Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5415.435ON86986940900.0
Skud_4.6385.435ON84384021020.0
Smik_4.6355.435ON86388520000.0
YDR369C (XRS2)5.435ON85488119870.0
KAFR0E038305.435ON8454524146e-41
NCAS0F033905.435ON8614223994e-39
ZYRO0F10054g5.435ON6603823803e-37
TDEL0E019005.435ON7623933781e-36
NDAI0B056805.435ON8564243702e-35
CAGL0A02838g5.435ON8284023568e-34
KNAG0C049005.435ON7694162987e-27
SAKL0G02552g5.435ON8344762811e-24
Kpol_1016.55.435ON8122042755e-24
TBLA0A028205.435ON9252052721e-23
TPHA0J025905.435ON7753992594e-22
KLTH0F16038g5.435ON7922372362e-19
Kwal_55.214225.435ON7822112301e-18
KLLA0E02201g5.435ON8352282032e-15
AER402C5.435ON8691291835e-13
Ecym_47615.435ON7981161729e-12
Skud_4.867.361ON2145130810.61
Suva_4.757.361ON2145130810.63
YDL171C (GLT1)7.361ON2145130800.75
Smik_4.677.361ON2145130800.92
CAGL0L01089g7.361ON215268790.98
NDAI0A018607.361ON215268771.7
NCAS0A141907.361ON214968772.0
TDEL0C018707.361ON214068753.0
Kpol_530.217.361ON213968735.1
TBLA0A091007.361ON214968727.4
KLLA0C10758g5.300ON36290708.7
Suva_15.213.20ON21359698.9
Skud_15.153.20ON21359699.5
YOL139C (CDC33)3.20ON21359699.5
Smik_15.153.20ON21359699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.541
         (869 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...  1580   0.0  
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   814   0.0  
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   775   0.0  
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   769   0.0  
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   164   6e-41
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   158   4e-39
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   150   3e-37
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   150   1e-36
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   147   2e-35
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   141   8e-34
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   119   7e-27
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   112   1e-24
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   110   5e-24
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   109   1e-23
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   104   4e-22
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...    96   2e-19
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...    93   1e-18
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    83   2e-15
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    75   5e-13
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    71   9e-12
Skud_4.86 Chr4 complement(145097..151534) [6438 bp, 2145 aa] {ON...    36   0.61 
Suva_4.75 Chr4 complement(136935..143372) [6438 bp, 2145 aa] {ON...    36   0.63 
YDL171C Chr4 complement(149203..155640) [6438 bp, 2145 aa] {ON} ...    35   0.75 
Smik_4.67 Chr4 complement(126041..132478) [6438 bp, 2145 aa] {ON...    35   0.92 
CAGL0L01089g Chr12 complement(123897..130355) [6459 bp, 2152 aa]...    35   0.98 
NDAI0A01860 Chr1 complement(412600..419058) [6459 bp, 2152 aa] {...    34   1.7  
NCAS0A14190 Chr1 (2788997..2795446) [6450 bp, 2149 aa] {ON} Anc_...    34   2.0  
TDEL0C01870 Chr3 complement(324830..331252) [6423 bp, 2140 aa] {...    33   3.0  
Kpol_530.21 s530 complement(53625..60044) [6420 bp, 2139 aa] {ON...    33   5.1  
TBLA0A09100 Chr1 complement(2248759..2255208) [6450 bp, 2149 aa]...    32   7.4  
KLLA0C10758g Chr3 (924736..925824) [1089 bp, 362 aa] {ON} simila...    32   8.7  
Suva_15.21 Chr15 complement(38206..38847) [642 bp, 213 aa] {ON} ...    31   8.9  
Skud_15.15 Chr15 complement(25600..26241) [642 bp, 213 aa] {ON} ...    31   9.5  
YOL139C Chr15 complement(60383..61024) [642 bp, 213 aa] {ON}  CD...    31   9.5  
Smik_15.15 Chr15 complement(28453..29094) [642 bp, 213 aa] {ON} ...    31   9.9  

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score = 1580 bits (4090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 792/869 (91%), Positives = 792/869 (91%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
           LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           WNIPSNLAQFQTILSQFGIATKT             FPSNNDDGMRELYALVHTIPLKKS
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240
           QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240

Query: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300
           NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI
Sbjct: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300

Query: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXX 360
           TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPA         
Sbjct: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAVLKKRRLNR 360

Query: 361 XXXQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420
              QPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ
Sbjct: 361 RRVQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420

Query: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISA 480
           NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISA
Sbjct: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISA 480

Query: 481 YPVTTTPEKHMEGRKIVESYKISDDSXXXXXXXXXXXXXXXXXXXXXXMKIKLQTLKDNR 540
           YPVTTTPEKHMEGRKIVESYKISDDS                      MKIKLQTLKDNR
Sbjct: 481 YPVTTTPEKHMEGRKIVESYKISDDSTQNENQTQNENQTQNENQTQNEMKIKLQTLKDNR 540

Query: 541 KFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELED 600
           KFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELED
Sbjct: 541 KFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELED 600

Query: 601 DELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTF 660
           DELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTF
Sbjct: 601 DELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTF 660

Query: 661 AKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDVLA 720
           AKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDVLA
Sbjct: 661 AKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDVLA 720

Query: 721 LTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTASTYQP 780
           LTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTASTYQP
Sbjct: 721 LTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTASTYQP 780

Query: 781 VKNKLFVAXXXXXXXXXXXXXXXXXGFELVTITKSNLQPDAAEESSKRNRSGGNAASRPL 840
           VKNKLFVA                 GFELVTITKSNLQPDAAEESSKRNRSGGNAASRPL
Sbjct: 781 VKNKLFVAEDDDNDDENDIVNDSEDGFELVTITKSNLQPDAAEESSKRNRSGGNAASRPL 840

Query: 841 GSYRXXXXXXXXXXXXXEGPKFKFKRKKG 869
           GSYR             EGPKFKFKRKKG
Sbjct: 841 GSYRNDNVNDSDDDDDDEGPKFKFKRKKG 869

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/840 (52%), Positives = 567/840 (67%), Gaps = 37/840 (4%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWVIRYQN +EDG I+ ISCCLQASKSYSIGRSSKN L+IKNDKSISRQH+TFKWEIN  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
           LN K + LSL+NQGKLTSINKKF+KVGE   I   +VSN T IELGT+P  I+  W+ EI
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           WNIPS+L +F+T LSQFGI+T++             FPS++D+GMRELYALV+ IPLKK 
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240
           +LLVD+C +LL +SV NLKFDE W +++N P F VF++D SVL SKFM+L+ +I LTT  
Sbjct: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240

Query: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300
           NE  L   LR LNV+L +FD +  LY+HVD LKPS KYLILT TNK ENGQ  CT+  LI
Sbjct: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300

Query: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXX 360
           TS+I+D LP++ NTK+VP E+Q N   E+V E  +  SKT+HTPE E  PA         
Sbjct: 301 TSVIEDALPAITNTKSVPCEIQ-NKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359

Query: 361 XXXQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420
              QPLDSL+FFAGGLS+  SS+H+ FADA++    L  KT +SSP I  +D   S +V+
Sbjct: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419

Query: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSP-TVTRPDSQNIS 479
           N Q++  +  KENG   TGA+V+ SPE+     H  E+  ++  + SP TVTRP  Q   
Sbjct: 420 NIQKVDENNEKENGQKSTGAIVISSPEL--YAEHISEDSEDKPPRLSPLTVTRPGLQ--- 474

Query: 480 AYPVT--TTPEKHMEGRKIVESYKISDDSXXXXXXXXXXXXXXXXXXXXXXMKIKLQTLK 537
           + P+   TTP  +ME ++I E+Y+    S                          +QTL+
Sbjct: 475 SNPLISRTTPAHYMEDKRIAENYENGKSSTRDI----------------------IQTLE 512

Query: 538 DNRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVE 597
           +N +    SQ+  S+ Q    SP++EL  K +SNTP SFVEAIQ+TKNREV+R KSTIV+
Sbjct: 513 ENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQ 572

Query: 598 LEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNF 657
           LEDDELSEE INQL NLAIVEP+ +LLR P+ +G+N  R+ A+++E G +RQEW +RKNF
Sbjct: 573 LEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNF 632

Query: 658 KTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDD 717
           KTF KVWP  K   EG+KG+ QNSDFIRSAAFLITRNYVPL+KYSK ++A+  + + N+D
Sbjct: 633 KTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENED 692

Query: 718 VLALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTAST 777
           +L L EMENL S+T +  NT ++VIQ+    Q++ + E+ SD+  ++SFSFSR SD A  
Sbjct: 693 MLGLIEMENLVSNTGVSGNTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIA-- 750

Query: 778 YQPVKNKLFVAXXXXXXXXXXXXXXXXXGFELVTITKSNLQPDAAEESSKRNRSGGNAAS 837
            QP KNKLFV                  G EL+T+ K  L+P   +E SK NR   + A+
Sbjct: 751 -QPAKNKLFVT---EDDDKNNMVNDSENGCELITLKKIGLRPSNFDEPSKGNRRSRSTAA 806

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/885 (50%), Positives = 555/885 (62%), Gaps = 40/885 (4%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWV+RYQNILEDG+I+ ISCCLQASKSYSIGRSSKN L+IK+DKSISRQH+T KW+ N  
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
            +   N L L+NQGKLTSIN KFMKVGET  I    VSN T IELG TPIRI+ EW +++
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           WNIPS+LAQF+T LSQFGI+T+T             +PS++D+ +REL AL   IPLKKS
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240
           QLLV LCN+LLS+S+ +L FDE WN++V  P + VFD +P +LFSKFM+L ++  LTTI 
Sbjct: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240

Query: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300
           NE  LP+ILRR N++LF F  +N LYKHVD LKPS KYLILT  NK+ENGQ LCT + L+
Sbjct: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300

Query: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXX 360
           TS+I DTL SVINTK+V FE   N TP +  E  ++ SK  HT ETEA+P          
Sbjct: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVILKKRRLNR 360

Query: 361 XXXQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420
               PLDSLNFFAGGL+   SS+ K   D KE    L+SK+ +SSPII   + K S   Q
Sbjct: 361 RRVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420

Query: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISA 480
           +TQ+++ D  KENG+  TGA++V SPE   +VR  +        Q S  +TR DSQ  SA
Sbjct: 421 DTQKVAGDIEKENGHNSTGAIIVSSPE-SDAVRTSKRFLDISPQQSSTNMTRRDSQKKSA 479

Query: 481 YPVT--TTPEKHMEGRKIVESYKISDDSXXXXXXXXXXXXXXXXXXXXXXMKIKLQTLKD 538
             V   T     ME  K  ++Y I+                              QT + 
Sbjct: 480 DFVNFETAATSSMEEDKATKAYSITGHPTHSVT----------------------QTSEG 517

Query: 539 NRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVEL 598
           + +    SQK     +A   SP++E+S +E+S+ PHSFV+AIQQTK REVKRVKSTIVEL
Sbjct: 518 SHELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVEL 577

Query: 599 EDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFK 658
           EDDELSEEAINQL  LAIVE +N+LLR       N   SS  +   G IRQEW +RKNFK
Sbjct: 578 EDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFK 637

Query: 659 TFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDV 718
           TF K WP  K  KEG K + Q SDFIR AAFLITRNYVPLKKYSKK++ + WDKE +DD+
Sbjct: 638 TFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDM 697

Query: 719 LALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTASTY 778
            ALTEME + S+ +I D T+++ I +R   Q   + E++SD+ +E SFSFSR SD A   
Sbjct: 698 HALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFISEDSSDNGEEDSFSFSRGSDAAPNA 757

Query: 779 QPVKNKLFVAXXXXXXXXXXXXXXXXXGFELVTITKSNLQPDAAEESSKRNRSGGNAASR 838
           QP   KLF+                   F+LVT + ++LQ + +E+S K N  G  A S+
Sbjct: 758 QPGTIKLFITDDNGNDNKSDRVYDKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISK 817

Query: 839 PLGSYRXX---------------XXXXXXXXXXXEGPKFKFKRKK 868
             GS R                            +GPKFKFKR+K
Sbjct: 818 SRGSSRASDIYHNNNNNNNNNNNNAADDDDDDDDDGPKFKFKRRK 862

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/881 (48%), Positives = 566/881 (64%), Gaps = 39/881 (4%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWV+RYQN LEDGSI+ ISCCLQA K+YSIGRSSKN L+IKNDKSISRQH+TFKWEIN+S
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
            + K + L LVN+GKLTS+NKKFMKVGET TI+ + V   T IELGTTPIRI+FEWI+E+
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           WNIP +L QF+T+LS++GI+T+              +P + D+ +RELYALV TIP+KKS
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240
           + L++LCN+LL +S  NLKFDE WN+M++ P + VFD+DP++L SKFMRL+N+  LTTI 
Sbjct: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240

Query: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300
           +E  L ++LR  N+ LF FD ++ LYK+VD L+ S +YLILT T+K+ENG+ LCT++ ++
Sbjct: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300

Query: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXX 360
           TSIID TL +VIN K       +N   +++ EG + I KT   PE EA+P          
Sbjct: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360

Query: 361 XXXQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420
               PLDSL+FFAGGLS    S+++   DAK       SKT +SSP I E D K +  +Q
Sbjct: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420

Query: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESL------QPS-PTVTRP 473
           N  + + D  K++G+   GA++V SP +G    +  E+ +++SL      QPS P V   
Sbjct: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLG--TVNTSEDSLDKSLQSHKLPQPSLPEVAGI 478

Query: 474 DSQNISAYPV--TTTPEKHMEGRKIVESYKISDDSXXXXXXXXXXXXXXXXXXXXXXMKI 531
            SQ IS+      T     M+  ++ ++++++                            
Sbjct: 479 GSQTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIE---------------------- 516

Query: 532 KLQTLKDNRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRV 591
             Q  K+ RK S  S++  S  Q    SP++ELS+KE+S TPH+FVEAIQ+TKNREVKRV
Sbjct: 517 --QPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRV 574

Query: 592 KSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEW 651
           KSTIVEL+D+ELSEEAINQL NLAIVEPSN LLR       N+T  +  + E   +  EW
Sbjct: 575 KSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEW 634

Query: 652 PKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWD 711
            KRKNFKTF KV P SK  KE  K N Q+SDFIR+AAFLITRNYVPLKKYSKKD  + W 
Sbjct: 635 HKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWG 694

Query: 712 KENNDDVLALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRR 771
            E N+D+ ALTEME   S+T + DN +++ IQ+RS A +    E++S++ +E SFSFSR 
Sbjct: 695 TEENEDMFALTEMERFGSNTFMSDNINSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRC 754

Query: 772 SDTASTYQPVKNKLFVAXXXXXXXXXXXX---XXXXXGFELVTITKSNLQPDAAEESSKR 828
           S TA++ QP+KNK+F+                        L  + + NL+P+ +EE SK+
Sbjct: 755 SGTAASVQPLKNKIFITDEDDLGDIDDKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQ 814

Query: 829 NRSGGNAASRPLGSYRXXXXXXXXXXXXXEGPKFKFKRKKG 869
           +R   +A SR  GS+              +GPKF FKR+KG
Sbjct: 815 SRHSRSATSRSRGSF-GASNNGDGDDDDDDGPKFTFKRRKG 854

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  164 bits (414), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 134/452 (29%), Positives = 203/452 (44%), Gaps = 67/452 (14%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RY+N LEDG++  +SCCLQ  K YSIGRSSKN L IKNDKSISRQH+T +W+ N+ 
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
               G  LS+VNQGKLT+I++ +MK  E+        S    ++LGT P+ ++  W    
Sbjct: 61  --GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYST-VVVKLGTKPVVVRISWTPIF 117

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALV-HTIPLKK 179
           W++  +  QF+  ++  GI T+                 +N    R ++AL+     L K
Sbjct: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSN--WSRIMFALLKQNCTLVK 175

Query: 180 SQLLVDLCNSLLSSSVMNLKFDETWNNMV----NKPLFKVFDYDPSVLFSKFMRLDNVIT 235
             LL ++CN LL+    N  FDE W  +     N  ++  F  + + +   F      + 
Sbjct: 176 PVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQD----VQ 229

Query: 236 LTTIGNESG-----LPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKREN- 289
             T+G+ S      L   +  L      FD  +DL   V  +K     L+     K+E+ 
Sbjct: 230 FYTVGSISHDDLLYLKATVSELQGNFKSFDTADDL---VTYIKTVNHNLLKCIALKQEDP 286

Query: 290 ------GQKLCTLQNLITSIIDDT---LPSVIN----------TKAVPF---------EV 321
                 G K+  ++ ++ +I+D     LP+ I           T ++            V
Sbjct: 287 APDEIQGIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHV 346

Query: 322 QENNTPEKVFEGHTAISKTVHT---------PETEATPAXXXXXXXXXXXXQPLDSLNFF 372
             +NT       H  IS              P T   P+            +PLDSL+FF
Sbjct: 347 HPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFF 406

Query: 373 AGGLSADPSSKHKGFADAKEPIFNLNSKTTVS 404
           AGG S +PS+  K  +    P+   N+  T S
Sbjct: 407 AGG-STNPSTTLKTVS----PVVPSNASNTTS 433

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 86/143 (60%), Gaps = 24/143 (16%)

Query: 563 ELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNE 622
           ++SL ++S +P +F+EA+Q TK REVKR+++ IV++   ELSEEAIN+L+NL IVE +  
Sbjct: 569 DVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPN 628

Query: 623 LLRDPRSVGSNRTRSSARRSEKG-AIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNS 681
           L+R+             RR++K  ++   W  R+NFK F KVWP  +             
Sbjct: 629 LIRE-------------RRADKNDSVNDMWKGRRNFKKFNKVWPQHR----------DGY 665

Query: 682 DFIRSAAFLITRNYVPLKKYSKK 704
           D +R+ AFLI RNYV LK Y  K
Sbjct: 666 DSLRNNAFLIIRNYVELKPYDGK 688

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 135/422 (31%), Positives = 194/422 (45%), Gaps = 69/422 (16%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWV+RYQ  LEDGS   IS C+Q S  Y+IGRS+KN L IKNDKSISRQH++ KWE    
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
                N + ++NQGKLT I ++++ VG++ T       N   I+LGT P+ +  E+    
Sbjct: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSLTFGNV---NSLSIKLGTKPVMVHLEFYSSN 110

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           W IP+ L QF   L  FG+   T                 N  G+  L+  +  IP+KK 
Sbjct: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKP 170

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNM--VNKPLF-----------KVFD-YDPSVLFSK 226
           Q     C  +LSS+  +  FD +W+ +   +  LF           ++F+ Y   +LF  
Sbjct: 171 QFFSTAC-EILSSN--DNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDN 227

Query: 227 FMRLDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPS--EKYLILTFT 284
               D V TL T  N  G           +  F  LN    +++ LKP+  +   ++ F 
Sbjct: 228 ETNKDAVKTLKTALNLGG---------AIVNDFSDLNASKDYINNLKPTTNQHICLVKFG 278

Query: 285 N-KRENGQ----KLCTLQNLITSIIDDTLPSVINTKAVPFEVQENN-----TPEKVF--E 332
           + K  N Q    +   L+++IT+I DD +  +I T  +P   Q  N      PE  +  +
Sbjct: 279 SFKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITT--IPEREQVMNQDVSLIPEITYPSD 336

Query: 333 GHTAISKTVHTPET---------------EATPAX--XXXXXXXXXXXQPLDSLNFFAGG 375
             T I  + HT ++               EAT                +PLDSL FFAGG
Sbjct: 337 RKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGG 396

Query: 376 LS 377
            S
Sbjct: 397 AS 398

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 140/242 (57%), Gaps = 29/242 (11%)

Query: 561 LRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPS 620
           L+  SL+E    P SFV+AIQ+TKNREV R+KST+VE++ DEL+E AINQL +L IVEP+
Sbjct: 530 LKSNSLEE----PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPN 585

Query: 621 NELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPN-SKTPKEGDKGNNQ 679
             L+R   S    RT  +   S+K A  +EW +RKNFK F K++P   K   E D     
Sbjct: 586 QSLIRKKASRCECRT-PTGEDSDKTA--REWSRRKNFKKFVKIYPKYMKKDTESD----- 637

Query: 680 NSDFIRSAAFLITRNYVPLKKYSKK-DRASNWDK---ENNDDVLALTEMENLESDTHIP- 734
            +D IR+ AFLITRNYVP+KK++ + +   N D+   E++D       +EN + D  IP 
Sbjct: 638 TTDLIRNNAFLITRNYVPMKKFTGQYNNVPNDDEDMYEHHD--YERENIENGDGDLAIPP 695

Query: 735 ---DNTDASVIQERSY---AQDSVMKENNSD--DMKERSFSFSRRSDTASTYQPVKNKLF 786
              D   +S + +R     +Q + +K+   D  D + +SFSF RRS   +      N LF
Sbjct: 696 VVNDFIPSSQLSQRRLQIDSQSARIKDTQPDFSDDEGQSFSF-RRSMANAKKTTANNGLF 754

Query: 787 VA 788
           V 
Sbjct: 755 VV 756

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 111/382 (29%), Positives = 182/382 (47%), Gaps = 50/382 (13%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RYQ  LEDG++  +SCCL+  ++Y+IGRSSKN L IKNDKSISRQHV+  W+  D 
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKD- 59

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
                 +L L+NQGK+T++++K++K+GE  +IS  K      +ELGT P++++ +W+D I
Sbjct: 60  -----RQLKLINQGKMTAVSEKYLKMGE--SISFGKSMGTVLVELGTKPLKMQLQWMDSI 112

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           W +P       + L + GI   +                   +  R LY LV  IPL   
Sbjct: 113 WMVPQGSRSDHSALEELGIEVLSSELSRANLIVI----DEQQNYSRWLYGLVKRIPLMNL 168

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKP--LFKVFDYDPSVLFS-KFMRL----DNV 233
           + L  +   +   S    +FD  W  ++N     +K ++    VL + +F+ +    D  
Sbjct: 169 EFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTS 225

Query: 234 ITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKL 293
           + +   G +      +  L   +     L+++      L P+E+   L          K 
Sbjct: 226 LAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLG---------KT 276

Query: 294 CTLQNLITSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXX 353
            T+Q+++ +I+ D + S+ N   V  EV +    E   E      + ++ P         
Sbjct: 277 FTVQDVVEAILKDEVNSLKN--GVIGEVAKRPEAEVPMEKPVTKKRRLNRPRV------- 327

Query: 354 XXXXXXXXXXQPLDSLNFFAGG 375
                     +PLD L+FFAGG
Sbjct: 328 ----------KPLDILSFFAGG 339

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 85/153 (55%), Gaps = 21/153 (13%)

Query: 557 HNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAI 616
           H  P      K +S + +  ++ IQ TKN EVKR+ STI+++ D+EL+E+AINQL NL +
Sbjct: 441 HRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVL 500

Query: 617 VEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWP----NSKTPKE 672
           V+ ++ L+R        R RS    S        W  RKNFK F KVWP       T +E
Sbjct: 501 VDRNDNLMR-------RRDRSPTVDSHN----PNWNNRKNFKNFVKVWPKYGGQDSTSRE 549

Query: 673 GDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKD 705
           G      +SD IR+ AFL+TR YVP + Y+  D
Sbjct: 550 G------SSDTIRNRAFLLTRQYVPTRTYTSGD 576

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 113/393 (28%), Positives = 188/393 (47%), Gaps = 35/393 (8%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW+++Y   LEDG+I  +S CL   +++SIGRSSKN L IKNDKSISR H++  W+    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTI-SVTKVSNHTEIELGTTPIRIKFEWIDE 119
           L      + L+NQG+LT+   K++KVGE+        +     IELGT PI+++  W D 
Sbjct: 61  L------IRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114

Query: 120 IWNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKK 179
           ++++PS L+QF   L   GI  K                       + L+ L++   ++ 
Sbjct: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVT--DKIKFAYKCLFGLINGAVIRN 172

Query: 180 SQLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVF--DYDPSVLFSK----FMRLDNV 233
           SQ LV++ N L   S     F+E+W++++    + ++  +  P  +  K    ++   +V
Sbjct: 173 SQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDV 229

Query: 234 ITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTF---TNKRENG 290
           IT+  +         L R N  L   +    L   +     ++  ++L     T    + 
Sbjct: 230 ITMAYVQEA------LERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDK 283

Query: 291 QKLCTLQNLITSIIDDTLPSVIN----TKAVPFEVQENNTP---EKVFEGHTAISKTVHT 343
            KL TL +L+ ++  +T+ +++      +A P +V  ++ P   +       ++S   HT
Sbjct: 284 IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHT 343

Query: 344 PETEATPAXX-XXXXXXXXXXQPLDSLNFFAGG 375
           PE   TPA             +PLDSL FFAGG
Sbjct: 344 PEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG 376

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 82/129 (63%), Gaps = 8/129 (6%)

Query: 576 FVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRT 635
            V+ I+  K+REVKR+KST+V+++ DEL+E+AINQL +LAIV+P++ L+R        R 
Sbjct: 518 LVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIR--------RQ 569

Query: 636 RSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNY 695
           +  +  + +      W  RKNFK F KV    K  + G+     +SDFIR++ +L+TR Y
Sbjct: 570 KIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQY 629

Query: 696 VPLKKYSKK 704
           VP K Y+K+
Sbjct: 630 VPSKIYTKE 638

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 126/424 (29%), Positives = 189/424 (44%), Gaps = 81/424 (19%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RYQ  LEDG I  +S CL+ S +YSIGRSSKN L IKNDKSISRQH+T KWE    
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWE---- 56

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
             P G +L LVNQGKLTS+ ++++ + E+   +V   +   ++ LGT P+ ++  W    
Sbjct: 57  --PSG-QLHLVNQGKLTSVKERYLAIDESLIFNVVD-TKELDVHLGTNPVIVQIRWQPMN 112

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
             IP+   QF+ +L+++GI   +                N  D    L AL   IP+ KS
Sbjct: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPN--DYYVPLLALALGIPVFKS 170

Query: 181 QLLVDLCNSLLSSSVMNLKFD---ETWNNMVNKPLFKVF-----------DY-------- 218
           Q L ++ N L      N+ FD   +  N+M +  L   F           DY        
Sbjct: 171 QYLTEVSNMLRPD---NITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNK 227

Query: 219 -------DPSVLFSKFMRL----DNVI--------TLTTIGNESGLPNIL--------RR 251
                  D S +  K ++L    + +I        ++T I + SG  NI+        +R
Sbjct: 228 SSVSEHADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSG-KNIVIVTDEDNGKR 286

Query: 252 LNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLITSIIDDTLPSV 311
           +   + +F+C N             K +  +F    +N  KL       T ++    P +
Sbjct: 287 M---IMNFECRN------------VKDIFDSFV---KNDPKLLKSNLTETGVVSPKAPEI 328

Query: 312 INTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXXXXXQPLDSLNF 371
              + +  E+QE      + E  T+     HTP    T              +PL+SL+F
Sbjct: 329 FENEKLMVEIQEPPIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDF 388

Query: 372 FAGG 375
           F GG
Sbjct: 389 FVGG 392

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 134/254 (52%), Gaps = 36/254 (14%)

Query: 562 RELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSN 621
           RE S +    TP S VE IQ  KNREV R++S+I  ++ +EL+E+AIN+ +NLAIVE + 
Sbjct: 527 REDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNA 586

Query: 622 ELLRDPRSVGSNRTRSS----ARRSEKGAIRQEWPKRKNFKTFAKVWP---NSKTPKEGD 674
            L+R  R+  ++ T  S     R      I      R+NFK F KV+P    +K     +
Sbjct: 587 SLIR--RTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNE 644

Query: 675 KGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASN-----------------WDKENNDD 717
           +G+N  SDFIR+ AFLITRNYVPLK+YSK D +                   +D E   +
Sbjct: 645 RGDNGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGN 704

Query: 718 VLALTEMENLESDTHIPDNTDASV----IQERSYAQDSVMKENNSDDMKERSFSFSRRSD 773
            L+ T+ EN E+  H+     A        + SY  D+    N  D++K  SFSFSR   
Sbjct: 705 GLSSTQHEN-ENGVHLSATNQAHFQRSRSSQSSYNVDADEDSNEDDNIK--SFSFSR--- 758

Query: 774 TASTYQPVKNKLFV 787
           T+   +P  NKLFV
Sbjct: 759 TSLPKEPAPNKLFV 772

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  141 bits (356), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 188/402 (46%), Gaps = 49/402 (12%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWV+RY  + E G +  +SCC++ +  Y+IGRSSKN LVIKNDKSISRQHV+ KW     
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKW----- 55

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
            +   N + L N GKLT  ++K++  G    I+ +      E+ LG  P++I    IDE+
Sbjct: 56  -SSSKNCIELTNTGKLTKSSEKYL--GSNELITYSADETQIEMLLGVAPVKIILSRIDEL 112

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           ++IP++L+QF+  L   GI                   +  D G REL+A  + I +  S
Sbjct: 113 FDIPNSLSQFRETLETLGIQISV----DNANVNSTSLITVGDFGYRELFAACNDINIYSS 168

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVN--------KPLFKVFDYDPSVLFSKFMRLDN 232
            LL ++CN L++    +  FD  W +M +        + L   F       F    ++D 
Sbjct: 169 GLLTEICNKLVND---HDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDW 225

Query: 233 VITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLK----PSEKYLILTFTNKRE 288
            I        S L   L +L+V +      + ++K+ DLL+         + +  +N++ 
Sbjct: 226 FII-------SYLKPFLLKLSVEIH-----DSIHKNDDLLRLISSKQADEIPIVISNEKI 273

Query: 289 NGQKLCTLQ---NLITSIID--DTLPSVINTKAV---PFEVQENNTPEKVFEGHTAISKT 340
                 TLQ   + I   I+  D   + I  +++   P    E+ T   +     +++ T
Sbjct: 274 KYLPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANT 333

Query: 341 VHTPETEATPAXXXXXXXXXXXXQPLDSLNFFAGGLSADPSS 382
             +  T+ +              +PL+SL+FFAGG+S  P +
Sbjct: 334 --SQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGT 373

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 74/124 (59%), Gaps = 14/124 (11%)

Query: 576 FVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRT 635
            V+ +Q TK  EVKR+ STIV++ED EL+EEAIN+LN+L +VEP  +L+R    + +N T
Sbjct: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT 612

Query: 636 RSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNY 695
                       +Q+W  RKNFK F K+ P  K+ +   +  +++   IR +  ++TR +
Sbjct: 613 -----------TQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRH---IRGSGEILTREF 658

Query: 696 VPLK 699
           +  K
Sbjct: 659 LQTK 662

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  119 bits (298), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 117/416 (28%), Positives = 187/416 (44%), Gaps = 56/416 (13%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSK-NELVIKNDKSISRQHVTFKWEIND 59
           MW++RY    ED     +SCCLQ S++YSIGRSSK N LVIKNDKSISRQH++F+W  +D
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  SLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDE 119
            ++       +VN GKLT IN  F+K  ET+ IS++  S  T I++G+ P+ +   W D 
Sbjct: 61  YVD-------IVNDGKLTYINDAFLKPKETTRISIS-ASKETNIKVGSAPVIVNLVWEDV 112

Query: 120 IWNIP--SNLAQFQTIL------SQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYAL 171
             ++   S+  Q   ++      S  G+  +              +P        +L AL
Sbjct: 113 FIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWP-------HQLIAL 165

Query: 172 VHTIPLKKSQLLVDLCNSLLSSSVMNL-KFDETWNNMVNKPLFKVFD---------YDPS 221
           +          LVDL    L  S  N+  FDE WN  V+   +K +           D +
Sbjct: 166 IRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFT 225

Query: 222 VLFSKFMRLDNVITLTTIGNESGLPNILRRLNVRLFH-FDCLNDLYKHVDLLKPSEKYLI 280
           +++  F   D+ I+      E     +L  +N   F  +   N+   +V LL+ SE++ +
Sbjct: 226 IIY--FDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR-SERFQV 282

Query: 281 LTFTNKRENGQKLCTLQNLITSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAIS-K 339
                +  N   +C+  +   ++ ++ + ++++              E     +T I+ K
Sbjct: 283 SHPVYEILNKIDICSTGSFFKAVTENNVSTLVHR-------------ELFLRRYTDITQK 329

Query: 340 TVHTPE--TEATPAXXXXXXXXXXXXQPLDSLNFFAGGLSADPS--SKHKGFADAK 391
            +  P+   E T              QPL+ L FFAGG +A  +  S   G A  K
Sbjct: 330 EMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSDDGLAATK 385

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 74/132 (56%), Gaps = 26/132 (19%)

Query: 575 SFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLR-DPRSVGSN 633
           S VE IQ  K+ E +R++ T+  ++  EL++EAI   +N+AIVEP+  ++R  P  V  +
Sbjct: 546 SLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTES 605

Query: 634 RTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITR 693
             RS                R NFK F KVWP ++      KGN    D +R+ A+LITR
Sbjct: 606 SIRSD---------------RPNFKKFMKVWPKAR------KGN----DSLRNNAYLITR 640

Query: 694 NYVPLKKYSKKD 705
           +YVP+K Y++ +
Sbjct: 641 DYVPMKAYNRNE 652

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 117/476 (24%), Positives = 201/476 (42%), Gaps = 79/476 (16%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RY+   EDG+  SISCCL+    Y IGRS+K+ L IKNDKSISR+H+  K  +N  
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLK--VN-- 56

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
              K N+L+L+N GKLT++N + + V ++             +ELG  PI    EW D++
Sbjct: 57  ---KENELNLLNTGKLTTLNAEVLMVDQSLNFHP---KGQLRLELGIKPIIATIEWQDQV 110

Query: 121 WNIPSNLAQFQTILSQ----FGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIP 176
           W +  +L        Q    +GI+  T                N D     L++LV  I 
Sbjct: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMSTRTNLQI---IKQNQDTYSNCLFSLVKGID 167

Query: 177 LKKSQLLVDLCNSLLSSSVMNLKFDETWNNMV------------------------NKPL 212
           + +   L D  + L  +      +D  W N++                        +K +
Sbjct: 168 IVRESFLSDFQSHLYMTPT---DYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSI 224

Query: 213 FKVFDYDPSVLFSKFMRLDNVITLTTIGNESGLPN---ILRRLNVRLFHFDCLNDLYKHV 269
           + +F Y   V   + +  +N+        E+       IL+ +       +  ND   ++
Sbjct: 225 YNLFKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHIT----EANLTNDKNSNI 280

Query: 270 DLLKPSEKYLILTFTNKRENGQKLCTLQNLITSIID-------DTLPSVINTKA------ 316
           D+ + + K   L    +   G KL  + +L+ +++        + +P+ I+ ++      
Sbjct: 281 DMSEDARKLEELKAAAESL-GYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEE 339

Query: 317 --VPFEVQENNTP--EKV-----FEGHTAISKTVHTPETEATPAXXXXXXXXXXXXQPLD 367
             +P ++ E  TP  +KV     F+G    S   +  E                  +PLD
Sbjct: 340 PKLPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLD 399

Query: 368 SLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQNTQ 423
           SL+FFAGG   +  +K++G    +E  F +   T  +S    ++D+      QN +
Sbjct: 400 SLDFFAGG---NIQAKNEGIQKNQE--FGMTRVTEGNSEGFHDVDKDDVIDEQNVE 450

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 87/152 (57%), Gaps = 20/152 (13%)

Query: 575 SFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNR 634
           + VEAIQ TK+REV R+K+T+++++ +EL+E AIN L+NLAIVE   +L+R       N 
Sbjct: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVE-KKDLIR------KNS 626

Query: 635 TRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRN 694
            R     S+       W  RKNFK F KV P  ++ +E    + +N   ++++AFLITR 
Sbjct: 627 ERGHCISSDTCL----WEGRKNFKKFIKVQP-RRSQRETFDSDGKN--IVKNSAFLITRE 679

Query: 695 YVPLKKYSKKDRASNWDKENNDDVLALTEMEN 726
           YVPLKK+         +KE  DD   L    N
Sbjct: 680 YVPLKKFDPN------EKEQIDDTFFLNHSAN 705

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 106/204 (51%), Gaps = 11/204 (5%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MWV+RYQ  L+DGS+  ISCC++  ++Y +GRSSKN+L ++NDKSISRQ ++ +W+ +  
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
                  + + N GK+T + ++++  GE  T+S    ++   +++GTTPI +   W  + 
Sbjct: 61  C------IMVKNLGKVTMVEERYLSDGE--TLSFQSKNDLVTMKIGTTPIVVNLSWEVKR 112

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
            N          +L  +G    T               +   D   + Y+++H   L  S
Sbjct: 113 CNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINS 172

Query: 181 QLLVDLCNSLLSSSVMNLKFDETW 204
           + L D+   L ++ +M  KFD  W
Sbjct: 173 KTLRDI---LTNNIIMTKKFDSYW 193

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 117/208 (56%), Gaps = 39/208 (18%)

Query: 576 FVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRT 635
            V AIQ  K RE  RVK++IVE++++EL+EEAIN+ ++L +V+ +  L +D +S+  N+ 
Sbjct: 524 LVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKD-KSLDINKP 582

Query: 636 RSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSD----FIRSAAFLI 691
            +S + +       +W  +KNFK F K+ P  K  +    GN Q++D    FIR++A LI
Sbjct: 583 ANSNQNN------MDWSGKKNFKKFVKMVPKYKRSQ----GNGQHADSCSTFIRNSAMLI 632

Query: 692 TRNYVPLKKYSKKDRASNWDKENNDDVLALTEMENLESDTH-IPDNTDASVIQERSYAQD 750
           TRN+VP+K+YSK D  SN ++        +T+  N+E +   +  N +A       Y+ D
Sbjct: 633 TRNFVPMKQYSKLDNNSNSNE--------MTDFSNIEVNKKPVEKNREA-------YSSD 677

Query: 751 SVMKENNSDDMKERSFSFSRRSDTASTY 778
                   D + E SF+F+R S +   +
Sbjct: 678 --------DSVDEPSFTFTRNSSSKQLF 697

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 108/205 (52%), Gaps = 11/205 (5%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW+I Y     D ++ ++SCCL+ +++YSIGRS K+ L +KNDKSISRQHVTF W     
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
                N+LSL+NQGKLT +N + +   ET   +   + +  E+ELG TP+ +   W + +
Sbjct: 56  TGNLNNQLSLLNQGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXF---PSNNDDGMREL-YALVHTIP 176
           +NIP    QF++ L  +G                      P NN+     L Y+LV+   
Sbjct: 115 YNIPIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174

Query: 177 LKKSQLLVDLCNSLLSSSVMNLKFD 201
           + KS  L  L N LL+ +V     D
Sbjct: 175 ILKSSFLTSLLN-LLNPNVTTFNID 198

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 120/229 (52%), Gaps = 32/229 (13%)

Query: 546 SQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSE 605
           S K    Q+ G  SP++      +S TP++F+ A+Q  KNRE  R+ S  V++ D+EL+E
Sbjct: 585 SLKRSKEQEKGTVSPVK------RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTE 638

Query: 606 EAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWP 665
           EAIN+ +NLA+VE + +++    S G     S         I  +W  RKNFK F K  P
Sbjct: 639 EAINKFSNLAVVETNVDIV---ISEGKKNNESIT------DIDPKWKGRKNFKNFVKQLP 689

Query: 666 NSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDVLALTEME 725
             +  K    G+N  + FIR++AFL+ R YVP++++ K +   N  +E  +  +  +  +
Sbjct: 690 KYRM-KTMPSGDNGVASFIRNSAFLLAREYVPMQEF-KMNNQGNRIQEFPEFPVEYSPQQ 747

Query: 726 NLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMK--ERSFSFSRRS 772
                        A  +     + +++ +  +SDD++  E+SFSFSR S
Sbjct: 748 -------------AEQLPSNGASMNTITQTFSSDDLETLEQSFSFSRAS 783

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 109/399 (27%), Positives = 173/399 (43%), Gaps = 53/399 (13%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           M ++RY+N+L DG +N +SCCL     Y+IGRSSKN+  IKNDKSISRQHV+  W+   S
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKY--S 58

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKF------ 114
            + K   + + N GK+T I  K++   E  T+  T +    E+ +GT+PI ++       
Sbjct: 59  SDDKNVIIQIKNFGKVTMIKDKYLSQDE--TLQFTLIDKKLEVNIGTSPITLEIFNQEVV 116

Query: 115 -EWIDEIWNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVH 173
              I++I N  S L     IL+   I                   ++  D + EL++ V 
Sbjct: 117 CNSIEDIQNSDSKL-----ILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVF 171

Query: 174 TIPLKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNV 233
            IP+   + L  + N+    S     +D+ ++   NK    + D       S+   +D  
Sbjct: 172 GIPIVTIEELRGIANANDFYSY----WDKIYSRKKNKGKACMLDLSTCYYISE---VDKY 224

Query: 234 ITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKL 293
           +    +         +R LN  +      +DL K  D+ K   K           N  K 
Sbjct: 225 VDYVKVA--------IRSLNAEIKILKDKDDLVK--DIRKNISK----------GNISKF 264

Query: 294 CTLQNLITSIIDDTLPSVINTKAVPFE-VQENNTPEKVFEGHTA----ISKTVHTPETE- 347
             L N IT   +      + + A   E V+ NN  + V   +++    I + V +P+ + 
Sbjct: 265 FVLSNDITQGEEAPFNISVTSIAKLLEAVKTNNMKDIVMHDYSSFKIEIPREVKSPKDDN 324

Query: 348 ----ATPAXXXXXXXXXXXXQPLDSLNFFAGGLSADPSS 382
                 P             +PLD+L+FFAGG+S D  S
Sbjct: 325 IIEKQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHS 363

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 104/237 (43%), Gaps = 20/237 (8%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RYQ I E GS   +SCCL+    Y +GRS K+ L IK DKSISR+HV  +   N  
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
                +KL ++N GKLT I    +K+ +       +      +E+G  P++    +   I
Sbjct: 59  -----SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQ---SVALEMGAGPVKGTVTYEPAI 110

Query: 121 WNIPSNLAQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPLKKS 180
           W IP +LA  +++ +   +                    +       L+ALV  IP+   
Sbjct: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCE 170

Query: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMV--NKPLFKVFDYDPSVLFSKFMRLDNVIT 235
             + D  +    + +    FD  W  +   N P  ++   D +     F  L+ V+T
Sbjct: 171 GFIGDFVSQFADTQI---DFDAKWEQITLKNAPFLELQTKDAA-----FKGLNFVVT 219

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 75/129 (58%), Gaps = 12/129 (9%)

Query: 573 PHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGS 632
           P S ++A Q+ K  EV R+K  + ++  +EL+EEAIN+L+NLA VE   +L+R P  V  
Sbjct: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKV-DLMRRPSEVPE 583

Query: 633 NRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLIT 692
           N        +++     +W +RKNFK F K+WP+  +    D      +D +R+ A+LIT
Sbjct: 584 N-------SNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNI----TDAVRNKAYLIT 632

Query: 693 RNYVPLKKY 701
           R+YV L  Y
Sbjct: 633 RDYVSLCPY 641

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 100/211 (47%), Gaps = 19/211 (9%)

Query: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60
           MW++RYQ +  +G    +SCCL+    YSIGRS+KN L IK+DKSISR HV    E++ S
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58

Query: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120
            N     + L   GKLT ++ K +K G+    +  +       E+G +PI+         
Sbjct: 59  CN-----VVLRVVGKLTKVSGKSVKAGQHLQFTADE---EVLFEMGASPIKATVVKQQSF 110

Query: 121 WNIPSNLAQFQTI---LSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIPL 177
           W IP +L+  Q++   L+ F I                    ++      L++L+  IP+
Sbjct: 111 WKIPHDLSLSQSLSRHLADFDIQV---TNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPI 167

Query: 178 KKSQLLVDLCNSLLSSSVMNLKFDETWNNMV 208
            +   + D    +   + ++  FD  W+ MV
Sbjct: 168 LREHFIGDFVTQI---NDVHADFDSRWDRMV 195

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 20/166 (12%)

Query: 569 QSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPR 628
           ++  P SF +A+++TK+ EV R++  IV +  +EL+EEAIN+L+ LA+VE + +L+R   
Sbjct: 516 EAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMR--- 571

Query: 629 SVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAA 688
                  R  A   + G   Q W  RKNFK F K+WP+  +    D   N     +R+ A
Sbjct: 572 -----ADREYAVCGQSGGSEQ-WAGRKNFKKFVKLWPSRSSRNSPDSATNA----LRNRA 621

Query: 689 FLITRNYVPLKKYSKKDRASNWDKENNDDVLALTEMENLESDTHIP 734
            LITR YVPL+ Y  +      +  N DD       ++L+ +   P
Sbjct: 622 HLITREYVPLRPYEGQ------NANNQDDSFLKNSQDDLQEEATCP 661

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 109/228 (47%), Gaps = 25/228 (10%)

Query: 1   MWVIRYQNILEDGSINSISCC--LQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58
           MW++ +  I +D +  S   C  LQ    YSIGRS+K    I+ DKSISR H+  K++  
Sbjct: 1   MWIVSF--IFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD-- 56

Query: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118
                 G+ L + N+GKLT  N++ + + ET  +     + +T I +G  PI +   +  
Sbjct: 57  ------GSDLIITNKGKLTKFNEEIIPLDETIVVH----NQNTVINIGGMPIDVNVRYFY 106

Query: 119 EIWNIPSNLA--QFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHTIP 176
           E W IP  L   + ++++S FG+  K                S++  G   L+AL+  +P
Sbjct: 107 EEWKIPHRLELNETKSLVSDFGV--KLSESFSKKTTTQICSDSSSYSGC--LFALLKGVP 162

Query: 177 LKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNK-PLFKVFDYDPSVL 223
           +   + L  +   L   +   L F   +  ++N+  LF  + Y P+VL
Sbjct: 163 VVSIEFLNQMGKLLQQGNY--LDFQSMYQGLLNRHKLFPSYRYVPNVL 208

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 23/149 (15%)

Query: 557 HNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAI 616
           H+    E  L+ +S+T  + + AI +TK +EVKR++  I+E++  EL+E A+    + A 
Sbjct: 577 HSVARLETDLQVRSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAK 634

Query: 617 VEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNS-KTPKEGDK 675
           +   N +   PR + S    +   +         W  RKNFK F K WP+  +   EG  
Sbjct: 635 I---NTIQIKPRVLASIPISNGNTK---------WLGRKNFKKFKKNWPSYLRRTTEGLC 682

Query: 676 GNNQNSDFIRSAAFLITRNYVPLKKYSKK 704
            +N ++         I R Y+ ++KY  +
Sbjct: 683 SDNTSNQ--------IGREYITMRKYDSR 703

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 71/129 (55%), Gaps = 27/129 (20%)

Query: 576 FVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPR---SVGS 632
            V+AI+Q K REV R+++TIVEL  +EL+E+AI QL +LAIV+P + +LR      +VGS
Sbjct: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVD-MLRQQHTVDTVGS 657

Query: 633 NRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLIT 692
           +    +               RKN+K F KVWP           N +NS   R+A  +  
Sbjct: 658 SPLTFA---------------RKNYKNFKKVWPKYM--------NRKNSPETRNATAISN 694

Query: 693 RNYVPLKKY 701
           R Y+PL+ Y
Sbjct: 695 RKYLPLELY 703

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 106/459 (23%), Positives = 186/459 (40%), Gaps = 100/459 (21%)

Query: 1   MWVIR--YQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58
           MWV +  YQ   + G++ +ISC L   + + +GR+SK+ LVI+ +K +SR H+  +  I+
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV-ID 58

Query: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118
           D +    N L L +Q K+   +       + S +      +   +E+G+  ++   EW  
Sbjct: 59  DHV----NILLLGSQLKVGGED-----ASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQ 109

Query: 119 EIWNIPSNLAQFQTILSQF--GIATKTXXXXXXXXXXXXXFPSNND-DGMRELYALVHTI 175
             + +P+ L Q    L +   G+  +               P  +D D  + L+ALV  I
Sbjct: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGI 169

Query: 176 PLKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSV--------LFSKF 227
           P                  +++L+F + +  ++ +P   V D+DP +         F  F
Sbjct: 170 P------------------ILHLEFLKQFTALLRQP---VTDFDPQLRSIQEQHYAFRGF 208

Query: 228 MR----LDNVITLTTIGNESGLPNILRRLNVRLFHFDC--LNDLYKHVDLLKPSEKYLIL 281
            +    L+ +  +    ++  +      +     HF C  +NDL   +  + P    L L
Sbjct: 209 TKKAADLNGLHFIVNRKHDFEMLKYTLEIGGGTVHF-CHDINDLSACLKTI-PINGALAL 266

Query: 282 TFTNK-----------------RENGQKLCTLQNLITSIIDDTLPSVINTK--------- 315
            + +                    +G +L T+  L  +I+ D L  +++ +         
Sbjct: 267 KYDHGISAEVKKVDDTRYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVE 326

Query: 316 AVPFEV-------QENNTPEKVFEGHTAISKTVHTPETEATPAXXXXXXXXXXXXQPLDS 368
            VP  +       QE+ +P  +  G+T I      P  + T              QPLDS
Sbjct: 327 PVPSTISQTQEMKQESLSP--ISLGNTTIKD---LPRKDKT-------RKRLKKPQPLDS 374

Query: 369 LNFFAGGLSADPSSKHKGFAD-AKEPIFNLNSKTTVSSP 406
           L+FFAGGLS   SS   G AD  K+   +L + T   SP
Sbjct: 375 LSFFAGGLSRQNSSI-GGTADLVKQESMSLGADTHYGSP 412

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 15/116 (12%)

Query: 551 SHQQAGH-NSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAIN 609
           S++Q  H N+  ++ +L  QS++  S V AI++ K REV R+K+TIVE+  DEL+EEAI 
Sbjct: 502 SNEQKYHLNAESKDSTLSTQSHS--SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAIC 559

Query: 610 QLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWP 665
           +L+ LA+VE S ++LR  +S           R  K    +    R+NFK F KVWP
Sbjct: 560 KLSTLAVVE-SVDMLRKTQS-----------RHMKTETNKRHHVRRNFKRFVKVWP 603

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 91/207 (43%), Gaps = 21/207 (10%)

Query: 1   MWVIR--YQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58
           MW+ +  YQN  +  ++N+IS  ++  K+Y +GR+SK+ LVI +++ +SR H+  K    
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK---- 55

Query: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118
                  N + +   G    I  K ++ G +      +  +   +E+G+  I  K  W  
Sbjct: 56  ----ANRNIIEITLLGAQLKIGHKTIEKGISCEFHPKQ--SPLRLEVGSHSIECKLLWTQ 109

Query: 119 EIWNIPSNL----AQFQTILSQFGIATKTXXXXXXXXXXXXXFPSNNDDGMRELYALVHT 174
             + +PS+L         +  Q GI                       D  + L+ALV  
Sbjct: 110 WEFKVPSDLEINYIALTKMFVQLGIKI-VFSLSKETSHQIVRSRQGQKDYDKYLFALVKG 168

Query: 175 IPLKKSQLLVDLCNSLLSSSVMNLKFD 201
           +PL +   L  + +SLL+S    LKF+
Sbjct: 169 LPLVEVGFLKGI-SSLLNSDT--LKFE 192

>Skud_4.86 Chr4 complement(145097..151534) [6438 bp, 2145 aa] {ON}
           YDL171C (REAL)
          Length = 2145

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 337 LDNVLELLTINGTLSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTD 396

Query: 286 KR-------ENGQKLCTLQNLITSIIDDTLPSVINTKAVPFE----VQENNT-PEKVFEG 333
            R        NG + C  +  ITS  DD +        +P E    VQ+    P  +F  
Sbjct: 397 GRYCGAILDRNGLRPC--RYYITS--DDRIICASEVGVIPIENSLVVQKGKLKPGDLFLV 452

Query: 334 HTAISKTVHT 343
            T + + V T
Sbjct: 453 DTQLGELVDT 462

>Suva_4.75 Chr4 complement(136935..143372) [6438 bp, 2145 aa] {ON}
           YDL171C (REAL)
          Length = 2145

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 337 LDNVLELLTINGTLSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTD 396

Query: 286 KR-------ENGQKLCTLQNLITSIIDDTLPSVINTKAVPFE----VQENNT-PEKVFEG 333
            R        NG + C  +  ITS  DD +        +P E    VQ+    P  +F  
Sbjct: 397 GRYCGAILDRNGLRPC--RYYITS--DDRIICASEVGVIPIENSLVVQKGKLKPGDLFLV 452

Query: 334 HTAISKTVHT 343
            T + + V T
Sbjct: 453 DTQLGELVDT 462

>YDL171C Chr4 complement(149203..155640) [6438 bp, 2145 aa] {ON}
           GLT1NAD(+)-dependent glutamate synthase (GOGAT),
           synthesizes glutamate from glutamine and
           alpha-ketoglutarate; with Gln1p, forms the secondary
           pathway for glutamate biosynthesis from ammonia;
           expression regulated by nitrogen source
          Length = 2145

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 337 LDNVLELLTINGTLSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTD 396

Query: 286 KR-------ENGQKLCTLQNLITSIIDDTLPSVINTKAVPFE----VQENNT-PEKVFEG 333
            R        NG + C  +  ITS  DD +        +P E    VQ+    P  +F  
Sbjct: 397 GRYCGAILDRNGLRPC--RYYITS--DDRVICASEVGVIPIENSLVVQKGKLKPGDLFLV 452

Query: 334 HTAISKTVHT 343
            T + + V T
Sbjct: 453 DTQLGEMVDT 462

>Smik_4.67 Chr4 complement(126041..132478) [6438 bp, 2145 aa] {ON}
           YDL171C (REAL)
          Length = 2145

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 20/130 (15%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 337 LDNVLELLTINGTLSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTD 396

Query: 286 KR-------ENGQKLCTLQNLITSIIDDTLPSVINTKAVPFE----VQENNT-PEKVFEG 333
            R        NG + C  +  ITS  DD +        +P E    VQ+    P  +F  
Sbjct: 397 GRYCGAILDRNGLRPC--RYYITS--DDRVICASEVGVIPIENSLVVQKGKLKPGDLFLV 452

Query: 334 HTAISKTVHT 343
            T + + V T
Sbjct: 453 DTQLGELVDT 462

>CAGL0L01089g Chr12 complement(123897..130355) [6459 bp, 2152 aa]
           {ON} highly similar to uniprot|Q12680 Saccharomyces
           cerevisiae YDL171c GLT1 glutamate synthase
          Length = 2152

 Score = 35.0 bits (79), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 347 LDNVLELLTINGTLSLPEAIMMMVPEAYHSDMDSDLKAWYDWAACLMEPWDGPALLTFTD 406

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 407 GRYCGAIL 414

>NDAI0A01860 Chr1 complement(412600..419058) [6459 bp, 2152 aa] {ON}
           Anc_7.361 YDL171C
          Length = 2152

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L T      LP  +  L    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 343 LDNVLELLTTNGNLSLPEAIMMLVPEAYHEDMDSDLKAWYDWAACLMEPWDGPALLTFTD 402

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 403 GRYCGAAL 410

>NCAS0A14190 Chr1 (2788997..2795446) [6450 bp, 2149 aa] {ON}
           Anc_7.361 YDL171C
          Length = 2149

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L T+     LP  +  +    +H D  +DL    D    L++P +   +LTFT+
Sbjct: 341 LDNVLELLTLNGNMSLPEAVMMMVPEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTD 400

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 401 GRYCGAVL 408

>TDEL0C01870 Chr3 complement(324830..331252) [6423 bp, 2140 aa] {ON}
           Anc_7.361 YDL171C
          Length = 2140

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  ++L    D    L++P +   +LTFT+
Sbjct: 336 LDNVLELLTINGTLSLPEAIMMMVPEAYHKDMDSNLKAWFDWAACLMEPWDGPALLTFTD 395

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 396 GRYCGAML 403

>Kpol_530.21 s530 complement(53625..60044) [6420 bp, 2139 aa] {ON}
           complement(53625..60044) [6420 nt, 2140 aa]
          Length = 2139

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  L    +H D  ++L    D    L++P +   +LTFT+
Sbjct: 334 LDNVLELLTINGVLSLPEAIMLLVPEAYHKDMDSNLKAWFDWAACLMEPWDGPALLTFTD 393

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 394 GRYIGAML 401

>TBLA0A09100 Chr1 complement(2248759..2255208) [6450 bp, 2149 aa]
           {ON} Anc_7.361 YDL171C
          Length = 2149

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 230 LDNVITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVD----LLKPSEKYLILTFTN 285
           LDNV+ L TI     LP  +  +    +H D  + L    D    L++P +   +LTFT+
Sbjct: 336 LDNVLELLTINGVLSLPEAIMLMVPEAYHKDMDSHLKAWFDWAACLMEPWDGPALLTFTD 395

Query: 286 KRENGQKL 293
            R  G  L
Sbjct: 396 GRYTGAML 403

>KLLA0C10758g Chr3 (924736..925824) [1089 bp, 362 aa] {ON} similar
           to uniprot|Q05543 Saccharomyces cerevisiae YDR289C
           RTT103 Regulator of Ty1 Transposition regulator of Ty1
           Transposition
          Length = 362

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 169 YALVHTIPLKKSQLLVDLCNSLLSSS----VMNLKFDETWNNMVNKPLFKVFDYDPSVLF 224
           Y    +I  K+  L+V L N ++  +    V N  FD+++ N++   L KV+   P+ L 
Sbjct: 46  YLHKSSISTKRKLLVVYLANDIVQQAKHRQVPN--FDKSFGNVLPSALEKVYADFPTELR 103

Query: 225 SKFMRLDNVITLTTIGNESGLPNILRRLNV 254
           +K  R+  +     + +ES L  I RRL+V
Sbjct: 104 AKVKRVVGIWRQRKVLSESVLDEIDRRLDV 133

>Suva_15.21 Chr15 complement(38206..38847) [642 bp, 213 aa] {ON}
           YOL139C (REAL)
          Length = 213

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 36  NELVIKNDKSISRQHVTFKWEINDSLNPKGNKLSLVNQGKLTSINKKFMK-----VGET 89
           +EL +K+D  + R  V  +WE  D  N KG K S   +GK   I++ +++     +GET
Sbjct: 85  HELPLKSDYHVFRNDVRPEWE--DEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGET 141

>Skud_15.15 Chr15 complement(25600..26241) [642 bp, 213 aa] {ON}
           YOL139C (REAL)
          Length = 213

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 36  NELVIKNDKSISRQHVTFKWEINDSLNPKGNKLSLVNQGKLTSINKKFMK-----VGET 89
           +EL +K+D  + R  V  +WE  D  N KG K S   +GK   I++ +++     +GET
Sbjct: 85  HELPLKSDYHVFRNDVRPEWE--DEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGET 141

>YOL139C Chr15 complement(60383..61024) [642 bp, 213 aa] {ON}
           CDC33Cytoplasmic mRNA cap binding protein and
           translation initiation factor eIF4E; the eIF4E-cap
           complex is responsible for mediating cap-dependent mRNA
           translation via interactions with translation initiation
           factor eIF4G (Tif4631p or Tif4632p)
          Length = 213

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 36  NELVIKNDKSISRQHVTFKWEINDSLNPKGNKLSLVNQGKLTSINKKFMK-----VGET 89
           +EL +K+D  + R  V  +WE  D  N KG K S   +GK   I++ +++     +GET
Sbjct: 85  HELPLKSDYHVFRNDVRPEWE--DEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGET 141

>Smik_15.15 Chr15 complement(28453..29094) [642 bp, 213 aa] {ON}
           YOL139C (REAL)
          Length = 213

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 36  NELVIKNDKSISRQHVTFKWEINDSLNPKGNKLSLVNQGKLTSINKKFMK-----VGET 89
           +EL +K+D  + R  V  +WE  D  N KG K S   +GK   I++ +++     +GET
Sbjct: 85  HELPLKSDYHVFRNDVRPEWE--DEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGET 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,852,621
Number of extensions: 4090127
Number of successful extensions: 14011
Number of sequences better than 10.0: 138
Number of HSP's gapped: 14673
Number of HSP's successfully gapped: 158
Length of query: 869
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 751
Effective length of database: 39,950,811
Effective search space: 30003059061
Effective search space used: 30003059061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)