGQCTKRKLPKCVY 34

>KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON} 
          Length = 675

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 7/39 (17%)

Query: 34 QACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLF 71
          ++C+ CR RK+KCD         P C +C KR+L +C++
Sbjct: 2  KSCVFCRKRKLKCD------KTKPVCGQCTKRKLPKCVY 34

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 44

>KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa]
          {ON} Anc_6.60 YLR266C possible pseudogene; N added to
          avoid frameshift
          Length = 855

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
          K+R+  ++C  CR RK+KCD         P C+ CK R  + C+++
Sbjct: 37 KKRKPIKSCAFCRRRKLKCD------QRKPICSSCKSRNFQVCMYT 76

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 7/44 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KRRR  +AC  CR +KVKCD          PC  C      C +
Sbjct: 13 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 49

>KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121
          Length = 688

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 50/118 (42%), Gaps = 26/118 (22%)

Query: 29  RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC--KRELKRCLFSSNREAMHTLSPS-- 84
           R RT ++C  C + K+KCD G        PC+RC        C +  NR    T S +  
Sbjct: 55  RVRTIKSCKYCYTHKLKCDKG-------TPCSRCLSMEMANECTYGFNRTNGATRSAAPL 107

Query: 85  ---------MINITSKSASSKSEQGVPNDLMSSTPSDMPLS----GKNTDNETLFKSE 129
                    M N+  +SA  KS+   P    +S+ +D  LS    GK   +E   ++E
Sbjct: 108 SKVAKGGEKMWNVIDESALYKSKYFYP--FFTSSINDRILSAEAYGKIALSENFVRNE 163

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 25  TFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           T  KRRR  +AC  CR +KVKCD          PC  C     +C +
Sbjct: 61  TQKKRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSY 100

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 7  KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 44

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          ++R  QAC  CRS+K+KCD          PC+ C +    C+ S
Sbjct: 22 KKRHSQACDRCRSKKIKCD-------GLQPCSNCAKIGYNCVTS 58

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 26 FPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS---NREAMHTLS 82
          F K+ +T   C NC+ R+VKCD G       P C +C      C++S+   N+ A  T S
Sbjct: 40 FHKKSKT--GCDNCKRRRVKCDEG------KPGCKKCSNLNLVCVYSTVVDNKVAKKTTS 91

>KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa]
          {ON} conserved hypothetical protein
          Length = 701

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 6/45 (13%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          PKR R+   C  CR R+ KC     D  H P C  C + + +C++
Sbjct: 24 PKRNRSRAGCFTCRLRRKKC-----DEVH-PKCGTCTKHVLKCIW 62

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYN 43

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa]
          {ON} similar to uniprot|Q03631 Saccharomyces cerevisiae
          YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          K +R+  ACI+C S K KC+     + +  PC RC +  K C F
Sbjct: 56 KVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQF 99

>Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {ON}
           YML076C (REAL)
          Length = 944

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
           K +R   AC+ C S K KC+    ++ +  PC RC +  K C F
Sbjct: 67  KIKRNSFACVCCHSLKQKCEPSDANDIYRKPCRRCLKHRKLCKF 110

>KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa]
          {ON} weakly similar to uniprot|Q12180 Saccharomyces
          cerevisiae YOL089C HAL9 Putative transcription factor
          containing a zinc finger overexpression increases salt
          tolerance through increased expression of the ENA1 (Na
          /Li extrusion pump) gene while gene disruption
          decreases both salt tolerance and ENA1 expression
          Length = 866

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 19 SENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNRE 76
          S + +  F  R+R  +AC +CR RK+KC  G V NP    C  C +    C F  + E
Sbjct: 5  SPSELSAFKFRKRVPKACDHCRKRKIKC--GAV-NPITGTCDNCTKFNTVCTFKHHDE 59

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 31 RTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          R+   C  CR +++KCD         P C RCKR L  C++
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCIW 72

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 7/44 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          KRRR  +AC  CR +KVKCD          PC  C      C +
Sbjct: 13 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 49

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
           (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 14/78 (17%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKR--ELKRCLFSSNREAMHTLSPSM 85
           KR R    C NC+ RK KCD G        PC+ C R      CL+  +     T S  +
Sbjct: 11  KRHRITVVCTNCKKRKSKCDRG-------KPCSNCTRIGIENSCLYIKD-----TPSLPI 58

Query: 86  INITSKSASSKSEQGVPN 103
            +I S +  + SE  +PN
Sbjct: 59  DSIGSVADLTASELQIPN 76

>NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.344
           YML076C
          Length = 989

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query: 11  MSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCL 70
           M TT+ G          K +R   AC+ C S K KC     ++ +  PC RC R  K C 
Sbjct: 71  METTENG----------KIKRNTFACVRCHSLKQKCVPSDTNDIYRRPCERCLRTGKLCK 120

Query: 71  F 71
           F
Sbjct: 121 F 121

>SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 645

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73
          KR+ +   C  C+ RKVKCD         P C +C    K C++SS
Sbjct: 13 KRKYSKLGCTECKRRKVKCD------ETKPMCWQCSHLGKNCVYSS 52

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 26/58 (44%), Gaps = 14/58 (24%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSSNREAMHT-LSPS 84
          KR+R    C NC+ RK +CD G       P C  C R         NRE  H  +SPS
Sbjct: 6  KRQRQTLVCSNCKRRKSRCDRG------KPACGNCIR-------LGNRETCHYFISPS 50

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 7/68 (10%)

Query: 11 MSTTKRGSS-ENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
          MS    GSS E       KR R    C  CR  K +CD         P C RCK+    C
Sbjct: 1  MSVVGSGSSPEGNAARTRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLEC 54

Query: 70 LFSSNREA 77
          ++   +++
Sbjct: 55 VYDMAKQS 62

>KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserved
           hypothetical protein
          Length = 1004

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 12  STTKRGSSENTVPTFPKRRRTY--QACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRC 69
           +TT   SSE  + T  KR+ TY  + C+ C+    KCD         P C+RC++    C
Sbjct: 46  TTTGDSSSEEKLST-KKRKSTYSRKGCLQCKKAHTKCD------ERKPKCSRCEKRSIDC 98

Query: 70  LF 71
            +
Sbjct: 99  TY 100

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1066

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 12 STTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          S + +G+S        +R +  +AC  CR RK++CD     +     C  C++  + C F
Sbjct: 44 SQSSQGASGGNTSASKRRTKASRACDQCRKRKIRCDY----DDDKGVCTSCRKNGESCAF 99

>ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON}
          similar to uniprot|Q6B2M3 Saccharomyces cerevisiae
          YOR172W and similar to uniprot|Q06149 Saccharomyces
          cerevisiae YLR266C PDR8
          Length = 758

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 7/48 (14%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFSSN 74
          +RR+  ++C  CR RK+KCD         P C +C  R+L  C+++ +
Sbjct: 11 RRRKAVKSCTFCRKRKLKCD------HRKPMCRQCLDRKLPNCVYTDD 52

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 54/138 (39%), Gaps = 27/138 (19%)

Query: 1   MVAFNTTVPFMSTTKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCA 60
           M A   T   +      S EN+      R R  +AC  C+ RKVKCD          PC 
Sbjct: 26  MTAIGNTDDALQNVAAASKENS----RGRLRVQKACELCKKRKVKCDGN-------KPCL 74

Query: 61  RCKRELKRCLF---SSNREAMHTLSPSMI-NITS----------KSASSKSEQGV--PND 104
            C +  K C +   ++NR      + S I N+            K   SKS   +  P+D
Sbjct: 75  NCFKHQKECRYEFKATNRRRRRRQATSPIQNVNEEYTEIDETFPKDVLSKSNTNINPPSD 134

Query: 105 LMSSTPSDMPLSGKNTDN 122
            +SS+  + P S  +  N
Sbjct: 135 CLSSSAENSPYSNSHYQN 152

>ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weakly
           similar to uniprot|Q12172 Saccharomyces cerevisiae
           YOR162C YRR1 Zn2-Cys6 zinc-finger transcription factor
           that activates genes involved in multidrug resistance
           paralog of Yrm1p acting on an overlapping set of target
           genes
          Length = 921

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 28  KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC-KRELKRCLFSSNREAMHTLSPSMI 86
           KR +  ++C  CR RK++CD         P C+ C  REL  C++  +     T++    
Sbjct: 45  KRMKPIKSCTFCRRRKLRCD------QQKPMCSTCIARELPECVYMESSSTPRTVAGKRG 98

Query: 87  NITS 90
           NI S
Sbjct: 99  NIDS 102

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
          (REAL)
          Length = 790

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCK-RELKRCLFS 72
          KRR+  ++C  CR RK++CD         P C+ CK R    CL++
Sbjct: 23 KRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLYT 62

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 11/46 (23%)

Query: 27 PKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          PKR     AC++CR ++ KC++         PC+ C+R   +C+F+
Sbjct: 16 PKR----LACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIFT 50

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 29 RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLF 71
          +R T+ AC+ C   K KC    V + +  PC RC R    C+F
Sbjct: 56 KRNTF-ACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIF 97

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFS 72
          KRRR  +AC  CR +KVKCD          PC  C      C ++
Sbjct: 29 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYN 66

>TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.60
          YLR266C
          Length = 793

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 9/46 (19%)

Query: 28 KRRRTYQACINCRSRKVKCDLGPVDNPHA-PPCARC-KRELKRCLF 71
          K+R+  ++C  CR RK+KCD       H+ P C +C  R+L  C++
Sbjct: 43 KKRKIPKSCYFCRKRKLKCD-------HSRPTCNQCSSRQLTGCVY 81

>SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some
          similarities with uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 8/39 (20%)

Query: 26 FPK--RRRTYQACINCRSRKVKCDLGPVDNPHAPPCARC 62
          FPK  R+RT   C NC+ RK+KCD         P C+ C
Sbjct: 16 FPKKKRQRTTVVCTNCKKRKIKCDRK------RPACSNC 48

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,443,649
Number of extensions: 4109380
Number of successful extensions: 14186
Number of sequences better than 10.0: 587
Number of HSP's gapped: 14369
Number of HSP's successfully gapped: 605
Length of query: 965
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 846
Effective length of database: 39,836,145
Effective search space: 33701378670
Effective search space used: 33701378670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)