Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5395.433ON22722710221e-142
YDR367W (KEI1)5.433ON2212278621e-118
Skud_4.6365.433ON2342348391e-114
Smik_4.6335.433ON2212278181e-111
CAGL0A02794g5.433ON2162276682e-88
KAFR0E039305.433ON2112266491e-85
NCAS0F033705.433ON2112306161e-80
KNAG0C049205.433ON2172206082e-79
TDEL0E019205.433ON2202266048e-79
Kpol_1062.305.433ON2142195387e-69
ZYRO0F10010g5.433ON2082195325e-68
SAKL0G02508g5.433ON2282255312e-67
TPHA0E017705.433ON2172195283e-67
TBLA0A065205.433ON2062224361e-53
Kwal_55.214325.433ON2072084301e-52
AER256C5.433ON2392254234e-51
NDAI0B056605.433ON1611754033e-49
TBLA0G020105.433ON2132114032e-48
KLLA0E21099g5.433ON2242274023e-48
Ecym_47625.433ON2212223991e-47
KLTH0F16082g5.433ON2062073789e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.539
         (227 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   398   e-142
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   336   e-118
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   327   e-114
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   319   e-111
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   261   2e-88
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   254   1e-85
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   241   1e-80
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   238   2e-79
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   237   8e-79
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   211   7e-69
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   209   5e-68
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   209   2e-67
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   207   3e-67
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   172   1e-53
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   170   1e-52
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   167   4e-51
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   159   3e-49
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   159   2e-48
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   159   3e-48
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   158   1e-47
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   150   9e-45

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  398 bits (1022), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/227 (86%), Positives = 197/227 (86%)

Query: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60
           MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS
Sbjct: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADA 120
           VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVD                  EGNASIVADA
Sbjct: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADA 120

Query: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
           SSTATQTINYNPIATGKLTARSTDTSGQGASESYEY            FRFYFNFILASF
Sbjct: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASF 180

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227
           VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE
Sbjct: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  336 bits (862), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 177/227 (77%), Gaps = 6/227 (2%)

Query: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60
           MRSSL+ LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQW+AYLWS
Sbjct: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60

Query: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADA 120
           VFTLIVF+QGLYLIHKPNLLVFSQICVLYT+D                  E  A+I  + 
Sbjct: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN 120

Query: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
           +      +  NPI+TGKLT R  D S Q A+ESYEY            FRFYFNFILASF
Sbjct: 121 A------LQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASF 174

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227
           VQELLHHPKYLVDRDDVEQ+LKNKPIWKRLWAKSQKGCYKLCKNLLE
Sbjct: 175 VQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  327 bits (839), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 165/234 (70%), Positives = 175/234 (74%), Gaps = 7/234 (2%)

Query: 1   MRSSLVALPK----SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 56
           MR+S + LPK    SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 57  YLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGN--- 113
           YLWSVFTLIVF+QGLYLIHKPNLLVFSQIC+LYTVD                  E     
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 114 ASIVADASSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYF 173
            SI    + TA +T   +PI  GKLTARS D SGQ A+E+YEY            FRFYF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 174 NFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227
           N IL SFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQK CY+LCKNLLE
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  319 bits (818), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 172/227 (75%), Gaps = 6/227 (2%)

Query: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60
           MRS L+ LPKSFLGFMPLYLAVEIVLGISILNKCSG YGILALFTGHPLDFMQWVAYLWS
Sbjct: 1   MRSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADA 120
           VFTLI+F+QGLYLIHKPNLL+FSQIC LYT+D                  E  A  VA  
Sbjct: 61  VFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQ 120

Query: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
           S+      N N I+T +LT R+TD S Q A+ESYEY            FRFYFN ILASF
Sbjct: 121 SN------NSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASF 174

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227
           VQELLHHPKYLVDRDDVEQ+LKNKPIWKRL+AKSQKGCYKLCKNLL 
Sbjct: 175 VQELLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  261 bits (668), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 131/227 (57%), Positives = 155/227 (68%), Gaps = 11/227 (4%)

Query: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60
           MR + ++ PKSF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQW++YLWS
Sbjct: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60

Query: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADA 120
           VFTLIVF+QGL++IHKP L+VFSQI V +T D                    +A     A
Sbjct: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWF---------SAQWFQSA 111

Query: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
           +    +T    P+   +   RSTD + QGASE YEY            FR YFNFILASF
Sbjct: 112 NEEKHET--SAPVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASF 169

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227
           VQELL HPKY+VD+DDVEQDLKNK   KR W KSQK CYKLC++ L+
Sbjct: 170 VQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  254 bits (649), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 147/226 (65%), Gaps = 16/226 (7%)

Query: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60
           MR++  +LPKSFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQWV YLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADA 120
             TL VFAQGL+ IHKPN+L FSQI V Y++D                          D 
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLW-------------FTGDW 107

Query: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
            +  +QT          +T R+ D S QGAS+ YEY            FRFYFNFILASF
Sbjct: 108 FNVESQT---EAAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASF 164

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           VQELL HPKY+ D+DD+EQDLKNK IWKR W K QK CYKLCKNLL
Sbjct: 165 VQELLRHPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  241 bits (616), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 145/230 (63%), Gaps = 24/230 (10%)

Query: 1   MRSSLVALPK---SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAY 57
           M    + LPK   SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QWV Y
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 58  LWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIV 117
           LWS+FTLI+FAQGLY IHKP LL FSQI V Y++D                         
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWF-------------- 106

Query: 118 ADASSTATQTINYNPIATGK-LTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFI 176
                  +Q     P  T + L  R+     QGA+E+YEY            FR YFN +
Sbjct: 107 ------TSQWFQTEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCL 160

Query: 177 LASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           LA+FVQELLHHPKYLVD+DDVEQDLKNKP+WKR W K+QK  YK+C +LL
Sbjct: 161 LAAFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  238 bits (608), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 142/220 (64%), Gaps = 10/220 (4%)

Query: 7   ALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 66
           +LPK+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V
Sbjct: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66

Query: 67  FAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQ 126
           +AQGLY IHKP LL FSQI V++++D                  E N       +++   
Sbjct: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAAS--- 123

Query: 127 TINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLH 186
                  A  +L  R  +   QGA+ESYEY            FR YFNF+LASFVQELL 
Sbjct: 124 -------AVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLR 176

Query: 187 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           HP+YLVD+DD+EQDLKNK   +R W  SQK  Y +C+++L
Sbjct: 177 HPQYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  237 bits (604), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 148/226 (65%), Gaps = 12/226 (5%)

Query: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61
           RS  + LPKSFLGF+PLY+ VEI LGISI+NKCSGAYGILALFTGHPLD MQWV Y+WS+
Sbjct: 5   RSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADAS 121
           FTLI+  QGLY IHKPN+L FS I + + +D                  EGN++ V D  
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 122 STATQT-INYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASF 180
           S+ +   ++Y           S+  + QGASE +EY             + YF FI+ASF
Sbjct: 125 SSYSDAPVDY-----------SSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASF 173

Query: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           VQELL HP+Y++D+DDVEQDLK++  WKR W KSQK CYK+ K+LL
Sbjct: 174 VQELLLHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  211 bits (538), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 136/219 (62%), Gaps = 22/219 (10%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67
           LP+SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QWV+YLWSVFTLI++
Sbjct: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76

Query: 68  AQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQT 127
           +QGL+ +H P+LL +SQI V+++ D                           +S   T+T
Sbjct: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIF----------------SSQWFTET 120

Query: 128 INYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLHH 187
                  +G       D  GQGASE+YEY             R YFNFILA+F QEL  H
Sbjct: 121 ------GSGMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLH 174

Query: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           PKY+VD DDVEQDLKNK    + W KS+K CY L +++L
Sbjct: 175 PKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  209 bits (532), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 134/219 (61%), Gaps = 18/219 (8%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67
           LPK FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QWV YLWS+F+ +V+
Sbjct: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66

Query: 68  AQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQT 127
           AQGL+   KP+LLVFSQI + +++D                  E N       ++ A Q 
Sbjct: 67  AQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAMQE 126

Query: 128 INYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLHH 187
            N                  QGAS+S+E+             R YFNF+LASFVQ LL H
Sbjct: 127 PN------------------QGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQH 168

Query: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           P+Y+VD  DVEQ+L+ +P+WKR+W ++Q  C +  K LL
Sbjct: 169 PRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  209 bits (531), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 137/225 (60%)

Query: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61
           ++ +V LPKSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW  Y  SV
Sbjct: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSV 62

Query: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADAS 121
            TL+V+  GL+ I KPN L +S + V++T+D                  E N        
Sbjct: 63  LTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122

Query: 122 STATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFV 181
           ++  Q+         +L  R+   + Q AS+ YEY             RFYFNFILA+FV
Sbjct: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182

Query: 182 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           Q++L HPKY+VD+DDVEQDLKNK +++RL  KS+K CY  C+  L
Sbjct: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  207 bits (528), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 107/219 (48%), Positives = 130/219 (59%), Gaps = 19/219 (8%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67
           LPKSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QWV+YLWS FTL+++
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 68  AQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQT 127
           AQGL+ +H PNLL + QI + Y+ D                  E NA    ++S+T    
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNINSSTTV--- 133

Query: 128 INYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLHH 187
                           D   QGASES E+             RFYFNFILASF Q+L  H
Sbjct: 134 ----------------DKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLH 177

Query: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           PKY++D+DDVEQDLKNK I  + W KS+K CY   K  L
Sbjct: 178 PKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  172 bits (436), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 121/222 (54%), Gaps = 34/222 (15%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67
           LPK F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QWV Y WS+  L ++
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 68  AQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQT 127
           AQGL  +H+P L  FSQ+ + ++VD                                  T
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLL-------------------------------T 103

Query: 128 INYNPIATGKLTARSTDT---SGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQEL 184
             +    T +  A +T T   + QGAS++YEY             R YFNFI+ SF+QEL
Sbjct: 104 CAFTVYFTHEWFAANTTTRPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQEL 163

Query: 185 LHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
              P Y +D D+VE +L++  + +RLW ++Q  CY L + +L
Sbjct: 164 FFRPAYTLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  170 bits (430), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 91/208 (43%), Positives = 124/208 (59%), Gaps = 3/208 (1%)

Query: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNL 79
           + VEI LGI++LNKCSG YGIL L TGH LDFMQWV YL S+ T+IV++ GL  I+KP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 80  LVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQTINYNPIATGKLT 139
           L +S I + +T D                  +   S + D +ST  Q+   N   +G L 
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKN--SELTDPNSTTLQSSAGNNSPSGNLI 118

Query: 140 ARSTDT-SGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLHHPKYLVDRDDVE 198
           ++  DT S Q AS+  EY             RFYFNFI+ +FVQ LL HPKY+VD+DDVE
Sbjct: 119 SKRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVE 178

Query: 199 QDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           QDLK++   +R W +++   YK+C+  L
Sbjct: 179 QDLKHRGFLRRWWIRAETHSYKICRRYL 206

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  167 bits (423), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 123/225 (54%), Gaps = 8/225 (3%)

Query: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61
            S++  LPKSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS 
Sbjct: 23  HSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSF 81

Query: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADAS 121
            TL+V+  GL  I++P L  +  + V+Y+ D                       I  D  
Sbjct: 82  VTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-------IDGDVG 134

Query: 122 STATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFV 181
            TAT   +      G +T  +   S Q AS+SYEY             RFY NF++ASFV
Sbjct: 135 VTATAKEDDADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFV 194

Query: 182 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           Q +  H K+    DDVEQDLK+K +  R +AK Q+ CY LC+  L
Sbjct: 195 QRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  159 bits (403), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 104/175 (59%), Gaps = 15/175 (8%)

Query: 52  MQWVAYLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXE 111
           MQWVAYLWS+F LI+FAQGLY IHKP LL FSQI V +T+D                  +
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWF--Q 58

Query: 112 GNASIVADASSTATQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRF 171
           G+    A  +ST  Q              R T  + QGA+  YEY            FRF
Sbjct: 59  GSEGESAVQTSTGVQ-------------KRDTSLASQGATAGYEYFVTMLITFITLTFRF 105

Query: 172 YFNFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           YFN ILASFVQELL +PK+++D+DDVEQDLKNK + KR W K++K CY+LCK++L
Sbjct: 106 YFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 84/211 (39%), Positives = 122/211 (57%), Gaps = 16/211 (7%)

Query: 7   ALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 66
            LP SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL++
Sbjct: 12  VLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLI 71

Query: 67  FAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQ 126
           + QG++ I KPN+ +FSQI  ++++D                         +D S+  ++
Sbjct: 72  YTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFS--------SDHSNKQSE 123

Query: 127 TINYNPIATGKLTARSTDTS-GQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELL 185
                   + + T +  + S  QGAS +YE              R Y+N +LASF+ +L 
Sbjct: 124 N-------SLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLF 176

Query: 186 HHPKYLVDRDDVEQDLKNKPIWKRLWAKSQK 216
            +PK+++D+DDVE DLKNK  +K+    S+K
Sbjct: 177 INPKFIIDQDDVETDLKNKSFFKKFGGISKK 207

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  159 bits (402), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 128/227 (56%), Gaps = 8/227 (3%)

Query: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61
           +S++V LP++FL + PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y+WS+
Sbjct: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62

Query: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADAS 121
           F L+VF  G+  ++KPN+L+ S +  +++VD                  EG+   V D  
Sbjct: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTD-VTDLK 121

Query: 122 STATQTINYNPIATGKLTARST--DTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILAS 179
           S  T      P   G  +  ST  DTS + AS  YE+             RFYFNFI+ +
Sbjct: 122 SAGTAL---GPAHEGTTSTISTKVDTS-KSASSGYEFFLIILLTLVPLAVRFYFNFIIIA 177

Query: 180 FVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           F Q+LL   K+  D++D+E +L N+ I  +   K +K C+ LCK  L
Sbjct: 178 FQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  158 bits (399), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 115/222 (51%), Gaps = 1/222 (0%)

Query: 5   LVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTL 64
           +V LP+SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L
Sbjct: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59

Query: 65  IVFAQGLYLIHKPNLLVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTA 124
           +VF +GL  ++KP L+ +  +  +Y++D                  E  +S     S   
Sbjct: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKG 119

Query: 125 TQTINYNPIATGKLTARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQEL 184
              ++     T     R T    Q AS  YEY             RFY NFI+ASFV+ +
Sbjct: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179

Query: 185 LHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           +   +Y+ + DDVE DLKN  +  R +  +Q+ CY  C+  L
Sbjct: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  150 bits (378), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 121/207 (58%), Gaps = 2/207 (0%)

Query: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNL 79
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQWV YL SVFTL+V++ GL  ++KP L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 80  LVFSQICVLYTVDXXXXXXXXXXXXXXXXXXEGNASIVADASSTATQTINYNPIATGKLT 139
             ++ + + +T D                      S ++D SS   QT       +  LT
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWF--AAKESELSDPSSATQQTSGGISSGSKLLT 118

Query: 140 ARSTDTSGQGASESYEYXXXXXXXXXXXXFRFYFNFILASFVQELLHHPKYLVDRDDVEQ 199
           AR    S Q AS++ EY             RFYFNFI+ +FVQ L  HPKYLVD+DDV+Q
Sbjct: 119 ARGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQ 178

Query: 200 DLKNKPIWKRLWAKSQKGCYKLCKNLL 226
           DLK+K +W+R W +++   Y++C + L
Sbjct: 179 DLKHKKLWQRWWIRAENWSYRVCHHYL 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,876,504
Number of extensions: 692133
Number of successful extensions: 2381
Number of sequences better than 10.0: 22
Number of HSP's gapped: 2404
Number of HSP's successfully gapped: 27
Length of query: 227
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 121
Effective length of database: 41,326,803
Effective search space: 5000543163
Effective search space used: 5000543163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)