Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5435.441ON51151126520.0
Skud_4.6405.441ON51151122140.0
YDR371W (CTS2)5.441ON51151121480.0
Smik_4.6375.441ON51151121240.0
NCAS0F034205.441ON52551312371e-166
ZYRO0F10186g5.441ON51950312191e-163
TDEL0D026005.441ON52350511631e-154
Kpol_1062.255.441ON53351811611e-154
TBLA0A027905.441ON54752311401e-151
NDAI0B057105.441ON56350711081e-146
SAKL0G02684g5.441ON53948610771e-141
CAGL0A02904g5.441ON50149810501e-138
TPHA0E017205.441ON53746310381e-135
KNAG0C048705.441ON4584589951e-130
KAFR0E038105.441ON4904579521e-123
KLLA0E02333g5.441ON4804879171e-118
KLTH0F15906g5.441ON5154859201e-118
Ecym_45125.441ON5275109141e-117
ACL166W5.441ON4905029071e-116
Kwal_55.214025.441ON5164609091e-116
Smik_8.452.500ON39590800.28
YOR289W8.751ON251113760.74
NCAS0A079905.591ON957118723.4
KLTH0D07502g2.555ON50499705.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.543
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...  1026   0.0  
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   857   0.0  
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   832   0.0  
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   822   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   481   e-166
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   474   e-163
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   452   e-154
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   451   e-154
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   443   e-151
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   431   e-146
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   419   e-141
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   409   e-138
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   404   e-135
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   387   e-130
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   371   e-123
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   357   e-118
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   358   e-118
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   356   e-117
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   353   e-116
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   354   e-116
Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)    35   0.28 
YOR289W Chr15 (853357..854112) [756 bp, 251 aa] {ON} Putative pr...    34   0.74 
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    32   3.4  
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...    32   5.1  

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/511 (96%), Positives = 495/511 (96%)

Query: 1   MVEHSQHHRSNTSXXXXXXXXXXXXXXXXEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60
           MVEHSQHHRSNTS                EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM
Sbjct: 1   MVEHSQHHRSNTSIISHLLILLIAITIIIEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60

Query: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120
           VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST
Sbjct: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120

Query: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180
           DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS
Sbjct: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180

Query: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240
           IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV
Sbjct: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240

Query: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300
           RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG
Sbjct: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300

Query: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360
           SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT
Sbjct: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360

Query: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420
           KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI
Sbjct: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420

Query: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480
           FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM
Sbjct: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480

Query: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511
           FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK
Sbjct: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/511 (80%), Positives = 456/511 (89%), Gaps = 1/511 (0%)

Query: 1   MVEHSQHHRSNTSXXXXXXXXXXXXXXXXEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60
           M+ +S+  RS TS                EMCLYNK+FK+QRS+DIRDNF+NG  QVP+M
Sbjct: 1   MLGYSEQQRSKTSIISHLLILLIIITIIIEMCLYNKIFKSQRSDDIRDNFRNGGDQVPSM 60

Query: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120
           VQNQKP     GYVSGVYYSNWSPY PRFHFPHDINL QVSHVYYAFFRI+ KTG I ST
Sbjct: 61  VQNQKPHDGGKGYVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIEST 120

Query: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180
           DSWSDLEM+LYKPLAIK+SQLV++NL+D+ +Q+ILPLGC+GELFYLKNACS +KFK IMS
Sbjct: 121 DSWSDLEMNLYKPLAIKSSQLVENNLNDS-VQNILPLGCVGELFYLKNACSEKKFKVIMS 179

Query: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240
           IGGWSDSENFKTIV ++KLLQNFVDSSVETMFKLGFDGIDIDWEFPENNK+EPQGYLKLV
Sbjct: 180 IGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLV 239

Query: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300
           +MLRLKLN+LESQIFG S +DHF++SIAAPAFKDKL+FLPI+EIDQYID+WNMMTYDYYG
Sbjct: 240 KMLRLKLNNLESQIFGESIEDHFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYG 299

Query: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360
           SWSETTGYHSNLFSETELSGNFA+HYMI EF V+  KLVLGMAAYGRSFHIKD KF+PFT
Sbjct: 300 SWSETTGYHSNLFSETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFT 359

Query: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420
           +NTVLINQ FKGVGKPGKEIDKADGKEGIWPYK+LPKKGT EQYDPKYVSAYCFDEKNSI
Sbjct: 360 QNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSI 419

Query: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480
           FI YDNT+S KTKA+YVMH +LGGGFWWESCGE + +KSRSLINAFNE + FNVSSKPSM
Sbjct: 420 FISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSM 479

Query: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511
           FQD RV+K+YL+KYGD GFL+PYLKHLES K
Sbjct: 480 FQDMRVIKFYLNKYGDDGFLSPYLKHLESSK 510

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/511 (77%), Positives = 446/511 (87%), Gaps = 1/511 (0%)

Query: 1   MVEHSQHHRSNTSXXXXXXXXXXXXXXXXEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60
           MV HS  HRS +S                EMCLYNK+FKNQRS+DIRDNF NG H+VP+ 
Sbjct: 1   MVGHSAQHRSKSSLVSHLLILLIFITIIIEMCLYNKIFKNQRSDDIRDNFNNGGHRVPSN 60

Query: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120
           VQN      D+ ++SGVYYSNWSPYKPRFHFPHDINL+QVSH+YYAFF+I+ +TG I +T
Sbjct: 61  VQNHGTHIRDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENT 120

Query: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180
           DSWSDLEM+LYK LAIK S+L+ ++  +N++Q+ILPLGCIGELFYLKN CS +KFK IMS
Sbjct: 121 DSWSDLEMNLYKSLAIKNSELIKES-SNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMS 179

Query: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240
           IGGWSDSENFK I+K++KLLQNFVDSSVETMF+LGFDGID+DWEFP NN+ EP+GYLKLV
Sbjct: 180 IGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLV 239

Query: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300
           RMLRLKLNSLESQIFG  T+DHF+LSIAAPAFKDKL++LPI EIDQY+D+WNMMTYDYYG
Sbjct: 240 RMLRLKLNSLESQIFGKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYG 299

Query: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360
           SWSETTGYHSNLFSETEL+GNFA+HYMI  FGVN RKLVLGMAAYGRSFHIKD+KF PF 
Sbjct: 300 SWSETTGYHSNLFSETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFN 359

Query: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420
           +NTVLIN+ FKGVGKP KEIDKADGKEGIWPYKNLPK GT EQYDPKYVSAYCFDEKNSI
Sbjct: 360 QNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSI 419

Query: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480
           FI YDNT+S+KTKA+YV H  LGGGFWWESCGE YA++SRSLINAFNE LHFNVSSKPS+
Sbjct: 420 FISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSI 479

Query: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511
           FQD RV KYYL+KYGDGGFL+PYLKHL+S K
Sbjct: 480 FQDVRVKKYYLNKYGDGGFLSPYLKHLDSRK 510

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/511 (76%), Positives = 443/511 (86%), Gaps = 1/511 (0%)

Query: 1   MVEHSQHHRSNTSXXXXXXXXXXXXXXXXEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60
           MV  S +H S TS                EMCLY K+FKNQRS  IRD+F NG H+VPNM
Sbjct: 1   MVSLSLYHGSKTSLISHLLILLIIVTIVIEMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM 60

Query: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120
            Q Q P+ D +G+VSGVYYSNWSPYKPRFHFPHDINL QVSHVYYAFFRI+P+TG I ST
Sbjct: 61  DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST 120

Query: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180
           D+WSDLEM+LYKPLAIK+S+L+D N   N++Q ILPLGCIGELFYLK++CSG+KFK IMS
Sbjct: 121 DNWSDLEMNLYKPLAIKSSELIDGN-SSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMS 179

Query: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240
           IGGWSDSENFK I+KNE LLQ FVDSSVETMFKLGFDGID+DWEFPENNK EPQGYLKLV
Sbjct: 180 IGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLV 239

Query: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300
           RMLR KLNSLESQIFG   +DHF+LSIAAPAFKDKLY+LPI EIDQYID+WNMMTYDYYG
Sbjct: 240 RMLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYG 299

Query: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360
           SWSETTGYHSNLFSETELSGNFAIHYMI +FG+N RKLVLGMAAYGRSFHIK   F+PFT
Sbjct: 300 SWSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFT 359

Query: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420
           +NT+LINQ FKGVGK  KE++KADGKEGIWPYKNLPKKGT E+YDPKYVSAYCFDEKNSI
Sbjct: 360 QNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSI 419

Query: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480
           FI YDNT+S+KTKA+YV+H +LGGGFWWESCGE YA++SRSLI+AFNE L  NVS+KPSM
Sbjct: 420 FISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSM 479

Query: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511
           F+++RV+ +YL+KYG+ GFL PYLKH++S K
Sbjct: 480 FENERVVNFYLNKYGNNGFLTPYLKHMDSFK 510

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  481 bits (1237), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 257/513 (50%), Positives = 339/513 (66%), Gaps = 53/513 (10%)

Query: 30  EMCLYNKLFKNQRSED-IRDNFQNGRHQVPNM-----VQNQKPSGDDDGYVSGVYYSNWS 83
           +MCL+   FK + ++D I+ +F+NG   +PN      + NQ  S  + GY+SG+YYS+WS
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNG--TIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWS 84

Query: 84  PYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVD 143
           PYKPRFHFPHDI+L +VSH+YYAFF +DPKTG +  +D WSDL+MDLYKPL++K   L  
Sbjct: 85  PYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNL-- 142

Query: 144 DNLDDNNM------QSILPLGCIGELFYLKNAC---SGRKFKSIMSIGGWSDSENFKTIV 194
            NL DN        +  LPLGCIGELFYLK++     G   K I+SIGGWS+ + F  +V
Sbjct: 143 -NLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLV 201

Query: 195 KNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQI 254
           ++ +  +NF+DS+VETMF+ GFDGID+DWEFP+++ +EP  YL+++  LR K++ LE +I
Sbjct: 202 RDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEI 261

Query: 255 FGGSTKDH--FELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNL 312
           F G TKDH  F+LS+A PAF  KL  LPI ++DQY+D+WNMMTYDYYGSWSE TGYH NL
Sbjct: 262 F-GETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNL 320

Query: 313 FS-----------------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDD 354
           F+                    L+ N AI +MI    V   K+VLGMAAYGR F H+K  
Sbjct: 321 FNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR 380

Query: 355 KFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCF 414
           +         LINQ+FKGVGK G        + G+W Y  LP KGT E YDP Y +A+C+
Sbjct: 381 Q-----GVDTLINQKFKGVGKGG-----LGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCY 430

Query: 415 DEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAF-NEALHFN 473
           D+K+  FIGYDN +S+K KA YV   ELGGGFWWESCG+D+ +K RSL+  F NE     
Sbjct: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490

Query: 474 -VSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLK 505
             S +  +F+ K  + YYL++YG  GFL+  L+
Sbjct: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  474 bits (1219), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 236/503 (46%), Positives = 319/503 (63%), Gaps = 34/503 (6%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRF 89
           EMC Y K+FK+    D+ D+            ++      D+GY SG+YYS+WSPY PR 
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84

Query: 90  HFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDN 149
           HFPHDI+  +VSH+YYAFF ID  TG + S+D WSD +MDLYKPLA+K +QL   N D +
Sbjct: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144

Query: 150 NMQSILPLGCIGELFYLKNAC-----SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFV 204
               +LP GC+GELFYL++        GR FK +M++GGWS+ + +  +V++ + ++NF+
Sbjct: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204

Query: 205 DSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGS-TKDHF 263
           +S VETMFK GFDGID+DWEFP+N+  EP+ YL+L R +RLK + LE  IF G      F
Sbjct: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264

Query: 264 ELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFS--------- 314
           +LS+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324

Query: 315 -------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPFTKNTVLI 366
                  +  L  N AI  MI  FGV+ RK+ LGMAAYGR F H+K       + +   I
Sbjct: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379

Query: 367 NQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDN 426
           ++ F GVG        ++G+ G+W Y  LP KG+ E+YDP+YVS +CFD K   F+GYDN
Sbjct: 380 DKSFHGVGG------ASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433

Query: 427 TESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRV 486
            ES+K KADYV    L GGFWWESCG+++ D  RSL+NAF   +     ++ S++     
Sbjct: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493

Query: 487 MKYYLSKYGDGGFLAPYLKHLES 509
           ++YYL K+G   FL+P++  + S
Sbjct: 494 LRYYLEKFGQDEFLSPFIIRIIS 516

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 235/505 (46%), Positives = 317/505 (62%), Gaps = 40/505 (7%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDG-YVSGVYYSNWSPYKPR 88
           EMC Y K+F       + D  Q+   Q   +V N  P   + G Y+SG+YYSNWSPY PR
Sbjct: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQA-QLVTN--PGTVEPGQYLSGLYYSNWSPYSPR 79

Query: 89  FHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDD 148
            HFPHDI+L +VSH+YYAFF +D  TG +   D WSD+ MDLYKP+AIK ++L  +  +D
Sbjct: 80  MHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKLNPEVKND 139

Query: 149 NNMQS-ILPLGCIGELFYLKNAC-----SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQN 202
              Q  ILP GC+GELFY++NA      + R FK IM +GGWS+ E F  +V+N K +  
Sbjct: 140 LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199

Query: 203 FVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKD- 261
           F+DS +ETMFK GFDGID+DWEFPE++  EPQ YL+L + L+ ++N LE  IFG +    
Sbjct: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259

Query: 262 HFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNL-------FS 314
            F+LS+A PAF +KL  LPI E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319

Query: 315 ETE------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKN 362
           ET             L  + AI +M+   GVN  K+ LGMAAYGR F          + +
Sbjct: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375

Query: 363 TVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFI 422
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429

Query: 423 GYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQ 482
           GYD+ ES++ KA YV    L GGFWWESCG+D+A++SRSL+NAF   + F       M++
Sbjct: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489

Query: 483 DKRVMKYYLSKYGDGGFLAPYLKHL 507
              V++YY++K+G+  FL+P++ +L
Sbjct: 490 QTPVLRYYVNKFGNDAFLSPFILNL 514

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  451 bits (1161), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/518 (44%), Positives = 329/518 (63%), Gaps = 55/518 (10%)

Query: 30  EMCLYNKLFKN-QRSEDIRDNFQNGRHQVPNMVQNQK-PSGDDDGYVSGVYYSNWSPYKP 87
           E  LY K  K+  + E I D+    +     +V  +  P+  D GY  GVYYSNWSPY P
Sbjct: 24  ESFLYQKFLKHGSKEESIEDSINESQ-----IVYGKSFPNNPDSGYDVGVYYSNWSPYTP 78

Query: 88  RFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLD 147
           R H PHD++  +++HVYYAFF +D KTG + ++D+WSD EMD YKPLA+K  +L  D+  
Sbjct: 79  RLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLDHFF 138

Query: 148 DNNMQSILPLGCIGELFYLK-----NACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQN 202
           +   ++ LP+GCIGELFYL+     ++ + RKFK IMS+GGWS+ E F  ++++ K L  
Sbjct: 139 NPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKKLDA 198

Query: 203 FVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGS---- 258
           FV+S +E MF  GFDGI++DWEFP+++K+EP+ YL+LV+ L+ K N LE +IF  S    
Sbjct: 199 FVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSGNGN 258

Query: 259 --TKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSET 316
              +  F LSIAAPAFK+KL  L + E+D Y+D WNMMTYDY+G WSE TGYHSNL+S  
Sbjct: 259 HSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQ 318

Query: 317 E---------------------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF 349
           E                           L+G++AI+Y+I ++ +NP+K+ LGMAAYGR F
Sbjct: 319 ETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYGRGF 378

Query: 350 HIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYV 409
                K    +++T  IN+ ++GVG        ++G+ G+W Y  LP K + E++DP YV
Sbjct: 379 ----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDPDYV 428

Query: 410 SAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEA 469
           SA+C+D+K+  F+GYDN +S+K KA YV    L GGFWWESCG+D+ +  +SL+NAF + 
Sbjct: 429 SAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDE 488

Query: 470 LHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLKHL 507
           +        +MF +  V+KYYL   GD GFL+ ++  L
Sbjct: 489 IGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  443 bits (1140), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 328/523 (62%), Gaps = 51/523 (9%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQ-----NGRHQVPNMVQNQKPS----GDDDGYVSGVYYS 80
           EMC Y+KLF  ++ + + +  Q        + V N +++ K +     +  GY SGVYYS
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 81  NWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQ 140
           NWSPY PR HFPHDI+  ++SHVYY+FF ++   G +   D WSD+EMDLYKPL+IK  +
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 141 LVD--DNLDDNNMQSI----LPLGCIGELFYLKNAC--------SGRKFKSIMSIGGWSD 186
           L +  D  ++   QS     LP GCIGE FYL+N+         + + FK IM+IGGWS+
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 187 SENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLK 246
            ++F  + K+ + + NFV S++E MF+ GFDGID+DWEFP+NN  EP  YLK+++ LR  
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 247 LNSLESQIFGGST-----KDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGS 301
           +N LE +I+  S      + HF+LS+A+PAF++KL  LPI E+++ +D+WNMMTYDY G 
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 302 WSETTGYHSNLFS-------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF----- 349
           WSE TGYHSNL+        E  L+ + AI YMI   GV P KLVLG+A YGR +     
Sbjct: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384

Query: 350 -HI----KDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQY 404
            HI    K++K R  T + V I+ ++KGVG       +++G+ G+W Y  LP KG+ EQ+
Sbjct: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438

Query: 405 DPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLIN 464
           DPK+VSAYC+D K +  + YDN ES+  K  YV    L GGF WESCG+ + +  RSLI 
Sbjct: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498

Query: 465 AFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLKHL 507
           AF   L      + S+FQD++  ++YL ++G+ G+L+  +  L
Sbjct: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  431 bits (1108), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 232/507 (45%), Positives = 315/507 (62%), Gaps = 61/507 (12%)

Query: 51  QNGRHQVP---NMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAF 107
           Q+  H  P   ++V   K    ++ +VSGVYYS+WSPYKPR+HFPHDI+L +++HVYY+F
Sbjct: 68  QHHSHLFPQENDIVNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSF 127

Query: 108 FRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLV--DDNLDDNN----------MQSIL 155
           F ++  TG +  +D WSDL+MDLYKPL++K + L   D  L D N          M+  L
Sbjct: 128 FLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQL 187

Query: 156 PLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLG 215
           PLGC+GELFYLK     + FK IMSIGGWS+ E+F ++V+++  L  F++SSVE MFK G
Sbjct: 188 PLGCVGELFYLKKF---QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYG 244

Query: 216 FDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGST-----KDH------FE 264
           FDGID+DWEFPE++  EP  YL++V+ LR +++ LE  IF  S       DH      FE
Sbjct: 245 FDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFE 304

Query: 265 LSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF----------- 313
           LS+A PAF +KL  LPI E+++YID+WNMMTYDYYG WSE TGYH NL+           
Sbjct: 305 LSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQ 364

Query: 314 -------SETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLI 366
                  S   L+ N AI+YM+    V+ RKLVLG+AAYGR F     K +    + + I
Sbjct: 365 YKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGF----TKVKVNKNDELFI 420

Query: 367 NQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDN 426
           N++F GVG        + G+ G+W Y  LP K + E +DP YVSA+C+D K   F+GYDN
Sbjct: 421 NKKFDGVGGA------SAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDN 474

Query: 427 TESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPS----MFQ 482
            +++K KA YV    L GGFWWESCG+D+    RSL+NAF   L      K      +++
Sbjct: 475 VDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYE 534

Query: 483 DKRVMKYYLSKYGDGGFLAPYLKHLES 509
               +KYYL+ +G+ GFL+P+   + S
Sbjct: 535 QPDTIKYYLNYFGNDGFLSPFFIQIMS 561

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  419 bits (1077), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 213/486 (43%), Positives = 302/486 (62%), Gaps = 45/486 (9%)

Query: 48  DNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAF 107
           DN QN + +V         S D   Y+SGVYY+NWSPY PR HFPHD+N  ++++V+Y+F
Sbjct: 70  DNNQNLQEEV------GPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSF 123

Query: 108 FRIDPKTGCIGSTDSWSDLEMDLYKPL--AIKASQLVDDNLD--DNNMQSILPLGCIGEL 163
           F +DPK+G + S+D WSD +MDLYK      KA+ L   +     ++ + +LP+GCIGEL
Sbjct: 124 FVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGEL 183

Query: 164 FYLKNAC---------SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKL 214
           FYLK +            R FK  MS+GGWS+ + F  IV+++     F+ + VETMF+ 
Sbjct: 184 FYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQY 243

Query: 215 GFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGST-KDHFELSIAAPAFK 273
           GFDG+DIDWEFP+N+ +EP+ YL ++R LR  L+ LE  IF      +HF L++A PAFK
Sbjct: 244 GFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFK 303

Query: 274 DKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSE--------------TELS 319
           +KL  LP+ ++D Y+D WN+M YDY+G WSE TGYHSNL+SE               +L+
Sbjct: 304 EKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLN 363

Query: 320 GNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQFKGVGKPGKE 379
            + A+ Y++  FG+N RK+VLGMAAYGR F     + +    +   I + + GVG     
Sbjct: 364 ADSAVKYLLKNFGINSRKVVLGMAAYGRGF----TRVKTTANSGSYIGKPYNGVG----- 414

Query: 380 IDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMH 439
              ++G+ G+W Y  LP  GT E +DP+ VSAY FD K+  F+GYDN +S++ KA YV +
Sbjct: 415 -GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKN 473

Query: 440 TELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGF 499
             L GGFWWESCG+++ D+ +SL+NAF   L      +PS++    V++YYL  Y   GF
Sbjct: 474 HNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQ-GF 532

Query: 500 LAPYLK 505
           L+   K
Sbjct: 533 LSRVFK 538

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  409 bits (1050), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 205/498 (41%), Positives = 305/498 (61%), Gaps = 43/498 (8%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRF 89
           +M L+ K+F+  +     D+++     V +          +  Y++G+YYSNWSPY+PR 
Sbjct: 23  QMSLHYKIFQKLKRRSQSDDYRMPESDVLS----------NTSYIAGLYYSNWSPYEPRL 72

Query: 90  HFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDN 149
           HFPHDI+ E+VSH+YYAF  IDP+TG + S+D WSD +++L K    +  + +      +
Sbjct: 73  HFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAK----QCREYMFKRFTGD 128

Query: 150 NMQSIL----PLGCIGELFYLK---NACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQN 202
            ++++     P GCIGEL YL+   +    R  K IMS+GGWS+ E+F  +V++E   +N
Sbjct: 129 ELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELKFKN 188

Query: 203 FVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKDH 262
           F++S +ETM   GFDGID+DWEFPE++  EP  YL++ R L+L+L  LE+ I G  +   
Sbjct: 189 FINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHSNKT 248

Query: 263 FELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSE------- 315
           F+LS+A PAFKDKL  LPI ++D+YID WN+MTYDYYG WSE TG H+NL++E       
Sbjct: 249 FQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKLLHL 308

Query: 316 ------TELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQ 369
                   LSG+ AI+YM+    ++PRK++LGMAAYGR F   D K    T        +
Sbjct: 309 HRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMK---STNPHNPYGLK 365

Query: 370 FKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNTES 429
           F GVG        ++G+ G+W Y  LP  G+ E+YD ++V AYC+D++    +GYDN  S
Sbjct: 366 FSGVG------GASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTS 419

Query: 430 IKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKY 489
           +  KA+Y+M   LGG FWWESCG+ + +  RSL+N +   +    ++K +++   ++  Y
Sbjct: 420 VIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDY 479

Query: 490 YLSKYGDGGFLAPYLKHL 507
           YL  Y   GFL  ++K +
Sbjct: 480 YLENYDTNGFLTGFIKDI 497

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  404 bits (1038), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 208/463 (44%), Positives = 295/463 (63%), Gaps = 44/463 (9%)

Query: 73  YVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYK 132
           Y  GVYYSNWSPY PR  FPHDI+  +VSHVYY+F  +D   G I S+D+WSD ++D+YK
Sbjct: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137

Query: 133 PLAIKASQLVDDNLDDNNM---QSILPLGCIGELFYLKNA---CSGRK---FKSIMSIGG 183
           PL +   Q VD++ D   +   + +LP+GCIGE FYL+N      G K   FK  MS+GG
Sbjct: 138 PLYLSLGQ-VDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGG 196

Query: 184 WSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRML 243
           WS+ E F  +V++ + +  F++S ++TMF  GFDGID+DWEFPE++  EP  YL +++ L
Sbjct: 197 WSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRL 256

Query: 244 RLKLNSLESQIFG-----GSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDY 298
           ++K+  LE+ I+       ++  HFELSIAAPAF +KL  LP+ ++D+++D WNMMTYDY
Sbjct: 257 KMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDY 316

Query: 299 YGSWSETTGYHSNLFSETELSGNF----------------AIHYMIGEFGVNPRKLVLGM 342
            G WS+ TGYHSNLFS  ++SG+                 A+ YM     ++ RK++LGM
Sbjct: 317 SGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGM 376

Query: 343 AAYGRSFH-IKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTT 401
           AAYGR F  +   K      N  L  ++F GV   G   D+     G+W Y  LP KG+ 
Sbjct: 377 AAYGRGFSGVSKSK-----TNGKLTGKKFNGVS--GSSPDEP----GVWLYNKLPIKGSK 425

Query: 402 EQYDPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRS 461
           E++D + VSAYC+D K+ IF+ YDN++S+  K+ YV    LGGGF WE+CGE   +   S
Sbjct: 426 EEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLS 485

Query: 462 LINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYL 504
           LIN+F   ++ N+  + SMF +++V++YYL KYG  GFL+ Y+
Sbjct: 486 LINSFTFDMN-NIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/458 (43%), Positives = 283/458 (61%), Gaps = 43/458 (9%)

Query: 55  HQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKT 114
           HQ P     Q P   +  YVSGVYYS+WSPY+PR HFP +I+  +++H+YY+FF +D  +
Sbjct: 37  HQPPA----QCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADS 92

Query: 115 GCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRK 174
             +   DSWSD+EM + K   +K                    GCIG L  L++   G  
Sbjct: 93  SALKLGDSWSDIEMPMGKNTVLK--------------------GCIGALNSLRDEKPG-- 130

Query: 175 FKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQ 234
           FK+IM++GGWS+ + F   ++ +  ++    S VETMF+ GFDGID+DWE+P+++  EP+
Sbjct: 131 FKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPR 190

Query: 235 GYLKLVRMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMM 294
            YL+L+R +R  +N LE  I+G   K  F LS+A PAF DKL   PI E+DQYID+WNMM
Sbjct: 191 IYLELMRKIRQHMNELEIAIWG-DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMM 249

Query: 295 TYDYYGSWSETTGYHSNL------FSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRS 348
           TYDYYG WS  TG+HSNL      FSE  L  + AI YM  + G+N RK+VLGMA YGR 
Sbjct: 250 TYDYYGEWSSGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRG 309

Query: 349 F-HIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPK 407
           F ++K+   +   K + LIN++FKGVG       +++G+ G+W Y  LP +GT E +D +
Sbjct: 310 FTNVKEGDPK---KTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQ 360

Query: 408 YVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFN 467
           Y SAYCFD K    +GYDN +S + KA YV    L GGFWWESCG  + +  +SL++ FN
Sbjct: 361 YGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFN 420

Query: 468 EALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLK 505
           E +     ++ +++QD ++ ++YL  +   GFLA   K
Sbjct: 421 EDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  371 bits (952), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 194/457 (42%), Positives = 280/457 (61%), Gaps = 50/457 (10%)

Query: 73  YVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYK 132
           +  G+YYSNWS Y+PR HFPH+IN + +SHVYYAFF +D K G + S D W+D +    +
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----R 113

Query: 133 PLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKT 192
           P+ +K ++LV  N              +GELF LK      + K IM IGGWS+ E +  
Sbjct: 114 PI-LKNNKLVKGN--------------VGELFDLKMK---NRVKCIMCIGGWSNREAWHI 155

Query: 193 IVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLES 252
              +   +++F + +V+ MF+ GFDGID+DWE+PE++ +EPQ YL+++R ++  +N LES
Sbjct: 156 FSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLES 215

Query: 253 QIF--GGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHS 310
           +IF    +T  +FELS+A PAFKDKL   P+ E+D  ID+WNMMTYDYYG WSE TGYHS
Sbjct: 216 EIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHS 275

Query: 311 NLF-----------------SETE-LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIK 352
           NL+                 SE E L+G++A+ YMI + G+   K++LGMAAYGR F   
Sbjct: 276 NLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNV 334

Query: 353 DDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAY 412
           D       ++   I + F GVG        ++G+ G+W Y  LP  GT EQ+DP+YVS Y
Sbjct: 335 DVPTPRPNESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGY 388

Query: 413 CFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHF 472
           CF+     F+GYD  +S++ K  Y+   ++GGGFWWESCG+ + +  RSL+NA+ + L  
Sbjct: 389 CFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGR 448

Query: 473 NVSSKP-SMFQDKRVMKYYLSKYGDGGFLAPYLKHLE 508
           +   KP S++++   + +Y   +   GFL+ YLK  E
Sbjct: 449 DNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLKEYE 485

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  357 bits (917), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 283/487 (58%), Gaps = 66/487 (13%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQK-PSGDDDGYVSGVYYSNWSPYKPR 88
           EMC+   LF ++    I+     GR     +  + + PS   DG+    YYSNWSPY  R
Sbjct: 26  EMCIVPWLFLDK----IKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNAR 81

Query: 89  FHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDD 148
            H P DI   Q++HVYYAFF +D K+G + S+DSWSD E+    PL++            
Sbjct: 82  NHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK--------- 128

Query: 149 NNMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSV 208
                    GCI EL  +K   S  +FK+I+ +GGWS+ E +K I K+EK ++ F++++V
Sbjct: 129 ---------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAV 178

Query: 209 ETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKD----HFE 264
           + MF+ GFDGID+DWEFPE +  EP  YL+++R +R  ++ LE QIFG   ++    HF+
Sbjct: 179 DCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQ 238

Query: 265 LSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF----------- 313
           LS+A PAF +KL  LPI+E+ +Y+D WNMM YD++G WS+ TGYHSNL+           
Sbjct: 239 LSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLS 298

Query: 314 ---SETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF---HIKDDKFRPFTKNTVLIN 367
              S + LS + A+  M     ++ R++ LGMAAYGR F      DD +         + 
Sbjct: 299 NRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNY---------LG 349

Query: 368 QQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNT 427
           +++ GVG        ++G+ GIW Y  LP  G+ EQ+D   VSAYCFD K+  F+GYDN 
Sbjct: 350 KKYHGVG------GGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNV 403

Query: 428 ESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVM 487
           +S+  K  Y+    L GGFWWESCG D  D  +SL+NAF++ +  +     S+F+  +V 
Sbjct: 404 QSMDIKGKYIKKKNLNGGFWWESCG-DSKDPRKSLVNAFSKEIGLS-EGFVSLFKSDKVK 461

Query: 488 KYYLSKY 494
           +++L KY
Sbjct: 462 QFHLQKY 468

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  358 bits (920), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/485 (41%), Positives = 293/485 (60%), Gaps = 44/485 (9%)

Query: 47  RDNFQN-GRHQVPNMVQNQKPSG----DDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVS 101
           +++F N GR        N   +G    ++ G+V+G+YYSNWSPY  R HFPHDI+  +++
Sbjct: 40  QEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKHFPHDIDFRKLT 99

Query: 102 HVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIG 161
           HVYYAF  ++ +TG    +D WSD++MDLYK +     +L          +  LPLGCIG
Sbjct: 100 HVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKLDLRAQFPTGSKDKLPLGCIG 159

Query: 162 ELFYLK---------NACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMF 212
           ELF+LK          +     FK+IMS+GGWS+ E F ++V++   L+ F+DS V  MF
Sbjct: 160 ELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMF 219

Query: 213 KLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGST-KDHFELSIAAPA 271
           + GFDGIDIDWEFP+N+  EP+ YL++++ LR +L++LESQIFG    K HF L+ A  A
Sbjct: 220 EYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKHHFALTSAISA 279

Query: 272 FKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSETEL---------SGNF 322
            ++ L +LP+ E D+Y+D+WN+M YD+ G+WS  T Y SNL++  +          S + 
Sbjct: 280 DEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKRSTNGRGSADK 339

Query: 323 AIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQFKGV-GKPGKEID 381
           A+ ++  +  +  +K+VLGM AYGR F           K   + ++  + V GKP +++ 
Sbjct: 340 AVRFLTDKSKLASKKIVLGMPAYGRGF-----------KGVEVSHKSIENVIGKPFQDVS 388

Query: 382 -KADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCF----DEKNSIFIGYDNTESIKTKADY 436
             ++G+EGI  YK LP KG  E +D   VSAYC     ++K +  I YDN +S+  KA Y
Sbjct: 389 GSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDNVDSMIQKAHY 448

Query: 437 VMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKYYLSKYGD 496
           V    LGGGFWWESCGEDY  K +SL+ AF + +     ++P+++    V+++YL K   
Sbjct: 449 VEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKTEPTIYSLPEVVQHYL-KLHP 505

Query: 497 GGFLA 501
           GGFLA
Sbjct: 506 GGFLA 510

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  356 bits (914), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/510 (40%), Positives = 296/510 (58%), Gaps = 70/510 (13%)

Query: 30  EMCLYNKL----FKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPY 85
           EM    KL    FK  RS+  R         V   +Q+ K       Y  GVYY++WSPY
Sbjct: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHGK-------YAVGVYYTSWSPY 75

Query: 86  KPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDN 145
           +PR HFPHDI+ ++V++V YAFF +DPKTG +  TDSWSDLEM  + P   +        
Sbjct: 76  EPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT----- 130

Query: 146 LDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVD 205
                       G IGEL YLK       F+  M++GGWS+ E F  IV++E+ L+NFV+
Sbjct: 131 ------------GMIGELNYLK-LQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVN 177

Query: 206 SSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKDH--F 263
           S+++ MF+ GFDGID+DWEFP+++  EP  YL++   LR K++ LE +I+G +  D+  F
Sbjct: 178 STIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKF 237

Query: 264 ELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSETE------ 317
           ELS+A PAF   L  LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +      
Sbjct: 238 ELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELK 297

Query: 318 --------------LSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF---HIKDDKFRPFT 360
                         L+ + AI  M+  F V+ +K+ LGM AYGR F     KDD      
Sbjct: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDD----- 352

Query: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420
               L+N+++ GVG        ++G+ GIW Y  LP   T E++D ++VSAYCFD+    
Sbjct: 353 ---DLLNKKYSGVGG------GSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKT 403

Query: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480
           F+GYDN +S++ K+DYV    L GGF+WESCG+ + D  R+L+ AF++ L  +    P++
Sbjct: 404 FVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQEL--SEMRIPTI 461

Query: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESL 510
           F+D R + YYL     G   + + +HL+ +
Sbjct: 462 FKDPRAIAYYLKHRQKGFLYSLFSQHLQKI 491

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  353 bits (907), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/502 (40%), Positives = 290/502 (57%), Gaps = 62/502 (12%)

Query: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRF 89
           EM    KL K + S  IR        +   +     P G+   Y  GVYYS+WSPYKPR 
Sbjct: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPDGE---YTVGVYYSSWSPYKPRL 79

Query: 90  HFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDN 149
           H+P +I+ ++V+HVYYAFF +D KTG IGS D WSD +M    P+ +     +   L+  
Sbjct: 80  HYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNLTG---MPRGLN-- 130

Query: 150 NMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVE 209
                   G IGEL YLK    G  FK +M++GGWS+ E F  IV++E+   NF+DS+++
Sbjct: 131 --------GAIGELNYLKTR-PGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAID 181

Query: 210 TMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIF--GGSTKDHFELSI 267
            MF+ GFDGID+DWEFP+++  EPQ YL++   LR K++ LE  I+  GG+T+  F LS+
Sbjct: 182 AMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSM 241

Query: 268 AAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSET----------- 316
           AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T           
Sbjct: 242 AAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKR 301

Query: 317 -----------ELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPFTKNTV 364
                      EL+ + AI  M  +F V+PRK+ LGMAAYGR F +++ D          
Sbjct: 302 RYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGD-------GEQ 354

Query: 365 LINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGY 424
           LI Q++            ++G+ G+W Y  LP     E++D  +VSAY +D      + Y
Sbjct: 355 LIGQKYS------GVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVY 408

Query: 425 DNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDK 484
           DN +S+K K +YV   +L G F WESCG+++ DK R+L+ AF E +    + K + ++D 
Sbjct: 409 DNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENM--KGARKATAYKDS 466

Query: 485 RVMKYYLSKYGDGGFLAPYLKH 506
           ++++YYL    + GFL P  +H
Sbjct: 467 KLIQYYLRTRPE-GFLVPMYRH 487

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  354 bits (909), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 195/460 (42%), Positives = 278/460 (60%), Gaps = 36/460 (7%)

Query: 70  DDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMD 129
           + G  SG+YYSNWSPYK R HFPHDI+  +++ V+Y+F  ++ +TG    +D WSD++MD
Sbjct: 68  ERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMD 127

Query: 130 LYKPLAIKASQLVDDNLD-DNNMQSILPLGCIGELFYLK-----NACSG----RKFKSIM 179
           LYK +   A + VD       + ++ LPLGCIGELFYLK     +   G    + FK+IM
Sbjct: 128 LYKQM-FSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVKNFKTIM 186

Query: 180 SIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKL 239
           S+GGWS+ E F+++V++   ++ F++S V+ MFK GFDGIDIDWEFP+N+  EP+ YL +
Sbjct: 187 SVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDM 246

Query: 240 VRMLRLKLNSLESQIFGGST-KDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDY 298
           +R LR KL+ LES IFG      HF L+ A  A    L +LP+ EID+Y+D WN+M YD+
Sbjct: 247 MRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDF 306

Query: 299 YGSWSETTGYHSNLFSETEL----------SGNFAIHYMIGEFGVNPRKLVLGMAAYGRS 348
            G+WS  T Y SNL+S + L          S + A+  ++ +  +  +K+VLGM AYGR 
Sbjct: 307 SGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRG 366

Query: 349 FHIKDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKY 408
           F        P      +I Q F+ V         ++G+ GI  Y  LP KG  E +D   
Sbjct: 367 FK---GVSVPHHSEHNVIGQSFQQVS------GLSEGESGISLYNQLPLKGGQEWFDQDA 417

Query: 409 VSAYCF----DEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLIN 464
           VSAY      +++ +  + YDN +S+K KA YV+   LGGGFWWESCGE+Y D SRSL  
Sbjct: 418 VSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTR 477

Query: 465 AFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYL 504
           AF + + +   + P+++   +V +YY  KY D GFLA  +
Sbjct: 478 AFTQEIKYLNKTVPTIYALPQVGEYYHKKYPD-GFLASII 516

>Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)
          Length = 395

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 162 ELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDI 221
            LF L+N+C  ++F+S  S    + S N + I+  +KLL + + + ++++ ++  D I  
Sbjct: 12  RLFSLRNSCLSKRFQSSSSGAADNSSNNDEVILLQQKLLYDEIRAELKSLSQIPEDEI-- 69

Query: 222 DWEFPENNKVEPQGYLKLV-RMLRLKLNSL 250
               PE  K   +G L    ++L  +LNSL
Sbjct: 70  ---LPELKKSLGEGKLSAKEQLLETELNSL 96

>YOR289W Chr15 (853357..854112) [756 bp, 251 aa] {ON} Putative
           protein of unknown function; transcription induced by
           the unfolded protein response; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus
          Length = 251

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 17/113 (15%)

Query: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360
           +W + +  H  + +  E   N+ +   IG F   P  +  G+  Y     ++D +F P  
Sbjct: 72  TWKKKSNKHHTIDTNEE---NYILRGCIGTFAKMP--IAHGIEKYSLIAALEDRRFSPIQ 126

Query: 361 KNTVL-----------INQQFKGVGKPGKEI-DKADGKEGIWPYKNLPKKGTT 401
           K  ++               F+G G P  +I D   GK GI  Y   PK GTT
Sbjct: 127 KRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTT 179

>NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa]
           {ON} Anc_5.591
          Length = 957

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 50/118 (42%), Gaps = 24/118 (20%)

Query: 102 HVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIG 161
           ++Y   F+ D    C+   DS+S ++ DL   L  K    +      N +  IL LG  G
Sbjct: 562 YIYTIPFKADGPAMCL---DSYSQIDNDLITSLVSKYKTSLKS---VNTLPCILMLGKNG 615

Query: 162 ELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGI 219
           +L Y+KN                 +S    T  KN +L+ N  DS + +M+   FD +
Sbjct: 616 DLSYVKN-----------------NSPTSPTASKNSELMVNVADSDL-SMYDFEFDEL 655

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 49/99 (49%), Gaps = 16/99 (16%)

Query: 184 WSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRML 243
           ++ +E F  I++ +  L +F +S V   F  G              K+  + YL  + ++
Sbjct: 202 YTKNELFVDIIERQSYLMDFKNSQVRQTFVYG--------------KINCRSYLSGMPIV 247

Query: 244 RLKLNSL--ESQIFGGSTKDHFELSIAAPAFKDKLYFLP 280
           R+ +N +  +  +F GS+K H  +S+ + + +D + F+P
Sbjct: 248 RVCINKMLKDKDLFLGSSKFHQCVSLESLSSQDYIEFIP 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,398,226
Number of extensions: 2877379
Number of successful extensions: 6659
Number of sequences better than 10.0: 29
Number of HSP's gapped: 6741
Number of HSP's successfully gapped: 29
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)