Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5445.442ON34634618220.0
Skud_4.6415.442ON34634617240.0
Smik_4.6385.442ON34634617050.0
YDR372C (VPS74)5.442ON34534716930.0
TDEL0D025905.442ON33034614240.0
KAFR0D050605.442ON32634614090.0
CAGL0A02926g5.442ON32834714030.0
KNAG0B042005.442ON34435314040.0
SAKL0G02706g5.442ON33234613700.0
NCAS0F034305.442ON33234713620.0
ZYRO0F10208g5.442ON33234613400.0
Ecym_45135.442ON33334413310.0
NDAI0B057205.442ON36536713320.0
Kpol_1016.25.442ON32834613280.0
KLTH0F15884g5.442ON32934613240.0
TBLA0A064805.442ON33434713140.0
Kwal_55.213995.442ON32934713130.0
KLLA0E02355g5.442ON32434412990.0
ACL165C5.442ON33134412361e-171
TPHA0J026105.442ON32934612301e-170
Kpol_1062.245.442ON2762739101e-122
TBLA0A027805.442ON3873048581e-113
NCAS0H020905.442ON3452845913e-73
KAFR0C051107.39ON89174840.083
ZYRO0F02794g8.24ON17375692.3
KLTH0E09504g2.396ON38523693.9
Skud_5.481.485ON51780694.0
TDEL0C048103.339ON142055695.3
KLTH0C09966g3.106ON760147669.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.544
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   706   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   668   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   661   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   656   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   553   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   547   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   545   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   545   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   532   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   529   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   520   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   517   0.0  
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   517   0.0  
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   516   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   514   0.0  
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   510   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   510   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   504   0.0  
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   480   e-171
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   478   e-170
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   355   e-122
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   335   e-113
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   232   3e-73
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    37   0.083
ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar...    31   2.3  
KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {...    31   3.9  
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    31   4.0  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    31   5.3  
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    30   9.3  

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/346 (94%), Positives = 336/346 (97%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQS SNN NS GDK +N  +D DD+G NKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERLVEV+DGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI+RAEEIM+ FSQYPFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K+T+LGVSVNLNKEVKEEIENN GHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/346 (92%), Positives = 336/346 (97%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQ ++NN N+ GDK ++  VD DDNG NKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           DNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERL+EVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIM+ FSQ+PFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K+T+LG+SVNLNKEVKEE+E+NPGH+LQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/347 (93%), Positives = 335/347 (96%), Gaps = 3/347 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-NGINKKIAYDPEESKL 59
           MSTLQRRRVNRADSGDTSS+ S++NN  + GDK +N  VDGDD NG NKKIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58

Query: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119
           RDNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSAR
Sbjct: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118

Query: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           KRFDLSERL+EVID SKTGEVLLDETLQLMKNDEPL+ISNWIDLLSGETWNLLKINYQLK
Sbjct: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN
Sbjct: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299
           EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIM+ FSQYPFDL
Sbjct: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298

Query: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           EK+T+LGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/346 (76%), Positives = 305/346 (88%), Gaps = 16/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS LQRRRVNR DSGD SS+Q++  N  ++                +K++AYDPEE+K+ 
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTT----------------SKRVAYDPEEAKIT 44

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           +N+K P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCI+IELALRGKIRI+DDSARK
Sbjct: 45  ENVKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARK 104

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERL+EV+D SKTGEVLLDETLQLMK DEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 105 RFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQ 164

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNE
Sbjct: 165 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNE 224

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+  ++QYPFDL+
Sbjct: 225 YFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLD 284

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K T+ G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 285 KATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/346 (78%), Positives = 296/346 (85%), Gaps = 20/346 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MSTLQRRR NR+DS         S N + S D+               K+AYDPEE+KLR
Sbjct: 1   MSTLQRRRKNRSDSN-----ADDSENVSESQDR---------------KVAYDPEEAKLR 40

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           DN+ IP LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCILIELALR KIRILDDSARK
Sbjct: 41  DNVSIPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARK 100

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERLVEVIDGSKTGEVLLDE LQLMKNDEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 101 RFDVSERLVEVIDGSKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQ 160

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSRNMEL+YN 
Sbjct: 161 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNS 220

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YF ETTSFK IR +AL+C SYGANVLENVL++L+YEKRD+AISRAEEI++ F+QYPFDL 
Sbjct: 221 YFAETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLS 280

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K+T+LG+SVNLNKEV+ E+  NP   LQLEVIAGV EVFSRMDMLL
Sbjct: 281 KNTELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/347 (76%), Positives = 307/347 (88%), Gaps = 20/347 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINK-KIAYDPEESKL 59
           MSTLQRRRVN++++                    SNG  D +D+G +  KIAYDPEESKL
Sbjct: 1   MSTLQRRRVNKSENA-------------------SNGIEDREDDGTSSGKIAYDPEESKL 41

Query: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119
           +++ K PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALR KIRILD  AR
Sbjct: 42  QNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPAR 101

Query: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
            RFD+SERL+EVID SKTGEVLLDETLQLM NDEPL+I+NWIDLLSGETWNLLKINYQLK
Sbjct: 102 MRFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLK 161

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN
Sbjct: 162 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYN 221

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299
            YFPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI++ FSQYPFDL
Sbjct: 222 SYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDL 281

Query: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           +K++  G+SVNLNKE++EE+E+NPG DL+LEVIAGVFEVFSRMDMLL
Sbjct: 282 QKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/353 (73%), Positives = 302/353 (85%), Gaps = 16/353 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-------NGINKKIAYD 53
           MSTLQRRRVNR+DS +  ++         SG KT+  P   +D       +G  +K+AYD
Sbjct: 1   MSTLQRRRVNRSDSNEGETV---------SGGKTAAAPSASNDAEEYEETSGPTRKVAYD 51

Query: 54  PEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRI 113
           PEE+KLRDN  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRI
Sbjct: 52  PEEAKLRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRI 111

Query: 114 LDDSARKRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLK 173
           LDDSARKRFD+SERLVEV+DGSKTGEVLLDETLQLMKNDEPLTI+NWIDLLSGETWNL+K
Sbjct: 112 LDDSARKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMK 171

Query: 174 INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRN 233
           INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRN
Sbjct: 172 INYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRN 231

Query: 234 MELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFS 293
           MELS+N YFPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++  F 
Sbjct: 232 MELSFNSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFG 291

Query: 294 QYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           QYPFDLEK  D G+S NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 292 QYPFDLEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/346 (74%), Positives = 298/346 (86%), Gaps = 14/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS LQRRRVNR +S D +    TS++ N             D+N  ++K+AYDPEE+KL+
Sbjct: 1   MSGLQRRRVNRTNS-DYAEQPITSSDSN-------------DENAKDRKVAYDPEEAKLK 46

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           +N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALR KIR+LDD ARK
Sbjct: 47  ENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARK 106

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+S+RL+EVIDGSKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 107 RFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQ 166

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNE
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNE 226

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YF E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI++ FS++PF L+
Sbjct: 227 YFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALD 286

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K T+ G+SVNLNKEV+ EI  NPG DLQLEV+AGVFEVFSRMD LL
Sbjct: 287 KATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/347 (74%), Positives = 302/347 (87%), Gaps = 16/347 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MSTLQRRRVN+ DS             N +G  T N   D D++    K+AYDPEE+++R
Sbjct: 1   MSTLQRRRVNKDDS------------DNETGSVTPNVERDSDNDN---KVAYDPEEARMR 45

Query: 61  D-NIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119
           +   ++P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCILIELALRGKI+ILDDSAR
Sbjct: 46  NVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSAR 105

Query: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           KRF+LSERLV+VIDG+KTGEVLLDETLQLMKNDEPL+I++WIDLLSGETWN++KINYQLK
Sbjct: 106 KRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLK 165

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSYN
Sbjct: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYN 225

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299
            YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E+++ FS++PFDL
Sbjct: 226 NYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDL 285

Query: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           E  T LG+SVNLN+EV++E+ + PG+DLQLEVIAGV EVFSRMD LL
Sbjct: 286 ETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 294/346 (84%), Gaps = 14/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS LQRRRVNR DS       S SNN  + G       ++  ++  +KK+AYDPEE KL 
Sbjct: 1   MSGLQRRRVNRVDS-------SGSNNEPTRG-------LEAQEDSSSKKVAYDPEEVKLT 46

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           DN+++P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSARK
Sbjct: 47  DNVEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARK 106

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERL+EV D SKTGEVLLDE LQLMK DEPL+I+NWIDLLSGETWN LKINYQLKQ
Sbjct: 107 RFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQ 166

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN+
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYND 226

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+  FS+YPFDL+
Sbjct: 227 YFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLD 286

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
             T+ G+S+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 287 TQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/344 (72%), Positives = 294/344 (85%), Gaps = 12/344 (3%)

Query: 3   TLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLRDN 62
           +LQRRRVN+A+ G TS ++ T   H            D DD G + K+AYDPE+ KLR+N
Sbjct: 2   SLQRRRVNKAEVGGTS-VELTQRKHGE----------DEDDKG-SHKVAYDPEDQKLREN 49

Query: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122
            K PTLTLMEEVLLMGL+D+EGYLSFWNDSISY+LRGCILIELALRGKIR+++D+ARKRF
Sbjct: 50  TKEPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRF 109

Query: 123 DLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           DLSERLVEVI+ SKTGE LLDETL LMK++EPL+I NWIDLLSGETWNLLKI+YQLKQVR
Sbjct: 110 DLSERLVEVIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVR 169

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE+IKRR+LSVLV RN+ L Y EYF
Sbjct: 170 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYF 229

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302
           PE+ +FK +RT+ALICG+YGANVLENVL++L+YEKR++  SRAEEI++ FSQYPF L+KD
Sbjct: 230 PESVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKD 289

Query: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
            + G+SVNL  +VKEEI  NPG  LQLEV+AGVFEVFSRMD  L
Sbjct: 290 VETGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/367 (72%), Positives = 301/367 (82%), Gaps = 23/367 (6%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSS----GDKTSNGPVDGDDNGINKKIAYDPEE 56
           MSTLQRRR  R   G    M    +++N S    G   SN  V   +   + KIAYDPEE
Sbjct: 1   MSTLQRRR--RPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEE 58

Query: 57  SKLRDNIK-----------------IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRG 99
           +KL +N                    PTLTLMEEVLLMGLRD+EGYLSFWND+ISYALRG
Sbjct: 59  AKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRG 118

Query: 100 CILIELALRGKIRILDDSARKRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISN 159
           CILIELALRGKIRILDDSARKRFDLSERL+EV DGSKTGEVLLDETLQLMKNDEPLTI+N
Sbjct: 119 CILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIAN 178

Query: 160 WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKE 219
           WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKE
Sbjct: 179 WIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKE 238

Query: 220 AIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRD 279
           AIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL++L+YEK D
Sbjct: 239 AIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSD 298

Query: 280 KAISRAEEIMSHFSQYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVF 339
            AI+RA+E+++ FS++PFDLEK T+  VSVNLN+ V++E++ NPG+DLQLEVIAGV EVF
Sbjct: 299 NAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVF 358

Query: 340 SRMDMLL 346
           SRMD LL
Sbjct: 359 SRMDTLL 365

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/346 (71%), Positives = 292/346 (84%), Gaps = 18/346 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS+LQRRR+NR                NS   ++SN   D ++   + KIAYDPEE+KL+
Sbjct: 1   MSSLQRRRLNRI---------------NSDTAESSN---DDEERSKSTKIAYDPEEAKLK 42

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           D++ +PTLTLMEEV+L+GL D++GYLSFWND+ISY LRGCI+IELALR KIRILDD ARK
Sbjct: 43  DDVTVPTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARK 102

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERLVEV+DGSKTGEVLLDE LQLMKNDEPL+I+NWIDLLSGETWN  KINYQLKQ
Sbjct: 103 RFDLSERLVEVVDGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQ 162

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRER++KGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSR MEL+YNE
Sbjct: 163 VRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNE 222

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFPETT +K+IRT+ALIC SY ANVLENVL++LEYEKRD AI+R+E I+S F+QYPF L+
Sbjct: 223 YFPETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLD 282

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K +D+ VS+NL+K V++EI  NPG  LQLE +AGVF+VFS+MDM+L
Sbjct: 283 KASDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/346 (71%), Positives = 291/346 (84%), Gaps = 17/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS LQRRRVN+++S              SS D   N   DG+     K++AYDPEE+KLR
Sbjct: 1   MSGLQRRRVNKSESI-------------SSQDPVVNDETDGE----GKRVAYDPEEAKLR 43

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           D+   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++L+D ARK
Sbjct: 44  DDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARK 103

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERLVEVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI++ FSQ+PF L+
Sbjct: 224 YFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALD 283

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           K T+ G+SVNLNKEV+EE+ +N    LQLE +AGVFEVFSRMD LL
Sbjct: 284 KQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/347 (70%), Positives = 292/347 (84%), Gaps = 14/347 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSG-DKTSNGPVDGDDNGINKKIAYDPEESKL 59
           MSTLQRRR            Q+ S++  SSG D   N P +      ++++AYDPEE K+
Sbjct: 1   MSTLQRRR-----------KQARSDSVGSSGTDSNDNEPTNR--QAESRRVAYDPEEDKI 47

Query: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119
           R+N+ +P LTLMEEV+L+GLRD+EGYLSFWND+ISYALRGCI+IELALRGKIRILDD AR
Sbjct: 48  RNNMSVPQLTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPAR 107

Query: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           KRF+LSERLVEV+D SKTGEVLLDE LQ+M+NDEPL ISNW+DLLSGETWN+ KINYQLK
Sbjct: 108 KRFELSERLVEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLK 167

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRER++KGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS+LV+R  E +YN
Sbjct: 168 QVRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYN 227

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299
           +YFPETTSFK IRT++LIC +YGANVLENVL +LEY+KRD  ++RAEE++  FSQYPFDL
Sbjct: 228 DYFPETTSFKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDL 287

Query: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           EK T+ G S+NLN  VKEEIE +P + L LEV+AGVFEVFS+MD+LL
Sbjct: 288 EKQTEFGTSINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 296/347 (85%), Gaps = 19/347 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-NGINKKIAYDPEESKL 59
           MS LQRRRVN+++S           N++S        PV  ++  G +K++AYDPEE+ L
Sbjct: 1   MSGLQRRRVNKSES-----------NYDSE-------PVISEEAEGESKRVAYDPEEAML 42

Query: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119
           +DN  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCILIELALRGKI++++DSAR
Sbjct: 43  KDNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSAR 102

Query: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           KRFD+SERLVEVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLK
Sbjct: 103 KRFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLK 162

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YN
Sbjct: 163 QVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYN 222

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299
           EYFP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI++ FSQ+PF L
Sbjct: 223 EYFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFAL 282

Query: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           +K T+ G+SVN+NKE++EEI+ N    L+LEV+AGVFEVFSRMD LL
Sbjct: 283 DKQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/344 (70%), Positives = 282/344 (81%), Gaps = 21/344 (6%)

Query: 3   TLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLRDN 62
           +LQRRRVN+ D+  T S+    N H+                    KI YD +E+KLRDN
Sbjct: 2   SLQRRRVNKGDT--TESIPQIDNEHD-------------------HKIVYDEQEAKLRDN 40

Query: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122
             +P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCILIELALRGKIR +DD ARKR+
Sbjct: 41  TSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY 100

Query: 123 DLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           D+SERL+EVIDGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVR
Sbjct: 101 DVSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR 160

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YF
Sbjct: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302
           P+  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI++ FS++PF L+K 
Sbjct: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280

Query: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
           T  GVSVNLNKE+ +E+ N+PG DLQLEV+AGVFEVFSRMD LL
Sbjct: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  480 bits (1236), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/344 (66%), Positives = 279/344 (81%), Gaps = 14/344 (4%)

Query: 3   TLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLRDN 62
           +LQRRRVN+    +T    S + +               ++ G+  K+AYDPEE KLR+N
Sbjct: 2   SLQRRRVNKTAGNETVGGASLNRSD--------------EEEGMTHKVAYDPEEQKLREN 47

Query: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122
            + PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCILIELALRG+I+++DD+ R+RF
Sbjct: 48  TREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRF 107

Query: 123 DLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           D SERL+EV+DGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVR
Sbjct: 108 DPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVR 167

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E F
Sbjct: 168 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELF 227

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302
           PET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++  FSQYPF L+KD
Sbjct: 228 PETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKD 287

Query: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
            + G+SVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 288 IETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  478 bits (1230), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 228/346 (65%), Positives = 283/346 (81%), Gaps = 17/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60
           MS +QRRR+NR  + D S       +H+ +    SN            K+A+DPEE+K++
Sbjct: 1   MSGVQRRRINRISNEDES-------DHSDNDQSRSNV----------SKVAFDPEEAKIK 43

Query: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120
           D++ +P LTLMEEV+L+GL D EGYLSFWND+ISY LRGCILIELALRGKIRI+DDSARK
Sbjct: 44  DDVSVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARK 103

Query: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
            FDLSERL+EVID SKTGEVLLDETLQLMKNDEP +I +WIDLLSGETWN  K+NYQLKQ
Sbjct: 104 SFDLSERLIEVIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQ 163

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERL+KGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE++KRR++S LV R + L YNE
Sbjct: 164 VRERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNE 223

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300
           YFPE+T+FK+IRT++LI  +Y ANVLENVL TLEYEKRDKA+SRAE ++++F  YPF L 
Sbjct: 224 YFPESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLV 283

Query: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
            + D  +S+NLN+ V++EI+ NP   LQLEV+AGVF+VF++MD+++
Sbjct: 284 NEPDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 215/273 (78%)

Query: 71  MEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLSERLVE 130
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCILIELA RG I+++DD +RKRFDLS+RL+E
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 131 VIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 190
           V++  KTGE LLDETLQ+MK++E  +IS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 191 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 250
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 251 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKDTDLGVSVN 310
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+   S YPF+ +  +   ++ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 311 LNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMD 343
           LN+ V+ E+  +   +L+LE IAGVFEVF +MD
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  335 bits (858), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 44  NGINKKIAYDPEESKLRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILI 103
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCILI
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 104 ELALRGKIRILDDSARKRFDLSERLVEVI-DGSKTGEVLLDETLQLMKNDEPLTISNWID 162
           ELALR KI+++DD  R  +D+S R++EV+   +KTG  LLDE L +M  + P +I NWID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 163 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 222
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 223 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 282
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 283 SRAEEIMSHFSQYPFDLEKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRM 342
            +AE++    S +P +L++    GV V++ K+++ E+  + G  L LEV+AGV +V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 343 DMLL 346
           D LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  232 bits (591), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 187/284 (65%), Gaps = 9/284 (3%)

Query: 66  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDLS 125
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALRGKI+ + +  +K+ DL+
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121

Query: 126 --ERLVEVIDGSKTGEVLLDETLQLMKNDEP-LTISNWIDLLSGETWNLLKINYQLKQVR 182
             E  +EVIDGS TG+ LLD+TL LMK ++   ++S+WI LLSGE+ N LK +YQL  VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302
           P+T S++++RT+ L C +YGA++L+      E E       RA  ++S FS++PF+L + 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQ- 299

Query: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346
               V  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 109 GKIRILDDSARKRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSG-E 167
           GK  + D  A K  DL++   + +D SK    +LDE LQL+ N++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 168 TWNLLKINYQLKQV 181
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

>ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar to
           uniprot|Q6Q5C1 Saccharomyces cerevisiae YLR065C
           Hypothetical ORF
          Length = 173

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 13/75 (17%)

Query: 65  IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRFDL 124
           IP + L      +  RD   Y+ F            IL+ L L G I +LD S R ++D 
Sbjct: 25  IPVVLLASTRQWISKRDIVNYIRF------------ILLHLPLLGCIYVLDSSGRPKYDS 72

Query: 125 SERLV-EVIDGSKTG 138
             +L+ E +D S++G
Sbjct: 73  KNKLIREGLDLSQSG 87

>KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {ON}
           similar to uniprot|P40208 Saccharomyces cerevisiae
           YMR135C GID8 Protein of unknown function involved in
           proteasome-dependent catabolite inactivation of
           fructose-1 6-bisphosphatase contains LisH and CTLH
           domains like Vid30p
          Length = 385

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 249 KIIRTLALICGSYGANVLENVLT 271
           +I+  + LIC ++GA VLENV T
Sbjct: 111 RILEAIELICSTFGAQVLENVKT 133

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 14/80 (17%)

Query: 86  LSFWNDSISYALRGCILIELALRGKIRILDDSARKR--------------FDLSERLVEV 131
           L F  D++    RGC  + +     +RI+ D+  K+              F ++E  V +
Sbjct: 150 LDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKKILTAVTNHLEKDYPFPIAEGSVSI 209

Query: 132 IDGSKTGEVLLDETLQLMKN 151
           +DG + G      T  L+KN
Sbjct: 210 MDGDEEGVFAWITTNYLLKN 229

>TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3.339
           YBR097W
          Length = 1420

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 194 VLRTEMKNFFLFDMA-THPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTS 247
           VL   ++ FF FD+  TH +  +SCK+ + R V ++L S ++  S + ++ +  S
Sbjct: 725 VLYPIVRPFFEFDVEFTHDLMLSSCKQPVSRTVYNLLCSWSLRASKSLFWQQVPS 779

>KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conserved
           hypothetical protein
          Length = 760

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 24/147 (16%)

Query: 101 ILIELALRGKIRILDDSARKRFDLSERLVEVIDGSKT-GEVLLDETLQLMKNDEP--LTI 157
           I  E  LRG++ I  +SA+K    SE L + +  SK   E L  ETL L + +E     I
Sbjct: 471 ISTEETLRGELDIAAESAKKELSKSEELRDSLIKSKNEQEALQAETLVLKEQNETSRSRI 530

Query: 158 SNWIDLLSGETWNLLKINYQLKQVRE---RLAKGLVDKGVLRTEMKNFFLFDMATHPIAD 214
           +  + L+S       ++  + ++ RE   +L +   +K VL T  K      MA   +  
Sbjct: 531 NELVQLVS-------QLEAEARKAREENSQLQQSFQEKDVLATHAK------MANVKLQK 577

Query: 215 ASCKEAIK----RRVLSVLVSRNMELS 237
              +E  K    RR L  L+ R MEL+
Sbjct: 578 DCQRERCKLLDGRRELD-LLRRQMELA 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,580,619
Number of extensions: 1643982
Number of successful extensions: 10423
Number of sequences better than 10.0: 70
Number of HSP's gapped: 10669
Number of HSP's successfully gapped: 70
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)