Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5425.437ON44244222640.0
Skud_4.6395.437ON44244216190.0
YDR370C5.437ON44244016030.0
Smik_4.6365.437ON44644215690.0
NCAS0F034005.437ON4153918581e-111
NDAI0B056905.437ON4233898561e-110
KAFR0E038205.437ON3963768451e-109
TDEL0B021805.437ON4183827123e-89
Kpol_1016.45.437ON4133756941e-86
CAGL0A02860g5.437ON4023436341e-77
ZYRO0F10098g5.437ON3733816171e-75
SAKL0G02596g5.437ON4003726034e-73
Kwal_55.214155.437ON3893816015e-73
KLTH0F15994g5.437ON3903535808e-70
KNAG0C048905.437ON4053895801e-69
TPHA0J026005.437ON4413865769e-69
TBLA0A028005.437ON4533995072e-58
AER404C5.437ON3863484044e-44
KLLA0E02245g5.437ON4033723433e-35
KLLA0E12893g3.570ON384235830.098
Kpol_380.83.570ON379211810.20
Kwal_47.192763.570ON386108770.56
TPHA0G036503.570ON37767770.61
TDEL0D063803.570ON37867760.82
NDAI0I032603.570ON377119760.85
CAGL0C01925g3.570ON40066760.91
KAFR0J001603.570ON380114750.98
TBLA0E001803.570ON37867751.1
NCAS0E002403.570ON380128731.7
SAKL0F00726g3.570ON383186722.1
CAGL0I07777g3.111ON24064685.3
CAGL0G03267g7.393ON42582695.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.542
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   876   0.0  
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   628   0.0  
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   622   0.0  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   608   0.0  
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   335   e-111
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   334   e-110
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   330   e-109
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   278   3e-89
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   271   1e-86
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   248   1e-77
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   242   1e-75
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   236   4e-73
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   236   5e-73
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   228   8e-70
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   228   1e-69
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   226   9e-69
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   199   2e-58
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   160   4e-44
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   136   3e-35
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    37   0.098
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    36   0.20 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    34   0.56 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    34   0.61 
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    34   0.82 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     34   0.85 
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    34   0.91 
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    33   0.98 
TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}...    33   1.1  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    33   1.7  
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    32   2.1  
CAGL0I07777g Chr9 complement(749478..750200) [723 bp, 240 aa] {O...    31   5.3  
CAGL0G03267g Chr7 complement(308963..310240) [1278 bp, 425 aa] {...    31   5.4  

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/442 (96%), Positives = 425/442 (96%)

Query: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHXXXXXXXXXXXXXXXXXPSSQQKNDYLEEI 60
           MSPEQDGVVKLAKDLEGINLRDVPNPVNEH                 PSSQQKNDYLEEI
Sbjct: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSSQQKNDYLEEI 60

Query: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120
           SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH
Sbjct: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180
           LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240
           GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG
Sbjct: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240

Query: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300
           DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV
Sbjct: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300

Query: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360
           SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD
Sbjct: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360

Query: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420
           TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID
Sbjct: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420

Query: 421 ANGTIIITKLSTIPRNVEIFKT 442
           ANGTIIITKLSTIPRNVEIFKT
Sbjct: 421 ANGTIIITKLSTIPRNVEIFKT 442

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/442 (67%), Positives = 356/442 (80%)

Query: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHXXXXXXXXXXXXXXXXXPSSQQKNDYLEEI 60
           MS E D + +L K+LE  NL  VP+ V  H                 P S QK+DY    
Sbjct: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPSPQKDDYWNRC 60

Query: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120
           S F  VPY+SF+HTSI +   KPP DIF +SKEVALFT+ Q Y  ARKD+IP+L++ I+ 
Sbjct: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180
           LYES LLEAR+ K  YLG DLFANID+ VPMTISELD+I+PCISY+E+W+L+N GK FKI
Sbjct: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240
           GKKFT+V+ RHHIVDLTMH FDRRNK+KS+I TYMG G IS SRNPK D + SKEGIYS 
Sbjct: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240

Query: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300
           DPN+KKIC+SGFEFE+ +TE+ K +  +  K P+FS+VE KLSEDIGLLMRCE+DAFNPV
Sbjct: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300

Query: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360
           S+TNTELKCFGPLSM NS+HRKKLLKTWIQTGLLPNSDI++GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360

Query: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420
           +L++KFNHPGLP +KKE+N+NAKVAVEWC HCIKSIC+LVEANIS YN  +PE FE++ID
Sbjct: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420

Query: 421 ANGTIIITKLSTIPRNVEIFKT 442
           ANGTI ITKL+T+P+NVE+F T
Sbjct: 421 ANGTIAITKLNTVPKNVELFVT 442

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/440 (67%), Positives = 349/440 (79%)

Query: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHXXXXXXXXXXXXXXXXXPSSQQKNDYLEEI 60
           MS EQD V+ LAKDLEGINL  VPN    H                   SQQ+++Y +  
Sbjct: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPSQQRDNYRKRR 60

Query: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120
            +   +PY+SFLHT + NF TKPP DIF+ESKEVALFT+ + Y   RKD+IPNLKE I+ 
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180
           LYES LLEA+K K  YLG DLFANIDE VPMTISELD+++PC SYIE+W L+N GK FKI
Sbjct: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240
           GKKFTVVTTRHHIVDLTMH F+RRN+Q S+I TYMG G +S  RN K D + SKEGIYS 
Sbjct: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240

Query: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300
           DPN+KKIC+SGFEFEN +TEN+K +  + SKCP+FS+VE KLSE+IGLL+RCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360
           S+TNTELKCF PLSM NS+HR+KLLKTW+QTGLLPNSDIM+GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420
            L +KFNHPGLP NKKE+NYNA++AVEWC +CI++IC LVEANIS Y+  KPE FEI ID
Sbjct: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420

Query: 421 ANGTIIITKLSTIPRNVEIF 440
            N  I+ITKL T PRNVE+F
Sbjct: 421 TNNAIVITKLKTTPRNVELF 440

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/442 (65%), Positives = 343/442 (77%)

Query: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHXXXXXXXXXXXXXXXXXPSSQQKNDYLEEI 60
           M  E D VV+L K+L+GINL   P+ V EH                  S QQ  +++   
Sbjct: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60

Query: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120
            +FTRV Y+SF H+ +  FP KPP DIF+ESKEVALFT+ Q Y   RKD++PNLK DI+ 
Sbjct: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180
           L E  LL+AR+ K  YLG DLFANI + VPMTISELD+I PCISYIE+WRLNN G+ FKI
Sbjct: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240
           G+KFTVVTTRHHIVD+TMH FDRRNK++S++ATYMG G IS SRN K D + SKEGIYS 
Sbjct: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240

Query: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300
           DPN+KKIC+SGFEFEN +TE  K +  + SK PVFS+VE KLSE+IGLL+RCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360
           S  NTELKCF PLSM NS+HR+KLLKTWIQTGL PNSDIM+GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420
           +L  KFNH GLP NK+E+NYNAKVAVEWC HCIKSIC+L+ ANIS Y+C  PE FEI+ID
Sbjct: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420

Query: 421 ANGTIIITKLSTIPRNVEIFKT 442
           +N TI ITKL  IP++VE+F T
Sbjct: 421 SNNTIAITKLKNIPKHVELFGT 442

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  335 bits (858), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/391 (44%), Positives = 251/391 (64%), Gaps = 20/391 (5%)

Query: 64  TRVPYSSFLHTSIRNFPTKPPPDIFYESK-EVALFTDNQLYVAARKDVIPNLKEDISHLY 122
           TRVP+  F H+SI  FPT   P  FYES  +VAL+ +++LY A++ D+IP+LK DI+ L 
Sbjct: 24  TRVPFGEFSHSSISLFPTCTQP--FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLP 81

Query: 123 ESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGK 182
           +    EAR LK  YLG DL+   +  VPM+  +LD++ PC+S+I+DW    S K +K G+
Sbjct: 82  KKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTK-YKPGR 140

Query: 183 KFTVVTTRHHIVDLTMHPFDRR----NKQKSII-----ATYMGN--GFISLSRNPKYDHK 231
           KF +V+TRHHIV++TM  F  +    N  K +        Y G+  G +  +++      
Sbjct: 141 KFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGN 200

Query: 232 ASKEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKC-----PVFSIVEGKLSEDI 286
           +  EGIYS +  +K+IC+SGF  E+ +TE T        K       VF++VE KL +DI
Sbjct: 201 SMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDI 260

Query: 287 GLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDS 346
            +L+RCE+DAFN   K  TELKCF PL M N SHR+KLLK W+QTG+LP+SDI++G+RDS
Sbjct: 261 CILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDS 320

Query: 347 YSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISR 406
             G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W +HCI+SIC LV+ N+ +
Sbjct: 321 SFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ 380

Query: 407 YNCNKPEPFEINIDANGTIIITKLSTIPRNV 437
              + P+ F+I ID+   I I  LS +P+++
Sbjct: 381 KAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  334 bits (856), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 173/389 (44%), Positives = 247/389 (63%), Gaps = 17/389 (4%)

Query: 64  TRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLY- 122
           T +P+  F H SI  +P K P   F  SK+VAL+ + QLY +   ++IP L+  I+ L  
Sbjct: 37  TTIPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95

Query: 123 -ESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIG 181
               L EAR LK  YLG DL+   +  +PM   ELD+I PC  YIE W L N    +++G
Sbjct: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDYQLG 154

Query: 182 KKFTVVTTRHHIVDLTMHPFDRRNKQKSII-ATYMG--NGFISLSRNPKYDHKASKEGIY 238
            KFT+V+ RHHIV++TM  F++R     I+  TY G  NG +  SR+    +K    GIY
Sbjct: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDV---NKKDDGGIY 211

Query: 239 SGDPNIKKICHSGFEFENCLTENTKNSGSSASKC-------PVFSIVEGKLSEDIGLLMR 291
           S D  ++KI +SGF  E+ LT N  +  +  S          VF+I+E KL++DI LL+R
Sbjct: 212 SKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLR 271

Query: 292 CEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQL 351
           CEMD++NPV+K  TE+KCF  L M N +HR+KLLK W+QTG++PNSDI++G+RD   G+L
Sbjct: 272 CEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGEL 331

Query: 352 LDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNK 411
            DI+W+SR  L+R+ N+  LP  K ++NYNA++AV+W +HCIKSIC LV+ +I +   N 
Sbjct: 332 NDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNT 391

Query: 412 PEPFEINIDANGTIIITKLSTIPRNVEIF 440
            + F+I I+A+  I I KL ++P NV ++
Sbjct: 392 SQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  330 bits (845), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 245/376 (65%), Gaps = 18/376 (4%)

Query: 67  PYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV--AARKDVIPNLKEDISHLYES 124
           P+  F H SI  FP  P  + F  S+EVA + D ++Y      +D++P L +DIS + + 
Sbjct: 31  PFKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQG 89

Query: 125 -PLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKK 183
              ++ARK K  Y+G DL+   +    M+  ELD+  PC +YI+ W  ++  K +   KK
Sbjct: 90  VSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKK 148

Query: 184 FTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPN 243
           +T+V+ RHHIV+L M  FD  +K+  + +TY+GNG ++ S++   D     EGI++ + N
Sbjct: 149 YTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTKNKN 206

Query: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303
           +KKIC+SGF  E+ LT++ K         P+FSI E +L ++I LL+RCEMDA+N +++ 
Sbjct: 207 LKKICYSGFALEDLLTKSQKE--------PLFSITENQLDDNITLLLRCEMDAYNQLTQN 258

Query: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363
            TELKC+ PL M +  HRKKLLKTWIQTG+LP+SD+M G+R  Y+G+LLDI+WYSRD L+
Sbjct: 259 YTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLY 318

Query: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANG 423
           R+FN+  LP NKK +N+NA +AVEW  HCIK+IC+L+  N+     + P+ F+I +D   
Sbjct: 319 RRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQ---GDAPQAFQIKVDTFR 375

Query: 424 TIIITKLSTIPRNVEI 439
            I I  LS IP+N +I
Sbjct: 376 NISIRNLSKIPQNAQI 391

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  278 bits (712), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 153/382 (40%), Positives = 234/382 (61%), Gaps = 26/382 (6%)

Query: 66  VPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV--AARKDVIPNLKEDISHLYE 123
           +P+S F H+ +  FP     D F   +EVA + +  L++  +++K + P L+     ++ 
Sbjct: 50  IPFSKFEHSDLDYFPDDTA-DFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQ-----MFA 103

Query: 124 SPLLEAR--KLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIG 181
           + + E R  K K  Y+G DL+   +   P+  SELD+   C  YI+ W      K F  G
Sbjct: 104 ALIAENRGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSG 163

Query: 182 KKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGD 241
           K  T+++ RHH+VDL M  F   + + SII T +G G +  S +     K  + G+ S +
Sbjct: 164 K-VTIISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLIFSGDRS---KEERNGLNSKN 217

Query: 242 PNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVS 301
              +KIC+SGF  E+ LT     +       P +SIVEGK++E + LL+RCEMDA+NP+ 
Sbjct: 218 SMTRKICYSGFALEDKLT-----TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIF 272

Query: 302 KTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDT 361
              TELKCF  L++Q+++HR+KLLKTW+Q GL+P+SD+++G RD+  GQL D+ WYSR +
Sbjct: 273 NRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGS 332

Query: 362 LFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEP----FEI 417
           L++KFN+P +  N K +N+NA +AVEWC HCI+SICDLV  N S  + + P P    F++
Sbjct: 333 LYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKV 391

Query: 418 NIDANGTIIITKLSTIPRNVEI 439
            +D +  II+ KL+ +PR+V+I
Sbjct: 392 IVDKSHNIIVKKLTKVPRHVQI 413

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  271 bits (694), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 150/375 (40%), Positives = 231/375 (61%), Gaps = 12/375 (3%)

Query: 66  VPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLYESP 125
           +P+  F+H++ R+FP K   D+F ESK VA F  +QL++      +P LK+DI+++    
Sbjct: 41  IPFHRFVHSNARSFPQKTK-DLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99

Query: 126 LLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFT 185
           +L ++K K  YLG DL+A+ D+  P+    LD+  PC  +I  W   + G+ +     +T
Sbjct: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159

Query: 186 VVTTRHHIVDLTMHPF-DRRNKQKSIIATYMGNGFISLSRN-PKYDHKASKEGIYSGDPN 243
           +++ RHHI ++ M  F D +N    ++ TY+ NG I LS++       ++  G+ S +P 
Sbjct: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPM 219

Query: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303
            +KIC+SGF FE+ + E+   +       P+FS+VE KL+E I LL+R E+D +N V+  
Sbjct: 220 TRKICYSGFAFEDLVLEDIAENAR-----PIFSVVESKLTESINLLLRNELDGYNNVTNM 274

Query: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363
            TELKCF PL    S+  K++LKTW+QTGL+P SDI++G+RD+ SG L D+ WY+R  L 
Sbjct: 275 FTELKCFAPLKCMFSA--KEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332

Query: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANG 423
           R FN+P LP      N+NA +AVEW K  ++SI  LV ++I+  + N P  F++ ID + 
Sbjct: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHK 390

Query: 424 TIIITKLSTIPRNVE 438
           TI I KLS IP+ V+
Sbjct: 391 TISIQKLSRIPQTVQ 405

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  248 bits (634), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 208/343 (60%), Gaps = 7/343 (2%)

Query: 85  PDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLYESPLLEARKLKTLYLGLDLFAN 144
           P  +  +K + +F D++LY   R D+ P LK+ I+H+ +S   E  +L   +LG+ L+ N
Sbjct: 60  PQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYEN 119

Query: 145 IDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTVVTTRHHIVDLTMHPFDRR 204
            D+  PMT  ELDT   C +Y++ +  N+ G+ +   + F +VT RHH++DL + PF R+
Sbjct: 120 HDKYSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQ 178

Query: 205 NKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIKKICHSGFEFENCLTENTKN 264
               +++  Y     + +S++P  D+   K G+ + +P +KKIC SGF  E+ LTE    
Sbjct: 179 FTNVNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTE---- 233

Query: 265 SGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKL 324
           S +   + P F IVE +++ +  LLMRCE+DA+NP++   TELKC+   +  N +HR+KL
Sbjct: 234 SANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKL 292

Query: 325 LKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKV 384
           LK+WIQTG++P +DI++G+RD+ SG L D++ Y+R+ L+ K     LP    E+NY+  +
Sbjct: 293 LKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAI 352

Query: 385 AVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANGTIII 427
           +V W +  I ++   + + + ++  ++P+ F I +D N  I I
Sbjct: 353 SVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  242 bits (617), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 222/381 (58%), Gaps = 23/381 (6%)

Query: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120
           ++   VP++ F H+S   FP++P  ++F + KE + +   QL+ +    +   LK   + 
Sbjct: 11  AQLPSVPFNQFQHSSAFRFPSEPR-NLFTKYKEASYYYGGQLHDSISDSI--GLKSPGNK 67

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180
           L       +   K  +LG DL+   ++ +P++   LD+   C  +I  W  N++   +  
Sbjct: 68  LSHD---RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWE-NDNHTSYSQ 123

Query: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSR--NPKYDHKASKEGIY 238
              F V++ RH++V+LTM  F  +  + SI+ T++G+G I LS+  N K  H+ +     
Sbjct: 124 RSPFVVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNT- 180

Query: 239 SGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFN 298
                 KKI HSG+  E+ LT      G      P F+I+E +L  +I L++RCE+D++N
Sbjct: 181 ---TMTKKILHSGYALEDLLTR-----GPRVEDDPFFAIIEAELDANISLVLRCELDSYN 232

Query: 299 PVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYS 358
            +++T TELKC+ PL+M N+ HR+KLLKTWIQ  + P  D+++G+R+++ G L D+Q+++
Sbjct: 233 ELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFT 292

Query: 359 RDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEIN 418
              L+RK N   LP + K  NYNA +AV+WC+HCI+SIC LV  N+ R   + P+ F++ 
Sbjct: 293 NKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDR---SSPQCFKLT 349

Query: 419 IDANGTIIITKLSTIPRNVEI 439
           ID +  I + KL  +P +VE+
Sbjct: 350 IDESHKIQLEKLKHVPAHVEL 370

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  236 bits (603), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 134/372 (36%), Positives = 224/372 (60%), Gaps = 23/372 (6%)

Query: 70  SFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPNLKEDISHLYESPL 126
            F+H+++ +FP+  P   F ES+E+  FT    +  Y+   K  +  LK+DI     +P 
Sbjct: 29  GFVHSNVSHFPS-VPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87

Query: 127 LEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTV 186
             A K+KT YLG DL    ++ +P++  EL+ +   +++I +W   N GK +    KFT+
Sbjct: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146

Query: 187 VTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRN---PKYDHKASKEGIYSGDPN 243
           V+ RHH++DL M PF    ++ ++I T++ +G + +S +   PK D      GI S D  
Sbjct: 147 VSNRHHLIDLIMCPFSL--EEANLIVTHL-DGLLIISSDKSKPKVD-----SGIRSKDTR 198

Query: 244 IKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303
           ++K+C++GFE EN +T+   +S      C  +SIVE KL+E + LL++ EMD++NP +  
Sbjct: 199 VRKLCYTGFELENLVTKGKVDS-PGMHTC-FYSIVENKLTEGVSLLLQAEMDSYNPKTDN 256

Query: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363
             ELKC     ++NS+HR+KLL+ WIQTGL+P +D++VG RD Y  QL  ++ Y+RD ++
Sbjct: 257 YVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIY 316

Query: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKP-EPFEINIDAN 422
           +KF+   L  N+K  N+N+ VAV+W  H I  I +LV+ N++    ++P + F++ +  +
Sbjct: 317 KKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLT----DEPLQSFKLTLTRD 372

Query: 423 GTIIITKLSTIP 434
             + +TKL+  P
Sbjct: 373 LQLSLTKLANTP 384

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  236 bits (601), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 135/381 (35%), Positives = 220/381 (57%), Gaps = 18/381 (4%)

Query: 57  LEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPN 113
           L++ +E       +F H  I  FP    P  F E +EVA  T   D   ++   K  +P 
Sbjct: 10  LQDRTEEVHANCKNFQHAQINQFPKNVLP-FFDEVQEVATITHLLDTDEFLLDDKLGMPE 68

Query: 114 LKEDISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNN 173
           L +D+    ES  L A K K  Y+G DL  + DE VP+T  +L+ +A   +++E W+   
Sbjct: 69  LVQDLCEFTESGKL-ANKGK--YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWK-QL 124

Query: 174 SGKPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKAS 233
            G+ F     FT+V +RH+++DL M PF   +    I      NG+++LS + +Y  + +
Sbjct: 125 HGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKI---QFSNGYLNLSPDAQY--QKT 179

Query: 234 KEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCE 293
            +GI+SGD  IKKIC++GFE EN +T  +K    S+     +S+VEGKL + I LL++ E
Sbjct: 180 DQGIHSGDTKIKKICYTGFELENLITATSKPDVRSS----FYSLVEGKLGDGIKLLLKAE 235

Query: 294 MDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLD 353
           MD FN  +++ TE+KC   L ++++ HR+KLL+ W+QT L+P+++++VG+RD Y  QL  
Sbjct: 236 MDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTS 295

Query: 354 IQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPE 413
            + Y+R  L+RKFN+  L + +K  NYNA ++V+W +H I+ +C +++  I +    +  
Sbjct: 296 FECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEK-GSKEEV 354

Query: 414 PFEINIDANGTIIITKLSTIP 434
            F + +  N TI + K+   P
Sbjct: 355 NFRLTLRKNLTIKLRKMPETP 375

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  228 bits (580), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 208/353 (58%), Gaps = 17/353 (4%)

Query: 57  LEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAARKDVIPN 113
           LE++ +   V    F   SI +FP +P    F E KE+   T   D+  +   RK   P+
Sbjct: 10  LEDLPDEACVSCRGFERASISHFPAEPL-HFFDEVKEIGTMTHWIDSDKFELGRKQSAPH 68

Query: 114 LKEDISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNN 173
           LK+D+     +  L        Y+G DL  + D+  P+T ++L+ ++    ++  W   +
Sbjct: 69  LKKDLGLFTITKKLAK---TNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GD 124

Query: 174 SGKPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKAS 233
            GKP+  G  FT+V +RH+++DL M PF   +   ++   Y+ NG++ +  + ++  K  
Sbjct: 125 HGKPYSSGSDFTIVCSRHNLIDLIMAPFSDEDVHFNV--KYI-NGYLHIFPDKQFQKK-- 179

Query: 234 KEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCE 293
            +GIYS + NI++IC++GFE E+ +TE    +  SA     +S+V+GK+S++I LL + E
Sbjct: 180 DDGIYSSESNIRRICYTGFELEDLVTETQPGAPKSA----FYSLVQGKISKNIKLLFKAE 235

Query: 294 MDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLD 353
           MD FNP  ++ TE+KC   L ++++ HR+KLL+ W+QT L+P++D+++GLRD Y  QL  
Sbjct: 236 MDCFNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSS 295

Query: 354 IQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISR 406
            + Y+R  L++KFN+  L L KK+ NYNA ++V+W +H +K +C  +   + +
Sbjct: 296 FECYTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK 348

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  228 bits (580), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 215/389 (55%), Gaps = 19/389 (4%)

Query: 60  ISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYV----AARKDVIPNLK 115
           I++  RV +  F H     + +KP   IF +SKEVA +T  +LY+         ++P LK
Sbjct: 22  INDQKRVRFKEFHHHDPGKYVSKPA-HIFQKSKEVACYTGGKLYINDGNTTNLTILPLLK 80

Query: 116 EDISHLYESP-LLEARKLKTLYLGLDLFANIDELV-PMTISELDTIAPCISYIEDWRLNN 173
           EDI+ L +S    ++   K+ YLGL L+A  ++ V  M+   LD+  PC+ YI +W   +
Sbjct: 81  EDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGS 140

Query: 174 SG-KPFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKA 232
            G K F    +  +V  RHH+V+LTM  F   +  K ++ T +   FI LS+      + 
Sbjct: 141 KGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYK-LVCTVLRGKFIVLSQFDDGSQRN 199

Query: 233 SKEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFS--IVEGKLSEDIGLLM 290
             EGI   D   + +C+SGF      +    N G   S+   +   I  G L+       
Sbjct: 200 RNEGITLSDRRTRMLCYSGFVICKIWS---LNRGIIPSQFFYYGTPIRRGHLAT-----F 251

Query: 291 RCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQ 350
            CEMDA+N +    TELKC+GPL+M++S H+ KLL+TW+QT + P++D+++G R++Y G 
Sbjct: 252 TCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGT 311

Query: 351 LLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCN 410
           L DI   SR++L+RKFN+   P      NYNA+VAVEW ++ +K+I  L+E N+++ +  
Sbjct: 312 LQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVL 371

Query: 411 KPEPFEINIDANGTIIITKLSTIPRNVEI 439
           +P+ F + +     I I KL  +P+  EI
Sbjct: 372 EPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  226 bits (576), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 212/386 (54%), Gaps = 20/386 (5%)

Query: 64  TRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVI-------PNLKE 116
            R+P+  F +++      K  P+IF E+K VAL+ D ++      +         P L +
Sbjct: 61  ARIPFKHFSYSNAH--IGKSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTK 118

Query: 117 DISHLYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGK 176
           DIS+L E  LL+++K K  Y+G +L+  I++  PM  + LD+  PC  Y+   +++   K
Sbjct: 119 DISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDK 178

Query: 177 PFKIGKKFTVVTTRHHIVDLTMHPFDRRNKQ---KSIIATYMGNGFISLSRNPKYDHKAS 233
            +     +T +T RHH+ +L M  ++ R  +   KS + T + +  I +S +   ++  S
Sbjct: 179 LY--NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPS 236

Query: 234 KEGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCE 293
            +     +   KK+ +SGF FE  + EN +         P F I E +L+     ++R E
Sbjct: 237 PQNHKLQNSFSKKVINSGFTFEELVIENFQECHK-----PYFYISENRLTPKSTFIIRSE 291

Query: 294 MDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLD 353
           MD++N  ++T TELKCF  L +  + HRKKLLKTW QTGL PN DI++G+RD+ SG L D
Sbjct: 292 MDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILED 351

Query: 354 IQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPE 413
           + WYSR+ +++K   P LP  K   ++   + ++W  HCI +I      + S    N P 
Sbjct: 352 LLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASN-PM 410

Query: 414 PFEINIDANGTIIITKLSTIPRNVEI 439
            +++ ID + +III KLS +P+NVEI
Sbjct: 411 TYKVIIDKHKSIIIKKLSIVPKNVEI 436

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  199 bits (507), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/399 (32%), Positives = 213/399 (53%), Gaps = 34/399 (8%)

Query: 66  VPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDV-----IPNLKEDISH 120
           + ++SF+  S  +F      D++  SKEVA +    L +     +     +P LK+DI  
Sbjct: 43  IRFNSFVKPSKTHFS-----DLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQ 97

Query: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIE--DWRLNNSGKPF 178
           +    LL+++K K  Y+G DLF + ++   M    L     C  YI+  D +  N  K +
Sbjct: 98  IAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKY 157

Query: 179 KIGKKFTVVTTRHHIVDLTMHPFDR-RNKQKSIIATYMGNGFISLSRNPKY---DHKASK 234
            + K+F ++T+RHHI DL + PF +  + + S++ TY+G+  I LS++  +   D + +K
Sbjct: 158 GMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENK 217

Query: 235 EGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSAS------KCP-----VFSIVEGKLS 283
           +   S    ++KI +SGF FE+ + ++  +S  + S      K P      FS+VE  +S
Sbjct: 218 QFYNS----MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDIS 273

Query: 284 EDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGL 343
             + +L+R EMD +NP++ + TELKCF  L+M +  HR+KLLKTW+Q G LPNSD++VG 
Sbjct: 274 PKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGS 333

Query: 344 RDSYSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEAN 403
           RD+ +G L DI W+SRD L  K +    P  +   N     A  W  H + +I  L    
Sbjct: 334 RDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDY 393

Query: 404 IS---RYNCNKPEPFEINIDANGTIIITKLSTIPRNVEI 439
           +    +   + P PF + ++ N TI +  L  +P +V I
Sbjct: 394 LKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASVPI 432

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  160 bits (404), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 172/348 (49%), Gaps = 39/348 (11%)

Query: 87  IFYESKEVA-LFTDNQLYVAARKDVIPNLKEDI----SHLYESPLLEARKLKTLYLGLDL 141
           IF ES+EV   F    +Y    K  +P L ++I    SH  +S L+        Y+G DL
Sbjct: 46  IFSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEYISHRSKSKLIG-------YVGSDL 98

Query: 142 FANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTVVTTRHHIVDLTMHPF 201
               +   P+T  EL  +   + +I  W  +N    +    KFT+V+ RHHI+D+ M PF
Sbjct: 99  SVESETFHPVTSEELHCLHGLLKFIAKWEADNEVN-YASRSKFTIVSPRHHILDILMIPF 157

Query: 202 DRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIKKICHSGFEFENCLTEN 261
               + + +   + G   I+L+ + +        GI S     +KIC++GFE E  LT  
Sbjct: 158 GN-ERCRLVFTAHRGLFVITLAPSQR------PTGINSPSSATRKICYTGFELERLLT-- 208

Query: 262 TKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHR 321
              + S   +   +S +E KL  DI +L++CEMDA+NP  +  TE+K     +++N  H 
Sbjct: 209 ---ATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHL 265

Query: 322 KKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKF-------NHPGLPLN 374
            KLLK W QT LLP++DI+VG RD  +  L  +  YS D +  K        +HP     
Sbjct: 266 SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSY--- 322

Query: 375 KKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDAN 422
               N+N +VA +W  + I+ IC+ + + +     + P+ F + ID N
Sbjct: 323 ---FNFNPEVAKDWTHYAIREICERLSSLVDA-TSSSPQSFLVEIDKN 366

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  136 bits (343), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 188/372 (50%), Gaps = 33/372 (8%)

Query: 71  FLHTSIRNFPTKPPPDIFYESKEVA----LFTDNQLYV--AARKDVIPNLKEDISHLYES 124
           F H S+ N+     P +  + KEV     +  D  L    A+RK   P L+ ++    + 
Sbjct: 47  FPHVSV-NYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRK---PRLRPEVCTYIKD 102

Query: 125 PLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKF 184
              E + +K  ++G+DL    D+ VP+  + L+++       +  R   +  P    +K 
Sbjct: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQ--RYEKTLNP----EKT 156

Query: 185 TVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNI 244
           T V+ RHHI+D+ M PF   ++  S++ T   +  I +S +   D      GI+    + 
Sbjct: 157 TFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKD---KPNGIHETRNSF 211

Query: 245 -KKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303
            KKIC++GF  E+ L E +   G        +SIV G L+++I LL++ EMD+ N ++ T
Sbjct: 212 NKKICYTGFALEDLLIE-SPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDT 270

Query: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363
            TE+K      + N+ HR+KLL+ WIQT LLP SD+++G R+SYS +L  ++ Y    ++
Sbjct: 271 YTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIY 330

Query: 364 RKFNHP---GLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNC-NKPEPFEINI 419
            K N+    G P   K   +N  VA +W +H    I  +++ N+   +  +    F++ I
Sbjct: 331 HKINNSSIVGKP--GKFYKFNPNVANDWFQH----IFQVLKQNLLLLSQESTSTTFKVQI 384

Query: 420 DANGTIIITKLS 431
           D N T+ I+  S
Sbjct: 385 DTNLTLSISPAS 396

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 95/235 (40%), Gaps = 41/235 (17%)

Query: 139 LDLFANIDELVPMTISELD--TIAPCISYIEDWRLNNSGKPFKIGKKFTVVTTRHHIVDL 196
           LDL + I +       E D  T+   +S +E++    S K      K  ++T R  I  L
Sbjct: 57  LDLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKKT-----KVDIITFRGIIRKL 111

Query: 197 TMHPFD--RRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIK-KICHSGFE 253
               FD  + N     I ++ G  FI   +  K D  AS+  I     +++ +  +SG++
Sbjct: 112 ISSAFDSSQFNPVNFRIVSFDGQLFI---KEVKTD--ASETSINKNRESLQARAYYSGYK 166

Query: 254 FENCLT-----------------ENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDA 296
           FE   T                 +   N+G          I  GK    IG  + C  D 
Sbjct: 167 FEALATLSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGI--GKCKILIGAEVDCIFD- 223

Query: 297 FNPVSKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSDIMVGLRD 345
           F   S  N     ELKC   ++  + +H+  +KL KTW+Q  L+  + I+ G RD
Sbjct: 224 FKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRD 278

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 88/211 (41%), Gaps = 30/211 (14%)

Query: 183 KFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDP 242
           K  ++T R  I  L    FD     +  +   + +G I +   P+ + +         D 
Sbjct: 98  KVDIITFRGVIRKLISSAFDSPKFNQVNLRIVLFDGQIFMKEVPRKEEEPK-------DG 150

Query: 243 NIKKICHSGFEFENCLTENTK---NSGSSASKCPVFSIVEGK-----LSEDIG---LLMR 291
            I    +SG++FEN +T +      S ++  K P   +  G      +   +G   L++ 
Sbjct: 151 KIAPPVYSGYKFENLVTVSKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVGNCKLMLG 210

Query: 292 CEMDA-FNPVSKTNTELKCFGPLSMQN-----SSHRK---KLLKTWIQTGLLPNSDIMVG 342
            E+DA F+   +    LK +  L   N     S  RK   K+ KTWIQ  L+    I+ G
Sbjct: 211 AEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYG 270

Query: 343 LRDSYSGQLLDIQWYSRDT--LFRKFNHPGL 371
            RD+ +  L  ++ +S D   L  K N P L
Sbjct: 271 FRDN-NFILKSVEEFSTDEVPLLLKSNSPQL 300

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 22/108 (20%)

Query: 245 KKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVS--- 301
           KKIC++G +F   +     N       C +           +G  + C  D     S   
Sbjct: 188 KKICNNGDQFVTVVRSGVGN-------CKLV----------LGAEVDCVFDFAEDTSNNL 230

Query: 302 KTNTELKCFGPLS--MQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSY 347
           K   ELKC   +S   +  S  +KL KTW+Q  L+  + I+ G RD +
Sbjct: 231 KHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINRIIYGFRDEH 278

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 288 LLMRCEMDA---FNPVSKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSD 338
           +L+  E+DA   F    K N     ELKC   ++  N + +   KL KTWIQ  L+  + 
Sbjct: 206 ILLGAEVDAIFDFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITR 265

Query: 339 IMVGLRD 345
           I  G RD
Sbjct: 266 ITYGFRD 272

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 288 LLMRCEMDA---FNPVSKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSD 338
           L++  E+D    F    K N     ELKC   +S Q  + +  KK+ KTW+Q  L+    
Sbjct: 208 LILGAEVDCIFDFKEEGKDNLKHYAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPR 267

Query: 339 IMVGLRD 345
           I+ G RD
Sbjct: 268 IIYGFRD 274

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 48/119 (40%), Gaps = 22/119 (18%)

Query: 248 CHSGFEFENCLTENT---------------KNSGSSASKCPVFSIVEGKLSEDIGLLMRC 292
           C++G++FE+  T +                K S +      V     G     +G  + C
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSSKLVLGAEIDC 212

Query: 293 EMDAFNPVSKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSDIMVGLRD 345
             D F   +K N     ELKC   +     +HR  +KL KTW+Q  L+    I+ G RD
Sbjct: 213 IFD-FKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD 270

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 286 IGLLMRCEMDAFNPVSKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSDI 339
           +G  + C  D F    K N    TELKC   +S  N   R  KK+ + W+Q  L+    +
Sbjct: 223 LGAEIDCIFD-FKEEGKDNLKHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRV 281

Query: 340 MVGLRD 345
           + G RD
Sbjct: 282 IYGFRD 287

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 12/114 (10%)

Query: 306 ELKCFGPLSMQN--SSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363
           ELKC   LS      +  KKL KTW+Q  L+    I  G RD  S  L  I+ Y  + + 
Sbjct: 234 ELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRDR-SYNLTSIEEYLTEDVP 292

Query: 364 RKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEI 417
           + F + G+     +       A++W    I  + D + A++   + N+  PF++
Sbjct: 293 KLFTNRGVKAQCMD-------AIQWYGEIIGWLYDTL-AHLET-DANEIRPFKL 337

>TBLA0E00180 Chr5 complement(23463..24599) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 286 IGLLMRCEMDAFNPVSKTN-----TELKCFGPL--SMQNSSHRKKLLKTWIQTGLLPNSD 338
           +G  + C  D F   SKTN      ELKC   +  + Q     KK+ +TW+Q  L+    
Sbjct: 208 LGAEVDCIFD-FKESSKTNNIYHYAELKCTQQICTAQQARGFDKKIFRTWLQCFLVGIPR 266

Query: 339 IMVGLRD 345
           I+ G RD
Sbjct: 267 IIYGFRD 273

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 25/128 (19%)

Query: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300
           D   KKIC++G E+   +      +G  ++K              +G  + C  D F   
Sbjct: 186 DKRSKKICNNGDEYVTVV-----KTGVGSAKLV------------LGAEIDCVFD-FKED 227

Query: 301 SKTN----TELKCFGPLSMQNSSHR--KKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDI 354
            K N     ELKC   +     +H+  +K+ +TW+Q  L+    I+ G RD  +  L  I
Sbjct: 228 GKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDE-NYVLKTI 286

Query: 355 QWYSRDTL 362
           + YS D +
Sbjct: 287 EEYSTDEI 294

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 77/186 (41%), Gaps = 31/186 (16%)

Query: 183 KFTVVTTRHHIVDLTMHPFD--RRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240
           K  ++T R  I  L    FD  R N+    I ++ G  FI     P    K +       
Sbjct: 99  KADIITFRGIIRKLISSAFDNPRYNRVNLRIVSFDGQLFIKEVGEPFVPPKTT------- 151

Query: 241 DPNIKKICHSGFEFENCLT------ENTKNSGSSASKCPV------FSIVE---GKLSED 285
           D    +  +SG++FE+ +T      E ++ +     K  V       S+V    GK    
Sbjct: 152 DSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKSKLI 211

Query: 286 IGLLMRCEMDAFNPVSKTN----TELKCFGPLS--MQNSSHRKKLLKTWIQTGLLPNSDI 339
           +G  + C  D F   S  N    TELKC   ++   +  +  +K+ KTW+Q  L+  + +
Sbjct: 212 LGAEVDCVFD-FKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRV 270

Query: 340 MVGLRD 345
           + G RD
Sbjct: 271 IYGFRD 276

>CAGL0I07777g Chr9 complement(749478..750200) [723 bp, 240 aa] {ON}
           similar to uniprot|Q99316 Saccharomyces cerevisiae
           YOL088c MPD2 protein disulfide isomerase-related protein
          Length = 240

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 382 AKVAVEWCKHC--IKSIC-DLVEANISRYNCNKPEPF-EINIDANGTIIITKLSTIPRNV 437
            K   EWC HC  +KS+  +L E   S  N N P  F E++ D  G+ I  +L   P  V
Sbjct: 39  VKYYTEWCSHCKKLKSVYKELDEQLSSESNLNAPIQFVEVDCDTYGSTICKRLPGYPI-V 97

Query: 438 EIFK 441
           E+ K
Sbjct: 98  EVVK 101

>CAGL0G03267g Chr7 complement(308963..310240) [1278 bp, 425 aa] {ON}
           highly similar to uniprot|P35183 Saccharomyces
           cerevisiae YBL069w AST1 or uniprot|P39945 Saccharomyces
           cerevisiae YER101c AST2
          Length = 425

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 51  QQKNDYLEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDV 110
           QQ  DY +   E T +PY+      + +F      DI   SK+  L      Y+    D 
Sbjct: 273 QQIVDYDDSKGEVT-IPYTEGKFDVVLDFVGGY--DIIAHSKD--LIKTGGAYITTVGDY 327

Query: 111 IPNLKEDISHLYESPLLEARKL 132
           + N KEDI + +++P   ARK+
Sbjct: 328 VANYKEDIFNSWDNPSANARKM 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,610,090
Number of extensions: 2259392
Number of successful extensions: 5446
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5552
Number of HSP's successfully gapped: 39
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)