Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.5345.425ON45243717770.0
YDR363W (ESC2)5.425ON45640512251e-166
Smik_4.6285.425ON45840611971e-161
Skud_4.6315.425ON45840711461e-154
NDAI0B056005.425ON4572937009e-87
NCAS0F033105.425ON4422876893e-85
KAFR0E038705.425ON3962896453e-79
ZYRO0F09812g5.425ON4161665122e-59
SAKL0G02266g5.425ON4842745162e-59
TDEL0E020005.425ON4362483935e-42
Kwal_55.214685.425ON4651443938e-42
TBLA0A037105.425ON4611443884e-41
KLTH0F16280g5.425ON4731383823e-40
Kpol_1027.265.425ON4431573514e-36
Ecym_55245.425ON4152993434e-35
AER251W5.425ON4072963321e-33
TPHA0E018105.425ON4531263296e-33
CAGL0A02706g5.425ON3691282974e-29
KNAG0C049805.425ON3451252772e-26
KLLA0E21275g5.425ON3921652225e-19
KLTH0E00682g5.718ON40772780.44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.534
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   689   0.0  
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   476   e-166
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   465   e-161
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   446   e-154
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   274   9e-87
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   270   3e-85
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   253   3e-79
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   201   2e-59
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   203   2e-59
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   155   5e-42
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   155   8e-42
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   154   4e-41
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   151   3e-40
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   139   4e-36
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   136   4e-35
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   132   1e-33
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   131   6e-33
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   119   4e-29
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   111   2e-26
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    90   5e-19
KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON...    35   0.44 

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/437 (80%), Positives = 353/437 (80%)

Query: 1   MTGNSKDSGSALGNIXXXXXXXXXXXXXXXXXXXXXXEIDNNQSDDSNERNVIVESKITD 60
           MTGNSKDSGSALGNI                      EIDNNQSDDSNERNVIVESKITD
Sbjct: 1   MTGNSKDSGSALGNIDANNTSLSDDDSDDFFMDNSFDEIDNNQSDDSNERNVIVESKITD 60

Query: 61  SQPFHLSLPSSEDEDKNIXXXXXXXXXXXXXANIVKPKSDKPSGRTRGRSVIKESVVEID 120
           SQPFHLSLPSSEDEDKNI             ANIVKPKSDKPSGRTRGRSVIKESVVEID
Sbjct: 61  SQPFHLSLPSSEDEDKNISQRSLSDSESASSANIVKPKSDKPSGRTRGRSVIKESVVEID 120

Query: 121 SSESKTKKKEYPHXXXXXXXXXXXXXXPEQKYKRQKNSLLNTYDENDDFFKELAKEAKKT 180
           SSESKTKKKEYPH              PEQKYKRQKNSLLNTYDENDDFFKELAKEAKKT
Sbjct: 121 SSESKTKKKEYPHRSRSRSKSSVRSISPEQKYKRQKNSLLNTYDENDDFFKELAKEAKKT 180

Query: 181 TSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIP 240
           TSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIP
Sbjct: 181 TSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIP 240

Query: 241 KVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATL 300
           KVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATL
Sbjct: 241 KVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATL 300

Query: 301 ESKLKEEETALFAKERQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANETFMNE 360
           ESKLKEEETALFAKERQ                                   ANETFMNE
Sbjct: 301 ESKLKEEETALFAKERQEMEMKLEKKRNEREESEFREFEFELRNVEETEELKANETFMNE 360

Query: 361 HSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKAR 420
           HSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKAR
Sbjct: 361 HSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKAR 420

Query: 421 IKLLFDHDELNLNECIA 437
           IKLLFDHDELNLNECIA
Sbjct: 421 IKLLFDHDELNLNECIA 437

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  476 bits (1225), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 292/405 (72%), Gaps = 8/405 (1%)

Query: 38  EIDNNQSDDSNERNVIVESKITDSQPFHLSLPSSEDEDKNIXXXXXXXXXXXXX----AN 93
           EID+  SD+SN ++VIV+SK+T     H +L  S+ ED +                   +
Sbjct: 40  EIDH--SDESNRQSVIVDSKVTVPPSKHSTLTLSDSEDSDAKEQHQSLSRSSSKNVNIED 97

Query: 94  IVKPKSDKPSGRTRGRSVIKESVVEIDSSESKTKK-KEYPHXXXXXXXXXXXXXXPEQKY 152
           I +PK DKPSGRTRGRSV+KESVVEI+SSES   + K +P               P  KY
Sbjct: 98  ITEPKPDKPSGRTRGRSVMKESVVEINSSESDLDEDKNFPRSRSRSRSSIRSIS-PAGKY 156

Query: 153 KRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAV 212
           KRQK+SLL TYDENDDFFKELAKEAKK+T+ISKESTPDQ KRVYNIKF SKLEGTINKAV
Sbjct: 157 KRQKSSLLYTYDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAV 216

Query: 213 QVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHI 272
           QVKVLGKYEFS+ILPAALDGLMKSYKIPKVMKDIYK ENVTLYWNNAKLL FMTCNSLHI
Sbjct: 217 QVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHI 276

Query: 273 PQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXXXXX 332
           PQDFENE+SDID+TIVSKEYEKNFEATLESKLKEEE AL  KERQ               
Sbjct: 277 PQDFENEVSDIDVTIVSKEYEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEE 336

Query: 333 XXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKKI 392
                                N+T MN   L+EG S+  N+   E+VM+IALMGQDNKKI
Sbjct: 337 SEYREFESELKNVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKI 396

Query: 393 YVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           YV+VR STPF K+AEYYRIQKQLPQK R+KLLFDHDEL++NECIA
Sbjct: 397 YVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIA 441

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  465 bits (1197), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/406 (63%), Positives = 286/406 (70%), Gaps = 8/406 (1%)

Query: 38  EIDNNQSDDSNERNVIVESKITD-SQPFHLSLPSSEDEDKNIXXXXXXXXXXXXXANI-- 94
           EID+N  D S  R+VIV+SK+++       S  SS D +KN+              N+  
Sbjct: 40  EIDDN--DGSKRRSVIVDSKVSNFPSDCLSSPSSSLDNEKNVASQANILPDRSSTENVNA 97

Query: 95  ---VKPKSDKPSGRTRGRSVIKESVVEIDSSESKTKKKEYPHXXXXXXXXXXXXXXPEQK 151
               KPK D PSGRTRGRS +KESVVEI+  ESK+   E  H              P  K
Sbjct: 98  EHTTKPKLDLPSGRTRGRSTMKESVVEINPRESKSIDDEKLHRSRSRSRSSIRSLSPTGK 157

Query: 152 YKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKA 211
           YKRQK+SLL  YDENDDFFKELAKEAKKTTS+SKESTPDQ KRVYNIKF SKLEGTINKA
Sbjct: 158 YKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKA 217

Query: 212 VQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLH 271
           VQVKVLGKYEFSRILPAALDGL KSYKIPKVMKDIYK ENVTLYW NAKLL FMTCNSLH
Sbjct: 218 VQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLH 277

Query: 272 IPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXXXX 331
           IPQDFENE+SDID+TIVSKEYEKNFEA+LESKLKEEE AL  KE +              
Sbjct: 278 IPQDFENEVSDIDVTIVSKEYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQE 337

Query: 332 XXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKK 391
                                 NET +N  +L+E +++ ENN  +EKVMKIAL GQDNKK
Sbjct: 338 ESEYREFEFELRNVKEKQERTENETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKK 397

Query: 392 IYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           IYVNVR STPF KVAEYYRIQKQLPQKARIKLLFDHD+L+++ECIA
Sbjct: 398 IYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHECIA 443

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  446 bits (1146), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 246/407 (60%), Positives = 287/407 (70%), Gaps = 9/407 (2%)

Query: 38  EIDNNQSDDSNERNVIVESKITDSQPFHLSLPSSEDEDKNIXXXXXXXXXXXXXA----N 93
           EID   SD+SN +NVIV+SK++ S   +LSL SS++ED +I             +     
Sbjct: 39  EID--HSDESNRQNVIVDSKVSVSSSRYLSLGSSDEEDDDINQRSQSHNRSSSESLDGRK 96

Query: 94  IVKPKSDKPSGRTRGRSVIKESVVEIDSSESKTKKKE---YPHXXXXXXXXXXXXXXPEQ 150
           ++K + +KPS RTRGRS+ K+S VE  + ES  + K    +                PE+
Sbjct: 97  LIKCRPEKPSDRTRGRSMTKDSAVETSAPESTNEAKRLHGFRSRSRSRSRSSIRSVSPER 156

Query: 151 KYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINK 210
           K+KRQK SL++ YDENDDFFKELAKEAKK T+ISKE TP+QPKRVYNIKF SKLEGTINK
Sbjct: 157 KHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINK 216

Query: 211 AVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSL 270
           AVQVKVLGKYEFSRILPAALDGL+KSYKIPKVM  IYK  NVTLYWNNAKLL FMTCNSL
Sbjct: 217 AVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSL 276

Query: 271 HIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXXX 330
           +I QDFENEISDID+TIVSKEYEKNFEATLESKLKE+E AL  K+RQ             
Sbjct: 277 NISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQ 336

Query: 331 XXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNK 390
                                  NE  +N   L+  NS+K NNG  EKV+K+ALMGQDNK
Sbjct: 337 EESEYREFEFELRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNK 396

Query: 391 KIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           KI+VNVRNSTP FKVAEYYRIQK+LPQKARI+LLFDHDELN++EC+A
Sbjct: 397 KIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVA 443

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  274 bits (700), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 148/293 (50%), Positives = 196/293 (66%), Gaps = 6/293 (2%)

Query: 148 PEQKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQ-PKRVYNIKFFSKLEG 206
           P +K  +  ++L    DEND+FFKE+AKEAKK  S++KESTPD+ PKR+YNI+F SKL+G
Sbjct: 149 PIRKTPKLSSTLQMEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDG 208

Query: 207 TINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMT 266
           T+NK VQVKVLGK++F +ILPAAL GL+K+Y IP V++  Y  +NV+LYWN+AKLL FMT
Sbjct: 209 TMNKCVQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMT 268

Query: 267 CNSLHIPQDFENEISDIDITIVSKEYE-KNFEATLESKLKEEETA---LFAKERQXXXXX 322
           CNSL+IPQ FENE++++DI ++SK+ E +N +A  E  LK+E      L A +++     
Sbjct: 269 CNSLNIPQAFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQE 328

Query: 323 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNEKVMKI 382
                                          N    +  ++ E N +     GN  VMKI
Sbjct: 329 KLAKELAKEEKENEVFEEFEHELENVSELKTNGYDADASTVNEANELALEE-GNADVMKI 387

Query: 383 ALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNEC 435
           AL+GQDNKKI+VNVR +TPF KVAEYYRIQKQLPQ A+IKL+FDH+EL+L E 
Sbjct: 388 ALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 152/287 (52%), Positives = 188/287 (65%), Gaps = 20/287 (6%)

Query: 164 DENDDFFKELAKEAKKTTSI---SKESTPD-QPKRVYNIKFFSKLEGTINKAVQVKVLGK 219
           DEND+FFKE+AKEAKK  SI   SKE+TPD QPKRVY+I+F S+L+GTINK VQVKVLGK
Sbjct: 148 DENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGK 207

Query: 220 YEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENE 279
           ++F +ILP  L+GL+KSY IP V++  YK +NVTLYWNN KLL FMTCNSL+IPQ FENE
Sbjct: 208 FQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENE 267

Query: 280 ISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXXXXXXXXXXXX 339
           ++++DI I+SKE E   E  L  KL  EE    A + +                      
Sbjct: 268 VTNVDIVIMSKEKEIENENELRKKLLLEEK---AAQMKLDLEKEREKEGEKNKPKESKNT 324

Query: 340 XXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGG-------NEK--VMKIALMGQDNK 390
                         + T + +  +  G    EN+G        NEK  +MKIAL+G DNK
Sbjct: 325 EYAKAIAEFEKELKDATELKDSQVHGG----ENDGNMNIDGSDNEKSSIMKIALVGHDNK 380

Query: 391 KIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           KIYVNVRNSTPF K+AEYYR+QKQLPQ A+I+L+FDHDELNL E + 
Sbjct: 381 KIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVG 427

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  253 bits (645), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 181/289 (62%), Gaps = 27/289 (9%)

Query: 153 KRQKNSLLNTY---DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTIN 209
           KRQK+ +  T    DENDDFFKELA  A+K +    ES   +PKR+YNI+F SKL+G+IN
Sbjct: 116 KRQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSIN 175

Query: 210 KAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNS 269
           K+V+VKVLGK+ FS+ILPAAL GL+ +YKIP +M +IY  ENV LYWNNAKLL FMTC+S
Sbjct: 176 KSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDS 235

Query: 270 LHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXX 329
           L IP  FENEIS++DI IVSKE+ +  E   + K  +EE  L   ERQ            
Sbjct: 236 LSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKL---ERQEEIKDVDEGDDF 292

Query: 330 XXXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNG-GNEKVMKIALMGQD 388
                                    E  + + +    N   + +G  +E +MK+ALMGQD
Sbjct: 293 VLKEF--------------------EAELRDVAPSNANLSLDTDGEDSEPLMKLALMGQD 332

Query: 389 NKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           NKKIYVNVR+ST   K+ EYY+ QK L +  ++KLLFDHDEL+LNE + 
Sbjct: 333 NKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVG 381

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  201 bits (512), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 128/166 (77%), Gaps = 5/166 (3%)

Query: 148 PEQKYKRQKNS--LLNTY---DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFS 202
           P ++ KR + +  + N +   DEND+FFK++AK+   T   ++E+TP+QP+R+YN++F S
Sbjct: 129 PPRRTKRSRTTPNIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLS 188

Query: 203 KLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLL 262
           KL+G+I+KAVQ+KVLGKY+F+ +LP+ L+G ++ YKIP VMK IY +ENVTLYW  AKLL
Sbjct: 189 KLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLL 248

Query: 263 KFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEE 308
            FMTCNSL IPQ FENEISDIDIT++ KE E  FE  + S+L E+E
Sbjct: 249 NFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDE 294

 Score = 92.8 bits (229), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 53/63 (84%)

Query: 375 GNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNE 434
           G+  +MKIAL+G+DNKKI+VNVRN+T   KVAEYYRI+K+LP+   IKL+FDH+ELNLNE
Sbjct: 339 GDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNE 398

Query: 435 CIA 437
            I 
Sbjct: 399 SIG 401

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  203 bits (516), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/274 (37%), Positives = 164/274 (59%), Gaps = 27/274 (9%)

Query: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223
           D+ D FF E+ + A +T+++ +ES+P+  KR Y I F SKL+G+I+K ++VK  GK  F+
Sbjct: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280

Query: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283
           +ILP+ LD ++K+Y+IPK ++++YK +NVTLYWN AK+L FMTCNSL IPQ++ +EI+D+
Sbjct: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340

Query: 284 DITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXXXXXXXXXXXXXXXXXXXXXXXX 343
           DIT+VSKEYE  +EA  +  ++ E +                                  
Sbjct: 341 DITLVSKEYEMKYEAEFKEMVENELSG---------------SSVDVKNVKKDDFATNEY 385

Query: 344 XXXXXXXXXANETFM-NEHSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPF 402
                    A  + + +  ++R+G+ +K           +AL+GQDNKK++V  R+ST F
Sbjct: 386 ELQLEKSESAEPSLLKSSENIRDGSFIK-----------LALVGQDNKKMFVKARSSTLF 434

Query: 403 FKVAEYYRIQKQLPQKARIKLLFDHDELNLNECI 436
            K+A+YY+  K LP   ++KL FDH  L+L + +
Sbjct: 435 KKIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRV 468

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  155 bits (393), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 140/248 (56%), Gaps = 16/248 (6%)

Query: 193 KRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENV 252
           ++++N+ F SKLEGT+++A+Q+KVLGKY+F+ IL + L+ +++ +KIP  +   Y  +NV
Sbjct: 188 QKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMHQYTVDNV 247

Query: 253 TLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALF 312
           TLYWN  KLLKFMTC+SL        +IS+ID   V++      E T+ SK  EE     
Sbjct: 248 TLYWNGGKLLKFMTCDSL--------KISNIDNNEVTE-----IEVTMVSKSDEERFEEE 294

Query: 313 AKERQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKEN 372
            + R                                      +    E  ++EG+ +   
Sbjct: 295 ERARLLRVEKEAMSKAKLPTTFEADPSDDNGEADCSIEIIEMDDSSRESEMKEGSKLAPV 354

Query: 373 NGGNE---KVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDE 429
           +  +E   +V+K+AL+GQDN ++YVNVR STPF KVAEYY++ K LP + ++ L FDH++
Sbjct: 355 DLEDEDELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEK 414

Query: 430 LNLNECIA 437
           L+LNE + 
Sbjct: 415 LDLNETVG 422

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  155 bits (393), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 102/144 (70%)

Query: 158 SLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVL 217
           SL    +E++ FF+EL +EA +TTS  KE +P   KRVYNIKF S LEG++N  + VKV 
Sbjct: 195 SLAAEDNEDEKFFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVK 254

Query: 218 GKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFE 277
           GK+ FS ILP AL  L+K YK+ K +K  Y+ ENV+LY N  K+L FM CNSLHIP ++E
Sbjct: 255 GKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYE 314

Query: 278 NEISDIDITIVSKEYEKNFEATLE 301
            E+SD+ +T+VS++ E+ +  TLE
Sbjct: 315 GEVSDVSMTLVSRDREQEYVKTLE 338

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%)

Query: 363 LREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIK 422
           L E     ENN G    +KIALM QDNKKIYVNVR +T    + E+YR  K L    R K
Sbjct: 379 LLEDTPQTENNHG---TIKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIERFK 435

Query: 423 LLFDHDELNLNECI 436
            +FD+++L L+  I
Sbjct: 436 FVFDNEDLQLSTKI 449

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  154 bits (388), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 76/144 (52%), Positives = 103/144 (71%), Gaps = 6/144 (4%)

Query: 169 FFKELAKEAKKTTSISKES----TPDQ--PKRVYNIKFFSKLEGTINKAVQVKVLGKYEF 222
           FFK L   +    S + +S    T DQ  PKR+YN++F SK+EGT++K VQVKVLGK+ F
Sbjct: 185 FFKALKHSSSVPPSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLGKFPF 244

Query: 223 SRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISD 282
           S+ILP AL    + YKIP V+K  Y+  NVTLYWN++KLL FMTCNSL+IPQ +ENEISD
Sbjct: 245 SKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENEISD 304

Query: 283 IDITIVSKEYEKNFEATLESKLKE 306
           ++I +++K  EK++E  +   LK+
Sbjct: 305 VEIIVITKTNEKSYEDKINMSLKQ 328

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%)

Query: 376 NEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNEC 435
           NE  +KIAL+ QDNKK+YV VRNSTPF ++  Y+R QKQL +  +IKL+FD++EL+LNE 
Sbjct: 385 NESHIKIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLNET 444

Query: 436 IA 437
           + 
Sbjct: 445 VG 446

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  151 bits (382), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (69%)

Query: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223
           DE+D FF+EL +EA +T S  KES+P   +R+YNIKF S LEG+  + + VKV GK  F 
Sbjct: 206 DEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFD 265

Query: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283
           +ILP AL  ++K YKIP  +  IY+ + VTLY +  K+L FM CNSL IP +F+ E+SD+
Sbjct: 266 QILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDV 325

Query: 284 DITIVSKEYEKNFEATLE 301
            +TI+SK  E+NFEA  E
Sbjct: 326 CLTIISKGQEQNFEALYE 343

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 380 MKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           ++IALM QDNKKI V  R  T F  +AE+Y+    LP + ++ L FD++EL+L+  ++
Sbjct: 399 IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKVS 456

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  139 bits (351), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/157 (45%), Positives = 106/157 (67%), Gaps = 3/157 (1%)

Query: 149 EQKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTI 208
           E+  KRQK       +ENDDF K +   +   T++   ++   P R+YNI F SKL+G++
Sbjct: 136 EEPSKRQK---YEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSV 192

Query: 209 NKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCN 268
           +K +Q +VLGK +FS I+   LD   K YK+ +V K  YK + VT+YW+ AKLL FMTCN
Sbjct: 193 DKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCN 252

Query: 269 SLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLK 305
           SL IP +F++EIS I++TI+SKE E+ FEA ++++L+
Sbjct: 253 SLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLE 289

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 48/60 (80%)

Query: 377 EKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECI 436
           + ++K+AL+G DNKKI+VN R +T FFK+AEYY + ++LP+  ++KL+FD ++++L+  +
Sbjct: 367 QNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMV 426

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  136 bits (343), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 152/299 (50%), Gaps = 23/299 (7%)

Query: 148 PEQKYKRQKNSLLNTYDENDD--FFKELAKEAKKTTSISKEST--------PDQPKRVYN 197
           P +  KR +N + ++ +E+D   F  E+ +EA++ +S+    +         +    +YN
Sbjct: 114 PVRPAKRSRN-VEHSQEESDTNKFLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYN 172

Query: 198 IKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWN 257
           + F SKLEG+ NK + V++ GK +FS  LP AL   +K YKI   + D Y+ +NV +Y  
Sbjct: 173 VGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYRE 232

Query: 258 NAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQ 317
             ++ KFMTC+S +I + + +   DI++ IV  E    FE   + K+   ET +      
Sbjct: 233 GVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKI---ETKM------ 283

Query: 318 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNE 377
                                              AN   ++E  ++  N + + + GNE
Sbjct: 284 --KRVSISASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNE 341

Query: 378 KVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECI 436
            ++K+ L+G DNKK+YVNV+ +T F K+AE+YR  K+LP   ++ L FDHD+++ +  I
Sbjct: 342 -LIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTI 399

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  132 bits (332), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 142/296 (47%), Gaps = 21/296 (7%)

Query: 148 PEQKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTP------DQPKRVYNIKFF 201
           P +  KR++        E + F  E+ ++ + +       T       D   RVYN+ F 
Sbjct: 112 PVRPAKRKRTDEQQPESEANRFLAEMERDIELSAGPGGGETATGKGGRDTDARVYNVGFI 171

Query: 202 SKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKL 261
           S++EG+ N+ V VKV G+ +F+  L  AL    K + I K +K  Y+ + V +Y    ++
Sbjct: 172 SRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEV 231

Query: 262 LKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQXXXX 321
            KFMTC+S +I + +    +DI++ IV  +    FE   + K +E    L          
Sbjct: 232 FKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRML--------SN 283

Query: 322 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANETFMNEHSLREGNSVKENNGGNEKVMK 381
                                           NET   E ++REG    E++    +++K
Sbjct: 284 SSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNET---ELAVREGTPADESS----QLLK 336

Query: 382 IALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIA 437
           I L+G DNKK++++VR +T   KVAE+YR+ K+LP   ++ L+FDH+E++L++ I 
Sbjct: 337 IVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTIC 392

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  131 bits (329), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 89/126 (70%)

Query: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223
           D +D+FFK + + +K+ +++S   TP+   R YNI + SKL G+  + +Q KVLG   F+
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283
           ++LP  L+ L+K  KIP  ++ +YK ENVTLYWN +KLL FM C+SL IPQ ++NEIS++
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 284 DITIVS 289
           +I ++S
Sbjct: 272 EIILIS 277

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 368 SVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDH 427
           S+KE+  G   V+KI+LM  DNKKI+VNVR+ST   K+ +Y++  K L    RIK++FDH
Sbjct: 371 SIKEH--GTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDH 428

Query: 428 DELNLNECIA 437
           D L+L+  I 
Sbjct: 429 DVLSLDSMIG 438

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223
           DEND FF+ +AK ++ +  +   S   +  +VY ++F S ++GT  K+VQVK LG + FS
Sbjct: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180

Query: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283
           +++ AAL GLM+++++P VM+ +Y+ E+V  YWN AK+L FMTC++L +PQ + ++  +I
Sbjct: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240

Query: 284 DITIVSKE 291
            +  V +E
Sbjct: 241 QLVPVKEE 248

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 45/61 (73%)

Query: 376 NEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNEC 435
           +E+V+++AL GQDNKK+YVNV+ +T F ++ EYYR QKQLP+  +I L  D + L+ +  
Sbjct: 293 SEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHAT 352

Query: 436 I 436
           +
Sbjct: 353 V 353

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 81/125 (64%), Gaps = 1/125 (0%)

Query: 164 DENDDFFKELAKEAKKTTSISKESTPDQ-PKRVYNIKFFSKLEGTINKAVQVKVLGKYEF 222
           D+ + FF+EL +   ++   ++ +T    P  VY ++F S+LEGT+ K+VQVKV+G    
Sbjct: 99  DDEEQFFQELLRARTQSVEPAETATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVIGTRPL 158

Query: 223 SRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISD 282
             +LP+ L  L+++ ++P+V++  Y E  V +Y   A++L FM CNSL + Q+FENE+ +
Sbjct: 159 GTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFENEVLE 218

Query: 283 IDITI 287
           +D+ +
Sbjct: 219 VDVVL 223

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 37/53 (69%)

Query: 379 VMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELN 431
           +MKIAL+  DN+++YV V   TP  ++ EYYR+++ LP  A ++L  D ++++
Sbjct: 273 LMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVS 325

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 10/165 (6%)

Query: 150 QKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTIN 209
           +++K  +   +NT DE  DF KE+   AK              KR+YNI F S LEG+ +
Sbjct: 106 ERFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNGK--VTKRIYNINFISTLEGSQD 163

Query: 210 KAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNS 269
           K V VKV G   F  ILP  +   ++SYKIP+ ++  Y    + L+    ++L F  C+S
Sbjct: 164 KRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDS 223

Query: 270 LHIPQDFENEISDIDITIVSK--------EYEKNFEATLESKLKE 306
           L IP+      + +D+ IV          EY++  E+ L+S L E
Sbjct: 224 LRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDE 268

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 33/52 (63%)

Query: 380 MKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELN 431
           +++ L+ + NK+  ++V  +T F ++A  Y+    L + A + L+FD++ELN
Sbjct: 320 IRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

>KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON}
           highly similar to uniprot|P27796 Saccharomyces
           cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with
           broad chain length specificity cleaves 3-ketoacyl-CoA
           into acyl- CoA and acetyl-CoA during beta-oxidation of
           fatty acids
          Length = 407

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 5/72 (6%)

Query: 207 TINKAVQVKVLGKYEFSRIL--PAALDGLMKSYKIPKVMKDI-YKEENVTLY-WNNAKLL 262
           +I +++++ +LGKY   +++  P  + G+  +Y IPKV+KD     E V ++  N A   
Sbjct: 279 SIAESMELPILGKYVACQVIGVPPEIMGVGPAYAIPKVLKDCGLAIEKVDVFEINEAFAG 338

Query: 263 KFMTC-NSLHIP 273
           + + C N L IP
Sbjct: 339 QALYCINKLQIP 350

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,398,720
Number of extensions: 1736883
Number of successful extensions: 5813
Number of sequences better than 10.0: 45
Number of HSP's gapped: 5966
Number of HSP's successfully gapped: 62
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)