Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.4895.352ON65965928040.0
YDR320C (SWA2)5.352ON66866819340.0
Smik_4.5795.352ON66766719140.0
Skud_4.5865.352ON64266218400.0
KAFR0C018505.352ON64670310531e-134
CAGL0H07095g5.352ON6615519941e-125
TDEL0E027505.352ON5645949671e-122
ZYRO0D10186g5.352ON6356979491e-119
NCAS0F028705.352ON7003099421e-117
KNAG0C055005.352ON5856699271e-116
Kpol_339.135.352ON6863389211e-114
NDAI0C043205.352ON7063079211e-114
TBLA0H019705.352ON8403618191e-97
SAKL0G08822g5.352ON5825467889e-96
TPHA0E011105.352ON6933537933e-95
Kwal_34.159775.352ON5975407392e-88
KLLA0B10197g5.352ON6215287193e-85
KLTH0H14872g5.352ON6235457133e-84
Ecym_81815.352ON6613086235e-71
AGR352C5.352ON6483355929e-67
Kpol_1028.516.328ON11766890.007
TDEL0B051402.152ON599111950.008
NCAS0G024802.152ON596139950.008
NCAS0B070102.152ON625112950.009
Ecym_20906.328ON172105870.027
KAFR0F007202.152ON608112900.036
YCR060W (TAH1)6.328ON11163820.043
ZYRO0G06512g2.152ON604111890.044
TPHA0I015102.152ON603139870.083
TBLA0I023106.328ON116119780.16
Skud_3.1356.328ON11869760.32
Kpol_1048.212.152ON597112810.33
KNAG0H035302.152ON614111810.34
NCAS0H008306.21ON33881810.35
NDAI0B043402.152ON664116800.47
KLTH0H02068g7.313ON370195780.78
NCAS0F034903.481ON51276771.2
NDAI0F028102.152ON609112761.6
SAKL0A01672g6.328ON12872711.9
TPHA0D038606.328ON12070702.2
TPHA0D032203.481ON513131742.7
CAGL0D05060g3.481ON51077732.8
TBLA0C039503.481ON512139733.5
TBLA0C053803.468ON388154723.7
YNL121C (TOM70)2.152ON617112733.9
Smik_10.3061.456ON39434724.4
Smik_14.2072.152ON617112724.7
TBLA0B019801.509ON103671724.9
Suva_14.2192.152ON617112715.4
Kwal_33.147672.152ON594111716.1
KAFR0J025706.328ON12132676.4
KLLA0C08910g6.328ON11581667.1
NCAS0D045006.328ON12166668.7
NDAI0I004406.328ON12866668.9
Ecym_55825.617ON584167699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.489
         (659 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...  1084   0.0  
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   749   0.0  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   741   0.0  
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   713   0.0  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   410   e-134
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   387   e-125
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   377   e-122
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   370   e-119
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   367   e-117
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   361   e-116
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   359   e-114
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   359   e-114
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   320   1e-97
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   308   9e-96
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   310   3e-95
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   289   2e-88
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   281   3e-85
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   279   3e-84
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   244   5e-71
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   232   9e-67
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    39   0.007
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    41   0.008
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    41   0.008
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    41   0.009
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    38   0.027
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    39   0.036
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.043
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    39   0.044
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    38   0.083
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.16 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    34   0.32 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    36   0.33 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    36   0.34 
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    36   0.35 
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    35   0.47 
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    35   0.78 
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    34   1.2  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    34   1.6  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    32   1.9  
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    32   2.2  
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    33   2.7  
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    33   2.8  
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    33   3.5  
TBLA0C05380 Chr3 (1300875..1302041) [1167 bp, 388 aa] {ON} Anc_3...    32   3.7  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    33   3.9  
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    32   4.4  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    32   4.7  
TBLA0B01980 Chr2 complement(452814..455924) [3111 bp, 1036 aa] {...    32   4.9  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    32   5.4  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    32   6.1  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    30   6.4  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    30   7.1  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    30   8.7  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    30   8.9  
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    31   9.0  

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/659 (83%), Positives = 553/659 (83%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           MSDPFAHLLTSLKNKDSGTESKKTTPQTKDF               QGNNDGLHSFSASP
Sbjct: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFTATSATVVASAATTTQGNNDGLHSFSASP 60

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQVD 120
           MIPASNVSFSVAPLV                     IEDDFNELFGSNTMATANELQQVD
Sbjct: 61  MIPASNVSFSVAPLVPSNSNSNANSASNTPTPSPANIEDDFNELFGSNTMATANELQQVD 120

Query: 121 QNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQ 180
           QNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQ
Sbjct: 121 QNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQ 180

Query: 181 KKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEAND 240
           KKHKDRIASHRPTGSSSK                SMATDFFNKGKELVDQWTSFPPEAND
Sbjct: 181 KKHKDRIASHRPTGSSSKNASLFNNASPNNNNLFSMATDFFNKGKELVDQWTSFPPEAND 240

Query: 241 RLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXX 300
           RLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEK             TDFE       
Sbjct: 241 RLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKDLLGGNDLDDDLLTDFETKIDITK 300

Query: 301 XXXXXXXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVA 360
                  PSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVA
Sbjct: 301 KDAKDTTPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVA 360

Query: 361 PISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLK 420
           PISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLK
Sbjct: 361 PISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLK 420

Query: 421 IGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFK 480
           IGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFK
Sbjct: 421 IGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFK 480

Query: 481 NALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXX 540
           NALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPAR                        
Sbjct: 481 NALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAPMKKPTSTPSP 540

Query: 541 XXXDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVS 600
              DNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVS
Sbjct: 541 APVDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVS 600

Query: 601 VQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           VQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN
Sbjct: 601 VQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/668 (58%), Positives = 457/668 (68%), Gaps = 9/668 (1%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           MSDPFAHLLTSLKNKDS + SK+TTPQ+ +                +  ND LHS SA P
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQVD 120
           +IP+  V FS  PLV                      +DDFN+LFG  T+ T + +Q+ D
Sbjct: 61  LIPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPD 120

Query: 121 QNYYGN-SDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLK 179
           ++YYG+  D  ++GD  LVDEVKDMEIARLMSLGLSIE+AT+FY +DVTYE+YLEI K K
Sbjct: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180

Query: 180 QKKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEAN 239
           QK+  D     + +G   +                SMATDFFNKGK+LVDQWTSFPPEAN
Sbjct: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240

Query: 240 DRLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXX 299
           DRL+NY    DK++ Y+LP  NDS +  L +  E  +             TDFE      
Sbjct: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300

Query: 300 XXXXXXXXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNIS---STNNSAISREDGNT 356
                    S SP  GIL+E+  R+ EP  ED+LLDFS  N++   S  +S +  E+ NT
Sbjct: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360

Query: 357 NPVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIA 416
           +   PISDIELSGYNEFKAKGTSLFKNGDY+NSLQEYEKSLN+LPL HPLRIIALSNIIA
Sbjct: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420

Query: 417 SQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476
           SQLKIGEYSKSIENS  AL LFP++K+ W +KIS SDP+RS+NDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480

Query: 477 ESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXX-----XXXXXXXXXXXXX 531
           ESFK ALETYQEL+ +NFFDDKIMQGKRRCQDF+NP P +                    
Sbjct: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQN 540

Query: 532 XXXXXXXXXXXXDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLL 591
                       D+ S +K++ELENAKLALYD V +KI  WK GKDDDIRHLLANLS LL
Sbjct: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600

Query: 592 TWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDK 651
           TWCNWKDVS+Q+LVMPK+VKITYMKAVAKTHPDKIP+SLSLENKMIAEN+F+TLS AWDK
Sbjct: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660

Query: 652 FKQQNDIN 659
           FK QNDIN
Sbjct: 661 FKLQNDIN 668

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/667 (58%), Positives = 460/667 (68%), Gaps = 8/667 (1%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           MSDPFAHLLTS KNKDS  ESKK T ++ +                +  ND LHS SASP
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQVD 120
           +IP+S V FSV PLV                     I+DDFNELFG+ T A  + LQ+V+
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPLDHIDDDFNELFGNGTTAATDTLQKVN 120

Query: 121 QNYYGNSDGSH-DGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLK 179
            +Y  N++G   +GD  LVDEVKDMEIARLMSLGLSIEKAT FYN D+TYE+YL++ K  
Sbjct: 121 DDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKVLKSN 180

Query: 180 QKKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEAN 239
           QKK KDR A   P   + +                S+AT+FFNKGKELVDQWTSFPPE N
Sbjct: 181 QKKSKDRTARESPGDVNFERSELSNNFGSENNNLFSIATNFFNKGKELVDQWTSFPPEEN 240

Query: 240 DRLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXX 299
           DRL+N+ N+ +K + Y+ PLEND Y+G   +  + EK             TDFE      
Sbjct: 241 DRLNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDLLTDFETKIEIT 300

Query: 300 XXXXXXXXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNS-AISREDGNTNP 358
                   PSPSP  GIL+E+   ++EP  E+NLLDFS  N++ +N+S + S  +GN NP
Sbjct: 301 KRTVSDVDPSPSPSSGILIEENPLRKEPLVENNLLDFSEGNVTKSNSSESNSLFNGNRNP 360

Query: 359 --VAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIA 416
               PISDIELSGYNEFKAKG++ FKNGDYVNSLQEYEKSLNSLP  HPLRIIALSNIIA
Sbjct: 361 NSAIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIA 420

Query: 417 SQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476
           SQLK+GEYSKSIENS  ALALFP  K++W++ IS SDPQRS+NDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKVGEYSKSIENSSMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHL 480

Query: 477 ESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARX----XXXXXXXXXXXXXXX 532
           ESF NALETYQEL+ +NFFD+KIMQGKRRCQ+F+NP P +                    
Sbjct: 481 ESFSNALETYQELINKNFFDEKIMQGKRRCQNFINPPPVKKFSPVKKATSTQSPTEKSTP 540

Query: 533 XXXXXXXXXXXDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLT 592
                      D  S++K+QELENAKLALYD V ++I  WK  K DDIRHLLANLSGLLT
Sbjct: 541 TSSSSTSSNSPDTTSKIKKQELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLT 600

Query: 593 WCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKF 652
           WCNWKD+ +Q+LVMPK+VKITYMKAVAKTHPDKIP+SLSLENKMIAENVF++LS AWDKF
Sbjct: 601 WCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKF 660

Query: 653 KQQNDIN 659
           KQQNDIN
Sbjct: 661 KQQNDIN 667

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/662 (58%), Positives = 452/662 (68%), Gaps = 23/662 (3%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           MSDPFAHLL SLKNKDS TE K+TT Q+ D                +GN + LHS SA P
Sbjct: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQVD 120
           +IP S VSFS APLV                     I+DDF+E+FGS+ +A    LQQVD
Sbjct: 61  LIPPSKVSFSAAPLVPSNSTSSANTASNTPSPAPVNIDDDFDEIFGSDAIAATGGLQQVD 120

Query: 121 QNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQ 180
           Q+ + + DG       LVDEVKDMEIARLMSLGLS++KAT+FYN D+TYE+YLEI K KQ
Sbjct: 121 QDSHDDDDGDD----ALVDEVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQ 176

Query: 181 KKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEAND 240
           KKH+DRIA  +      K                S+ATDFFNKGKEL+DQWTSFPPE N+
Sbjct: 177 KKHRDRIAREKSNDIKIKKPGLFNNTDSDNNNLLSIATDFFNKGKELMDQWTSFPPEENN 236

Query: 241 RLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXX 300
           RL +++N+ED+ + Y+L LE +  +       ED               TDFE       
Sbjct: 237 RLKSHLNLEDESNDYDLSLEENPCNSGGDNLDED-------------LLTDFEAKIDITK 283

Query: 301 XXXXXXXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNIS---STNNSAISREDGNTN 357
                   SPSP   I +++   K+E   +D+LLDFS +N +   ST N+ +  E  N  
Sbjct: 284 RASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAV 343

Query: 358 PVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIAS 417
            V PISDIELSGY+EFKAKG +LFKNGDYVNSLQEYEK+LNSLP  HPLRII LSNIIAS
Sbjct: 344 SVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIAS 403

Query: 418 QLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLE 477
           QLK+GEYSKSI NSD ALALFP  K+SWN+KIS SDPQRS+NDIWPKIMIRRAESFEHLE
Sbjct: 404 QLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLE 463

Query: 478 SFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXX 537
           SFKNALETYQEL++RNFFDDKIMQGKRRCQ+F++P   R                     
Sbjct: 464 SFKNALETYQELISRNFFDDKIMQGKRRCQNFISPPLVR---KSTPVKKTTPTLKKPAPD 520

Query: 538 XXXXXXDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWK 597
                 D  S+VKEQELENAKLALYD V  KIG WK GK+DDIRHLL+NLS LLTWCNWK
Sbjct: 521 PSPAPIDIPSKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWK 580

Query: 598 DVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQND 657
           DVS+Q+LVMPKKVKI YMKAVAKTHPDKIP+SLSLENKMIAEN+F+TLS AWDKFKQQND
Sbjct: 581 DVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQND 640

Query: 658 IN 659
           IN
Sbjct: 641 IN 642

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  410 bits (1053), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 271/703 (38%), Positives = 364/703 (51%), Gaps = 101/703 (14%)

Query: 1   MSDPFAHLLTSLK--NKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSA 58
           MSDPFA+LL S K   K    E K   P   +                 G N  + + S 
Sbjct: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60

Query: 59  SPMIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQ 118
           + +   +NVS                            I DDF ELFGS+T    +   +
Sbjct: 61  NSVPTFANVS-------------------SLNSLQTTPIHDDFEELFGSSTSNNFSVSPE 101

Query: 119 VDQNYYGNSDGSH-----DGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYL 173
              N+   +D  +       D V VDEVKDMEIA+LMSLGLSIEKA  +Y+  ++Y+  L
Sbjct: 102 PTNNFKTVTDVPNVTYEAKQDSV-VDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLL 160

Query: 174 EISKLKQKKHKDRIASHRPT--GSSSKXXXXXXXX--XXXXXXXXSMATDFFNKGKELVD 229
           +  KL+++++  R     PT  G+++K                  SMA+  FNKGKE +D
Sbjct: 161 K--KLERRRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLFNKGKEFID 218

Query: 230 QWTSFPPEANDRLSNYVNVE---------------DKLDHYELPLENDSYDGSLPQRKED 274
           Q T++P E  DRLS Y ++                D  D   +    D+  G  P R+  
Sbjct: 219 QMTAYP-EETDRLSRYRDISEISSMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREVQ 277

Query: 275 EKXXXXXXXXXXXXXTDFEXXXXXXXXXXXXXXPSPSPPPGILVEDALR--------KEE 326
           ++                                  SPPP   + D  +        KEE
Sbjct: 278 QE----------------------------------SPPPSHDLLDNFQNNLKLDDNKEE 303

Query: 327 PQREDNLLDFSTDNI------SSTNNSAISREDG---NTN-PVAPISDIELSGYNEFKAK 376
             +E  LLD   D+       S T++S + +++    N+N P  PIS IELSGYNE+ ++
Sbjct: 304 LSKESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELSGYNEYNSR 363

Query: 377 GTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTALA 436
           G+S FKNGDY+++L+EYEKSLN+LP  HPLRIIA SNI A++LKIGEYS  ++ +D AL 
Sbjct: 364 GSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALK 423

Query: 437 LFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFFD 496
           LFP     WN  I  S+P +SY DIW K+++R+AE+ EHLE+F+ A + Y  L+  N F 
Sbjct: 424 LFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFS 483

Query: 497 DKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVKEQELEN 556
           DKIM GKRRCQ  +NP  A+                                 +E+E E 
Sbjct: 484 DKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVPTPSTQKYESVERIKEQNRQEEENEA 543

Query: 557 AKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMK 616
            KL LYD V  KI  WK  K +DIRHLLANL  +LTW  WK +SV +LVMPKKVK+TY+K
Sbjct: 544 EKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLK 603

Query: 617 AVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           A+AKTHPDKI  SL+LE+KMIAEN F+TLS AWDKFK++N++N
Sbjct: 604 AIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  387 bits (994), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/551 (41%), Positives = 311/551 (56%), Gaps = 47/551 (8%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKK---HKDRIASHRPT 193
           ++DEV+DME+A+LMSLGL+I+KA+ +Y   +T+E  L   K KQK    ++ R    R  
Sbjct: 130 VIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVLR--KRKQKASNGYQQRSNIDRKQ 187

Query: 194 GSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVED-KL 252
           G                    S+ +   NKGKELV+Q +++  E N+R++ +   E+  +
Sbjct: 188 GGGE----IRNIFDTRGSGSESLFSGILNKGKELVNQLSTYTEEENERMNKFKGYEEYSM 243

Query: 253 DHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXXXXXXXXXPSPSP 312
               L  EN S D  +  R   EK                               P    
Sbjct: 244 SETYLEKEN-SMDPGVFSRSSQEKIPQRAARPSHEKSNSSRSKINKRMTTEAPHKPFNDD 302

Query: 313 PPGILVE--DALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGY 370
               L+E  D+ R+     E  LLDF  DN +S+     S ++  +    PIS IE+SGY
Sbjct: 303 DQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVNTSNQNTVSITQIPISHIEISGY 362

Query: 371 NEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIEN 430
           NEFKA+GT  FKNGDY ++++EYEKSLN+LP+KHPLRIIA SNIIAS++KIG++S+S+ +
Sbjct: 363 NEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVD 422

Query: 431 SDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELV 490
           +  A+ L P  KS W   I  SDP RSYNDIWPKI++R+AES+E +E +K AL+ YQ L+
Sbjct: 423 AQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLL 482

Query: 491 TRNFFDDKIMQGKRRCQDFVN-----------------PAPARXXXXXXXXXXXXXXXXX 533
            +N F +K++ GKRRCQ  +                  PAP R                 
Sbjct: 483 EKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEVVNKKSV- 541

Query: 534 XXXXXXXXXXDNASRVKEQ-----ELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLS 588
                      NA ++K++     +LE+ K+ALYD V   I  WK GK DDIR+LL+NL 
Sbjct: 542 -----------NAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQ 590

Query: 589 GLLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFA 648
            ++TW  WK V   ELV+P+KVKITYMKAVAK HPDK+P SL+LE +MIAE+VF+TLS +
Sbjct: 591 AVITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDS 650

Query: 649 WDKFKQQNDIN 659
           W+ FK+ NDIN
Sbjct: 651 WENFKKSNDIN 661

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/594 (38%), Positives = 313/594 (52%), Gaps = 101/594 (17%)

Query: 97  IEDDFNELFGSNTMATANELQQVDQNYYGNSDGSHD-----------GDGVLVDEVKDME 145
           + DD +ELFG           QV  + +  +  + D              ++VDEVKDME
Sbjct: 41  VHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPEMVVDEVKDME 100

Query: 146 IARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSSSKXXXXXXX 205
           +A+LMSL L I++ATD+Y   V YE+       +Q++ ++ I          +       
Sbjct: 101 VAKLMSLNLDIDQATDYYERGVLYEQLS-----RQRREQELIRRREQMLRQQQQQQQTPE 155

Query: 206 XXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVEDKLDHYELPLENDSYD 265
                    S+A+    KG++ VDQ++ FP E  DRL+  V VE      +LP+E     
Sbjct: 156 EKFDSGSFFSLASGILEKGRQFVDQFSGFPQE-QDRLTR-VRVEQ-----DLPVER---- 204

Query: 266 GSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXXXXXXXXXPSPSPPPGILVEDA---- 321
                                                     P    PP + VE+     
Sbjct: 205 ------------------------------------------PKSVEPPTVEVEEGNLLG 222

Query: 322 -----LRKEEPQR------EDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGY 370
                +  EEP+R      +  LLDF        +N           PV PIS +E+SGY
Sbjct: 223 EFQEKINLEEPKRSPTPPPQATLLDF--------DNGTPPERIKTITPV-PISHLEISGY 273

Query: 371 NEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIEN 430
            E+K +GT  FK GDYV++ QEYEKSLNSLP  H LRI+A SN+ A+  K+GEY + + +
Sbjct: 274 KEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSD 333

Query: 431 SDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELV 490
            ++AL +FP + + W++ I  S P R++ ++WPKI+ RRAE+FEH+E+++ AL+ YQ L+
Sbjct: 334 IESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLI 393

Query: 491 TRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVK 550
            +N F+DKIM GKRRCQ  +NP   +                            N  RVK
Sbjct: 394 EKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPKTYA---NVERVK 450

Query: 551 EQ----ELENA-KLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELV 605
           ++    EL+ A K ALYD V  +I  WK GK DDIRHLLANLS +LTWC+WK VS  +LV
Sbjct: 451 QENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLV 510

Query: 606 MPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           MPKKVKITYMKAVAKTHPDKIP SL LE +MIAE+VF++LS AW+KFK  NDIN
Sbjct: 511 MPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 1  MSDPFAHLLTSLKNKDSGTESKKTTPQTK 29
          MSDPFA LL+S ++  S + SK+ TP+ K
Sbjct: 1  MSDPFADLLSSFRSGGSDSVSKEATPEVK 29

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  370 bits (949), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 245/697 (35%), Positives = 338/697 (48%), Gaps = 100/697 (14%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           M DPFA LLT  K  +S  +++   P    +                       S    P
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNTRETSSSL-----------SLQPEP 49

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFG------SNTMATAN 114
           +  ASN                              I+DDF +LFG      +N     N
Sbjct: 50  VTTASNYK----------------------------IDDDFEQLFGIKSNTNTNNSDVNN 81

Query: 115 ELQQVDQNYYGNS------------DGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDF 162
                +QN + ++              +      LVDEV+DME+A+LMSLG SI+ A   
Sbjct: 82  RPNTTNQNEFDSAIDLLQITPEKQRQSAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTS 141

Query: 163 YNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXX--SMATDF 220
           Y   + Y+  +E  K K+K H+  +       +  +                  S+A+  
Sbjct: 142 YEQGMLYDDVIEERK-KKKLHRRELQRLMAETNWERETPETNNDESGKNNVDLFSIASGI 200

Query: 221 FNKGKELVDQWTSFPPEANDRLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXX 280
           FNKGK++VD  + FP E ND L             E   +  +++  LP+R    K    
Sbjct: 201 FNKGKKIVDHLSLFPDEENDLLPY---------RSERLKQRQTFEPELPRRPR--KDPTP 249

Query: 281 XXXXXXXXXTDFEXXXXXXXXXXXXXXPSPSPPPGILVED-----ALRKE--------EP 327
                     ++E              P+     G L+ D     +LR +        + 
Sbjct: 250 NPRTQGTPQVEYESTLQYQQ-------PTIQAQEGDLLGDFQDKLSLRSQGNKSTSASQS 302

Query: 328 QREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKAKGTSLFKNGDYV 387
              + LLDF   + +ST+ S      G+  P  PI++IELSGYNEFK +   LFK GDYV
Sbjct: 303 PSNETLLDFDAPSANSTSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELFKTGDYV 362

Query: 388 NSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWND 447
            +LQEYEKS N+LP  HPLRII+ SN++ASQLK G+Y +S+  +  AL LFP + + W  
Sbjct: 363 AALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQ 422

Query: 448 KISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFFDDKIMQGKRRCQ 507
            I  S+P ++Y D+WPKI+ RRAE+FEH E+F+ A   YQ L+ +NF  +KIM GKRRCQ
Sbjct: 423 LIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQ 482

Query: 508 DFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVKE-----QELENAKLALY 562
             +NP   +                            N  +VKE      E +  + ALY
Sbjct: 483 KVLNPEKPKVVQKKPASSKSPSPSPNHSDKKYK----NLQKVKEDNRKQAEEDTQRHALY 538

Query: 563 DNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMKAVAKTH 622
           D V D+I  W+ GK +DIRHLL+NL  +LTW +WK VS  +LVMPKKVKITY++AVAKTH
Sbjct: 539 DRVYDQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTH 598

Query: 623 PDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           PDKI  SL L+ KMIAE+VF++LS AW+KFK +NDIN
Sbjct: 599 PDKISDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  367 bits (942), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/309 (58%), Positives = 221/309 (71%), Gaps = 8/309 (2%)

Query: 358 PVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIAS 417
           PV PIS IELSGY EF+ +GT  FKNGDYV+S QEYEKSLN+LP+ HPLRIIA SNIIAS
Sbjct: 391 PVIPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIAS 450

Query: 418 QLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLE 477
           +LKIGEYSKS++NS +AL +FP + + W   I  SDPQR+Y DIWPK+ +R+AE+ EH+E
Sbjct: 451 ELKIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIE 510

Query: 478 SFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXX---XXX 534
           SFK AL +YQEL+ + F +DKIM GKRRCQ  +NP P                       
Sbjct: 511 SFKAALSSYQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVPRKA 570

Query: 535 XXXXXXXXXDNASRVKE-----QELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSG 589
                    ++  R+K+     QE+E  KLALYD V  K+  WK  KD DIRHLLANLS 
Sbjct: 571 TSNSKDAVYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLSI 630

Query: 590 LLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAW 649
           +LTWC+WK V+  +LVMPKKVKITYMKAVAKTHPDK+P+SL LENKMIAENVF+ LS AW
Sbjct: 631 VLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSVAW 690

Query: 650 DKFKQQNDI 658
           DKFK +N++
Sbjct: 691 DKFKIENNM 699

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 113/285 (39%), Gaps = 79/285 (27%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           MSDPFA LLTS KN   G ++ K+ P   +                          SASP
Sbjct: 1   MSDPFADLLTSFKN---GKDNAKSEPTKSNISATQKPA------------------SASP 39

Query: 61  MIPASNVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFG-------SNTMA-- 111
            I       S+ PLV                     I DDF++LFG       +NT+   
Sbjct: 40  NIS----QLSITPLVPSPSPNVS-------------IHDDFDDLFGVSLGQNGTNTIVPK 82

Query: 112 -----------------TANELQQVDQNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGL 154
                             A   Q +       +D   D +  +VDEVKDME+ARLMSLGL
Sbjct: 83  QTVKTETDDIDAAFNVFQATPSQSIKPEASAPNDIDRDEEEYVVDEVKDMEVARLMSLGL 142

Query: 155 SIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSSS--------------KXX 200
           SI++A D Y+  + YE  L   K  Q++ + R    +PT  +S                 
Sbjct: 143 SIDEANDHYDKGILYENLLAKMKQNQRQKERRKVETQPTKRNSNPPSANNRLNDRFDNTY 202

Query: 201 XXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNY 245
                         SMATDF  KGKE VDQ  ++ PE N+RL NY
Sbjct: 203 ANIRDSRTRGGDLFSMATDFLYKGKEFVDQLIAY-PEENNRLLNY 246

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  361 bits (927), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 235/669 (35%), Positives = 328/669 (49%), Gaps = 94/669 (14%)

Query: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSASP 60
           M+DPFA LLTS K       +K  +P+                   +      H+    P
Sbjct: 1   MADPFASLLTSFKESSKKPAAKSESPEP-----------VTVKGGGEPATASTHAVFMEP 49

Query: 61  MIPASNV--SFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSNTMATANELQQ 118
           +IP+     SF   P                         DD  +LF S   A   E  +
Sbjct: 50  LIPSGGGQGSFQQKPAGSDDKF------------------DDVFDLFNSEPAAEVKEPDR 91

Query: 119 VDQNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKL 178
           V       SD S   +  +VDEV+DME+A++MSLG  I+KA +FY+S V Y++ +E    
Sbjct: 92  VP------SDESVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVERRDR 145

Query: 179 KQKKHKDRIASHRPTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEA 238
           +  +H     S R      K                S A    NKGK+ VD  T++P E 
Sbjct: 146 RHIRHTHTRHSVREVTEVPKHTGNSFF---------SAAVGLLNKGKDFVDHLTAYPDEE 196

Query: 239 NDRLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXX 298
            DRL+ Y        H+         D +  +R++D                DFE     
Sbjct: 197 GDRLARYRQEHADAAHFG--------DFTPGEREQD------------LLIDDFESKVSI 236

Query: 299 XXXXXXXXXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNIS-STNNSAISREDGNTN 357
                     +P                   ++ LLDF  D+ S S + + ++       
Sbjct: 237 TDKHNPPLAQTP-------------------DETLLDFGEDDSSKSGSRTHVNNSPSIEL 277

Query: 358 PVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIAS 417
           P+ PIS +ELSGYNEF+AKGT LFK GDY  ++ EYEKSLN+LP KHPLRIIA+SN++  
Sbjct: 278 PIVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLP 337

Query: 418 QLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLE 477
            LKIGEY+K ++ +  AL L P ++S+W   I +S+P+R+Y DIW K+++R AE+ EH E
Sbjct: 338 YLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAE 397

Query: 478 SFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNP-APARXXXXXXXXXXXXXXXXXXXX 536
           ++  A + YQ LV     ++K+M GKRRCQ  +NP +                       
Sbjct: 398 NYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPARTPDP 457

Query: 537 XXXXXXXDNASRVK------EQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGL 590
                  +NA RVK      EQE E AK+  YD V  K+  WK  K+ DIR+LL++L+ +
Sbjct: 458 ATSKTVYENAERVKRANAKSEQE-EAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLTEI 516

Query: 591 LTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWD 650
           +TW  W  VS  +LVMPK+VKITY+KA+AK HPDKIP  L LE +MIA+ VF+ L+ AW+
Sbjct: 517 VTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNAWE 576

Query: 651 KFKQQNDIN 659
           KFK  N+IN
Sbjct: 577 KFKLDNNIN 585

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  359 bits (921), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 230/338 (68%), Gaps = 14/338 (4%)

Query: 327 PQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKAKGTSLFKNGDY 386
           P+  + LLDF +   +  + +A       + P  PIS+IEL GY EFK +GT  FK GDY
Sbjct: 358 PKANNTLLDFDSPTTAVHSPAA-------SLPKVPISEIELLGYKEFKERGTENFKTGDY 410

Query: 387 VNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWN 446
           V +L+ Y+KSLN+LP+KHPLRIIA SNI+AS  K GEY KSIE S +AL  FP ++  WN
Sbjct: 411 VTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQKQWN 470

Query: 447 DKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFFDDKIMQGKRRC 506
           + I  S+PQR+Y DIWPKI+++RAE+FEH+ES++NALETYQ+++ +NFF+DK+M GKRRC
Sbjct: 471 EFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMSGKRRC 530

Query: 507 QDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVK-----EQELENAKLAL 561
           Q  +N  P +                           +N  ++K     E E+E+ +LAL
Sbjct: 531 QHVIN--PVKPTKSNSSALPRQTNTKPKKESNQNKAYENVEKLKQKNKLEAEIESQRLAL 588

Query: 562 YDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMKAVAKT 621
           YD+V  +I  WK  KDDDIRHLL+NL  +LTW NW  V   +LVMPKKVKITYMKAVA+T
Sbjct: 589 YDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMKAVART 648

Query: 622 HPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           HPDKIP  L LE KMIAEN+F+ LS AW+KFK+ N++N
Sbjct: 649 HPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 61/108 (56%), Gaps = 8/108 (7%)

Query: 136 VLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGS 195
           ++VDEVKDMEIA+LMSLGL I++AT  Y++ + YE    +SK++      RI + R    
Sbjct: 131 IVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYETL--VSKIRT--SNSRITAQR--ND 184

Query: 196 SSKXXXXXXXXXXXXXXXXSMA-TDFFNKGKELVDQWTSFPPEANDRL 242
           S +                S   T  F+KGK+LVDQWT +  E +DRL
Sbjct: 185 SGRNDIRAEPMRKPRTSNGSFTFTGLFDKGKQLVDQWTVY-HEEDDRL 231

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  359 bits (921), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 177/307 (57%), Positives = 219/307 (71%), Gaps = 9/307 (2%)

Query: 359 VAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQ 418
             PIS IELSG+ EFK +G+ LFKNGDYV++LQEYEKSLN+LP  HPLRII+ SNIIA+Q
Sbjct: 403 TVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQ 462

Query: 419 LKIGEYSKSIENSDTALALFPANK--SSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476
           LKIGEYSKSIE+   AL+LFP  K  S+WN  I  S PQRS+ DIW K+++R+AES+EHL
Sbjct: 463 LKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHL 522

Query: 477 ESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAP----ARXXXXXXXXXXXXXXXX 532
           E++K AL++YQ+L+   F + KIM GKRRCQ  +NP P    ++                
Sbjct: 523 ENYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKD 582

Query: 533 XXXXXXXXXXXDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLT 592
                      +NA   K +E+EN K+ALYD V  KI  WK  KD DIRHLL+NLS +LT
Sbjct: 583 TTTASVQRLQDENA---KSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLT 639

Query: 593 WCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKF 652
           WC+W  +S  +LVMPKKVKITY+KA+ KTHPDKIP+SL LENKMIAENVF+ LS AWDKF
Sbjct: 640 WCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKF 699

Query: 653 KQQNDIN 659
           K  N++N
Sbjct: 700 KLDNNMN 706

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 122/285 (42%), Gaps = 63/285 (22%)

Query: 1   MSDPFAHLLTSLKN-KDSGTESKKTTPQTKDFXXXXXXXXXXXXXXXQGNNDGLHSFSAS 59
           MSDPFA LLTS KN +++   +  T   TK                 + +   L +F+ +
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60

Query: 60  PMIPAS------NVSFSVAPLVXXXXXXXXXXXXXXXXXXXXXIEDDFNELFGSN----- 108
           P+IP+S      N   +  PL                      IEDDF++LF SN     
Sbjct: 61  PLIPSSRDASKSNSRVTSPPL----------------------IEDDFSDLFNSNEQKNI 98

Query: 109 ----------------TMATANELQQVDQNYYGNSDGSHD-GDGVLVDEVKDMEIARLMS 151
                              +   L+Q  Q +   ++   D  + ++VDEVKDME+ARLMS
Sbjct: 99  TSPPAPKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMS 158

Query: 152 LGLSIEKATDFYNSDVTYEKYLEIS---KLKQK--------KHKDRIASHRPTGSSSKXX 200
           LGLSI++A  +Y+  + YE  +      KLKQ+        + K+    +     ++   
Sbjct: 159 LGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYAN 218

Query: 201 XXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNY 245
                         SMATD   KGKELVDQ T++ PE N+RL  Y
Sbjct: 219 KRFNESQNNTGNLFSMATDILYKGKELVDQLTAY-PEENNRLYKY 262

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  320 bits (819), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/361 (47%), Positives = 232/361 (64%), Gaps = 22/361 (6%)

Query: 320 DALRKEEPQREDNLLDFSTDNISST----NNSAISR----------EDGNTNPVA--PIS 363
           ++L     Q    L DF +D+++S     NNSA S+          +  NT P+   PIS
Sbjct: 480 ESLVSHGSQESSILFDFDSDSVTSMHIKQNNSATSKNIVTAKADEKDLVNTLPIVKVPIS 539

Query: 364 DIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGE 423
            IELSGY EF+A GT  FK GDY ++L EY+KSLN+LP KHPLR+I+ SNI+A+QLK+GE
Sbjct: 540 TIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGE 599

Query: 424 YSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
           YS+S+++ D AL LFP N   W   I  SDPQ++Y +IWPKI++R+AE+ EH+E ++ A 
Sbjct: 600 YSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAY 659

Query: 484 ETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXX 543
           ++YQ L+ +N F+DKIM GKRRCQ  +NP   +                           
Sbjct: 660 DSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSINVNK 719

Query: 544 DNASRV-----KEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKD 598
            N  R+     KE+E E  +L L D+V+ KI  W   K+DDIR+LL+N+  +LTW NWK 
Sbjct: 720 -NVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKA 778

Query: 599 VSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDI 658
           ++  +LVMPKKVK+ YMKAVAKTHPDKI K LS+ENKMIAE++F+ LS AW+KFK  N +
Sbjct: 779 INASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKM 838

Query: 659 N 659
           N
Sbjct: 839 N 839

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 8/106 (7%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196
           +VDEVKDMEIA+LMSLGLSI+KA  +YN     +  L   K++ +KHK R +++      
Sbjct: 216 VVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLR--KMQAQKHK-RQSNYSTKYDD 272

Query: 197 SKXXXXXXXXXXXXX-----XXXSMATDFFNKGKELVDQWTSFPPE 237
           +K                     S+A+DF NKGK +VDQ++++  E
Sbjct: 273 TKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEE 318

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  308 bits (788), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 198/546 (36%), Positives = 284/546 (52%), Gaps = 61/546 (11%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHR----- 191
           +VDEVKDMEIARLMSLG+S+E+A  +Y   + Y+  L     K +  +   A+ R     
Sbjct: 75  VVDEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRRRHEKHEAKRQAAAASRDFTKL 134

Query: 192 -PTGSSSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVED 250
              GSS+                 SMAT  FNKGK  +++          RL      + 
Sbjct: 135 FDNGSSN--ILGSDGSDDKQQDLFSMATGLFNKGKSFMEE----------RLKQRQQHQH 182

Query: 251 KLDHYELPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXXXXXXXXXPSP 310
           + D         S+   +  R E                  +E              P P
Sbjct: 183 QQDP-----AFRSFADHISSRLE------------SPTRAKYERSQYTDKQVGSERRPEP 225

Query: 311 SP-----PPGILVEDALRK------EEPQREDNLLDFSTDNISSTNNSAISREDGNTNPV 359
           +P      P ++  D L          PQ E  LLDF          S+ +R      P 
Sbjct: 226 APVDEVEEPSVIEGDLLGGFDELSVSSPQHE-TLLDFEQAVSPPQLRSSSAR------PP 278

Query: 360 APISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQL 419
             IS +ELSG+ EFK+KG  LF +G+Y ++L EYEKSLN+LP  HPLRII+LSNII +QL
Sbjct: 279 ISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNIITTQL 338

Query: 420 KIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESF 479
           K+GE S +++N +TAL L   ++      I  S+P +SY + W KI +R+AE+ EH+E++
Sbjct: 339 KLGESSSALQNIETALRLIGEDELQLT--IPASNPPKSYREFWGKITMRKAEALEHVENY 396

Query: 480 KNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARXXXXXXXXXXXXXXXXXXXXXXX 539
            +ALE Y+ L+ + F   K+M GKRRCQ  ++P   +                       
Sbjct: 397 VSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPSPNVLDTSSSTL 456

Query: 540 XXXXDNASRVKE-----QELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWC 594
               DN  +++      ++LEN K  L D V ++I  W  GK++D+R LLA+L  +LTW 
Sbjct: 457 PKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLADLPKVLTWS 516

Query: 595 N-WKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFK 653
           N WK V+  +LVMPKKVKITY+KA+AKTHPDK+  SL +E+KM+AE++F+ LS AW+ FK
Sbjct: 517 NDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSILSKAWEAFK 576

Query: 654 QQNDIN 659
           ++N+I+
Sbjct: 577 EENNIS 582

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  310 bits (793), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 219/353 (62%), Gaps = 8/353 (2%)

Query: 313 PPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNE 372
           PP I  E     +E  +++ LLDF  +++SS  N +IS       PV  I+ IELSGYNE
Sbjct: 341 PPRI-TERQKPNDERIQDNTLLDFGNEDLSSPANVSISSSGQECIPVISINQIELSGYNE 399

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
           FK +GT  FK GDYV++ ++YEKSLNSL   HPLRIIA SN++AS LK G+Y+  I  S 
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTR 492
           +AL LFP     W++ I  S+P ++Y +IW K++ RRAE+FE +E+++ A ++YQ L+  
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIEN 519

Query: 493 NFFDDKIMQGKRRCQDFVNPAPARX--XXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVK 550
           N F++KIM GK RCQ  +NP                                  N  +++
Sbjct: 520 NIFNEKIMAGKLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQ 579

Query: 551 EQ-----ELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELV 605
           EQ     + E  K ALYD V  K+  W  GKDDDIRHLL+ L  ++TW  W +V+  +LV
Sbjct: 580 EQNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLV 639

Query: 606 MPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDI 658
           MPKKVKITY+KAVAKTHPDK+P +L  E++M+AEN+F+ LS  W+KFK  N+I
Sbjct: 640 MPKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNI 692

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 11/107 (10%)

Query: 136 VLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGS 195
           V+VDEVKDMEIA+LMSLGLSI++A   +   + Y+    ++  +Q       A+ R + S
Sbjct: 149 VIVDEVKDMEIAKLMSLGLSIDEAIKSFEHGILYDT---VASRQQ-------AAQRFSSS 198

Query: 196 SSKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRL 242
           S++                 + +    K K+L+D WT    E +DRL
Sbjct: 199 SNRRGTPIANSGTNNSSGGGLFSSIIGKSKQLIDDWTVNHDE-DDRL 244

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  289 bits (739), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 268/540 (49%), Gaps = 53/540 (9%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196
           LVDE+KDMEIARLMSLGLS  KAT +Y   + Y+  LE      +K + R     P  +S
Sbjct: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE------RKRQQRTREEAPQKTS 147

Query: 197 SKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVEDKLDHYE 256
            +                S+A+ + N+G+  +D           ++ N    +   D+  
Sbjct: 148 DEGRFTQGSEPDLL----SVASSWLNRGRTFLDSKLK-------QIQNDNGTQSYSDYIS 196

Query: 257 LPLENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDFEXXXXXXXXXXXXXXPSPSP---- 312
             +E+ ++ GS  +   D                 F+                 SP    
Sbjct: 197 SRMESSAHTGSRLRPTSD-------IPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSE 249

Query: 313 --PPGILVEDALRKEEPQRE--DNLLDFSTDNISSTNNSAISREDGNTNPVAP---ISDI 365
             PP + + D +    P+    D L+DF           A S  D  ++PVA    +S +
Sbjct: 250 ILPPLVNIGDDVPVSGPEEASADLLVDFD----------APSGHDAVSSPVAASIAMSAL 299

Query: 366 ELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYS 425
           E   Y EFK KGT  F  GDY  + Q +EKS+NSLP  HPLR I+LSN+I  +LK+GEY 
Sbjct: 300 EFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYR 359

Query: 426 KSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALET 485
           K+IE+S  AL L    K   +D I  SDP +++ +IW KI+  +AE++EH+E +  AL+ 
Sbjct: 360 KAIEDSSVALKLISCAK--LDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKE 417

Query: 486 YQELVTRNFFDDKIMQGKRRCQDFVNPAP-ARXXXXXXXXXXXXXXXXXXXXXXXXXXXD 544
           YQ L+ R     K+M+G+RRCQ  V P    +                           +
Sbjct: 418 YQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSE 477

Query: 545 NASRV-----KEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDV 599
              RV     KE+ELE  K  L+D V D++  W    +DD+R LL+    ++ W +WK+V
Sbjct: 478 KLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNV 537

Query: 600 SVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           S  +LVMPK+VKI Y+KAV KTHPDKI  S  LE KM+AENVF  LS AW+ FK+QN ++
Sbjct: 538 STADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  281 bits (719), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 190/528 (35%), Positives = 271/528 (51%), Gaps = 45/528 (8%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196
           LVDEVKDMEIARLMSLGLS +KA  +Y+  + YE+ +E S+ K+K+ +  +         
Sbjct: 133 LVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIE-SQKKRKQSRSNV-----NNDF 186

Query: 197 SKXXXXXXXXXXXXXXXXSMATDFFNKGKELVDQWTSFPPEANDRLSNYVNVEDKLDHYE 256
            +                S+A++ FN GKE ++          D+L   +  +     Y 
Sbjct: 187 GQQQLRKQESRDSSPAFISVASNLFNMGKEFIE----------DKLKPTLQPQ-----YA 231

Query: 257 LPLENDSYDGSLPQRKEDEKXXXXXXXXX-XXXXTDFEXXXXXXXXXXXXXXPSPSPPPG 315
              +   +   +P R++  +              T  +               + S PP 
Sbjct: 232 NSSQRSQFSDDIPLRRDYTRPHSRPHSMQFQSERTSPQPSPELPSIHQLSINNASSAPPP 291

Query: 316 ILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKA 375
           + VE+        +E  L+DF     +S +            P   ISD EL+ +NEFK 
Sbjct: 292 VSVENQDTASVINQE-TLVDFGAAPQTSAS------------PQHRISDFELTSFNEFKN 338

Query: 376 KGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTAL 435
            G   F +GDY N+L E+EKS N+LP KHPLRII+LSNI++ QLK+GE SK++E+   AL
Sbjct: 339 NGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESVKLAL 398

Query: 436 AL--FPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRN 493
            L     N S   D I  S P+R++  +  KI ++ AE  EHLE+++ AL  Y  L++  
Sbjct: 399 DLSDLAPNAS---DIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISNG 455

Query: 494 FFDDKIMQGKRRCQDFVNP---APARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVK 550
             + K+M GKRRC+  VNP    PA+                           +   + +
Sbjct: 456 ITEQKVMDGKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADTVAVNRVKEENKKQE 515

Query: 551 EQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKV 610
           E+  E  +L L D V +KI  W    ++D+R+LLANL  LL W +WK+VS Q+LVM KKV
Sbjct: 516 EE--EEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVMTKKV 573

Query: 611 KITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDI 658
           KI Y+KA+AKTHPDKIP   SLE  MIAENV+T L+ AW+ FK QN+I
Sbjct: 574 KICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  279 bits (713), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 183/545 (33%), Positives = 275/545 (50%), Gaps = 42/545 (7%)

Query: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196
           +VDEVKDMEIARLMSLGL  +KA ++Y   + YE+ ++    +QK+   R  + RP  +S
Sbjct: 99  VVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVD----RQKRRTAR--TERPLRTS 152

Query: 197 SKXXXXXXXXXXXXXXXXSMATDFFNKGKELVD-QWTSFPPEANDR-LSNYVNVEDKLDH 254
            +                S+A+++ NKG+  +D +      E +DR  S+Y++     + 
Sbjct: 153 PQSSQLREEESDLF----SVASNWLNKGRTFLDSKLKQVQTEYSDRSFSDYISSRSGSNA 208

Query: 255 YELPL-ENDSYDGSLPQRKEDEKXXXXXXXXXXXXXTDF--------EXXXXXXXXXXXX 305
               L E+ SY   +   +  +K             T F                     
Sbjct: 209 SPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANSPVPSTKSPAVSVASA 268

Query: 306 XXPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDI 365
             P  S  PG   E        Q  D L+DF    + ++N  A    +        ++++
Sbjct: 269 SHPVYSETPGDKSEAPPNPSPVQDNDLLIDFEAPALKTSNVPATYSPN--------LTEL 320

Query: 366 ELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYS 425
           E   + EFK KG + F+ GDY  + Q YEKSLNSLPL HPLR+++ SNII  +LK+GEY 
Sbjct: 321 ERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYR 380

Query: 426 KSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALET 485
           +++ ++ +AL L P  + S N  I   +P ++Y + W KIM  +A +FE +E+++ ALET
Sbjct: 381 EALSDASSALKLIP--QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALET 438

Query: 486 YQELVTRNFFDDKIMQGKRRCQDFV--NPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXX 543
           YQ+L+       K+++ +R+CQ  +     P                             
Sbjct: 439 YQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPAKVTL 498

Query: 544 DNAS----RV-----KEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWC 594
           +N S    RV     KE++LE  +  L+D VS  I  W  G DD++R LLA    ++ W 
Sbjct: 499 ENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWV 558

Query: 595 NWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQ 654
           NWK+VS  +LV+PKK K+ Y+KAVAKTHPDKI  S  L+ KMIAENVF  LS AW+ FK+
Sbjct: 559 NWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKE 618

Query: 655 QNDIN 659
           +N ++
Sbjct: 619 KNQLS 623

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  244 bits (623), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 187/308 (60%), Gaps = 10/308 (3%)

Query: 360 APISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQL 419
            PIS IE+SGY EF   G   F+NGDY N+ Q+Y KSLN+LP+ HPLRI+A SNII +QL
Sbjct: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415

Query: 420 KIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESF 479
           KIGE+++S++N + A  L   + SS +  I  ++P ++Y + W KI+ ++AE  E+LE +
Sbjct: 416 KIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473

Query: 480 KNALETYQELVTRNFFDDKIMQGKRRCQDF--VNPAPARXXXXXXXXXXXXXXXXXXXXX 537
             AL  Y+ L+++  FD KI++GK RCQ    +   PA                      
Sbjct: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSI 533

Query: 538 XXXXXXDNAS------RVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLL 591
                    +      R + +ELE  K  L+D V  KI  W  GK+ D+RHLL+ LS +L
Sbjct: 534 PERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVL 593

Query: 592 TWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDK 651
           TW NW  +   +LV+PKKVKI YMKA++K HPDK+P +L LE+KM+AE++F+ L  AW+ 
Sbjct: 594 TWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNV 653

Query: 652 FKQQNDIN 659
           FK  NDIN
Sbjct: 654 FKLNNDIN 661

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  232 bits (592), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 194/335 (57%), Gaps = 16/335 (4%)

Query: 330 EDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKAKGTSLFKNGDYVNS 389
           E++L+DFS++          S+     N V+ I+ +ELSGY +F       +K GDY  +
Sbjct: 325 EESLIDFSSE--------GPSKSAAQLNYVS-ITPLELSGYYDFNKTAAESYKKGDYHAA 375

Query: 390 LQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWNDKI 449
            Q+Y KSLN+LPL HPLRIIALSNII +QLKIGE+++S++N ++A+ L       ++ +I
Sbjct: 376 FQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQI 433

Query: 450 SKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFFDDKIMQGKRRCQDF 509
             + P R+Y + W KI+ ++AE  E  ++++ AL  YQ+L++R +    I+ GK RCQ  
Sbjct: 434 QDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKA 493

Query: 510 VNPAPARXXXXXXXXXXXXXXXXXXXXXXXXXXXDNASRVKEQ-----ELENAKLALYDN 564
            N                                +   R+K Q     + EN +  L+D 
Sbjct: 494 CNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDK 553

Query: 565 VSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPD 624
           V  +I  W  GK  D+RHLL  L  LL W N   +   +LVMPK+VK++Y+KAV+KTHPD
Sbjct: 554 VESRIRTWTAGKSTDLRHLLLGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPD 613

Query: 625 KIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659
           K+P++L LE KM+AE+VF TL+ AW  FK++N ++
Sbjct: 614 KLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 132 DGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEK 171
           D    + DE +D E+A+LMSLGL I  A D+Y+    YE+
Sbjct: 114 DKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQ 153

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIE 429
           + E+K  G + FK+G+Y+ +++ Y+K +   P ++P   I  SN   S +K+ +Y++++E
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEP-ENP---IGYSNSAMSLIKLTKYTEALE 58

Query: 430 NSDTAL 435
           +  T L
Sbjct: 59  SCGTGL 64

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
            K +G   FK  DY N+L+ Y  +L  +  K P   +  SNI A  + +G+  K +ENS 
Sbjct: 104 LKDRGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISACYVSLGQLDKVVENST 158

Query: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 159 KALELKPD---------------------YSKALLRRASANESLENYADAM 188

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 62/139 (44%), Gaps = 37/139 (26%)

Query: 353 DGNTNPVAPISDIELSG-------YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH- 404
           D N  PV  + D++L             K KG +LFK  D+ N+++ Y  +L+   LK  
Sbjct: 73  DANGEPV--LGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALS---LKED 127

Query: 405 PLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPK 464
           P   +  SNI A    +  Y K IE +  ALAL P                      + K
Sbjct: 128 P---VYYSNISACYSSLLNYEKVIEMATKALALRPD---------------------YSK 163

Query: 465 IMIRRAESFEHLESFKNAL 483
           +++RRA ++E L +F +A+
Sbjct: 164 VLVRRANAYEKLGNFGDAM 182

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           + K KG   FK  DY N+++ Y  +L+    K P   I  SNI A  + +G+  K IE+S
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDL--NKDP---IFYSNISACYVSLGQLDKVIESS 178

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K ++RRA + E LE++ +AL
Sbjct: 179 TKALELNPN---------------------YSKALLRRASANESLENYSDAL 209

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 17/105 (16%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           + K KG + FKNGDY  ++  YEK+  +L   +P   I  SN+  + +K+  + +++   
Sbjct: 43  DLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNAC 98

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476
           D  L     NK S+   +     Q        K+  RR  + +HL
Sbjct: 99  DKGL-----NKVSFKTGMDSKTKQ--------KLEWRRITALKHL 130

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           E K KG   FK  DY N+L+ Y+ +L  +  K P   +  SN+ A  + + E  K IE S
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 367 LSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSK 426
           +S + + K +G SLFK G Y  ++  Y++ + + P ++P   +  SN   + +K+GEY++
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQP-QNP---VGYSNKAMALIKLGEYTQ 56

Query: 427 SIE 429
           +I+
Sbjct: 57  AIQ 59

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
            K KG   FK  DY N+L+ Y+ +L     K P   +  SNI A  + + +  K +ENS 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYALTLK--KDP---VFYSNISACYVSMNQLDKVVENST 163

Query: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 38.1 bits (87), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 62/139 (44%), Gaps = 40/139 (28%)

Query: 358 PVAPISDIELSGYNEF------------KAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH- 404
           PVA   + +LSG + F            K KG   FK  D+ N+L+ Y  +L    LK  
Sbjct: 81  PVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALT---LKQD 137

Query: 405 PLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPK 464
           P   +  SNI A  + +G+  K +E+S  AL L             K D        + K
Sbjct: 138 P---VFYSNISACYVSLGQLEKVVESSTEALKL-------------KHD--------YSK 173

Query: 465 IMIRRAESFEHLESFKNAL 483
            ++RRA ++E L ++ +A+
Sbjct: 174 ALLRRASAYESLANYVDAM 192

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 25/119 (21%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIE 429
           + E KAKG   FKNG Y  ++  Y + ++  P  +P   I  SN   + LK   + ++I 
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDP-SNP---IGYSNKAMALLKADRFDEAIT 58

Query: 430 NSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQE 488
             +  L L           ISK DP+   N I  K+  R       L+S K++L  YQ+
Sbjct: 59  TCEKGLQL-----------ISKEDPE---NLIKQKLEYR-------LQSAKSSLRDYQK 96

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 33.9 bits (76), Expect = 0.32,   Method: Composition-based stats.
 Identities = 17/69 (24%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 367 LSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSK 426
           ++ + + K +G +LFK G Y+ ++  Y++ + + P ++P   +  SN   + +K+GE+++
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQP-QNP---VGYSNKAMALIKLGEHAQ 60

Query: 427 SIENSDTAL 435
           +I+     L
Sbjct: 61  AIQACQQGL 69

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431
            K KG   FK   Y ++L+ Y  +L+   LK  P   +  SNI A  + +G   K +E+S
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALD---LKQDP---VFYSNISACYVSLGNLEKVVESS 155

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K ++RRA + E+LE+F  A+
Sbjct: 156 TKALELKPD---------------------YSKALLRRASANENLENFAEAM 186

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
            K KG  LFK      +++ Y+ +L     K P   +  +NI A  + + ++ K +EN +
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDP---VFYANISACYVSLNDFEKVLENCN 163

Query: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
            AL L P                      + K+++RRA ++E++E+F +A+
Sbjct: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 361 PISDIELSGYNE-FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQL 419
           P+ D E+    E FK +G       DY  ++++Y +++ +L    P  +I  +N  A+  
Sbjct: 89  PVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTL----PTNVIYYANRAAAYS 144

Query: 420 KIGEYSKSIENSDTALALFPA 440
            + EY  +I++++ A+ + PA
Sbjct: 145 SVKEYDNAIKDAEKAIEIDPA 165

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 34/116 (29%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRI----IALSNIIASQLKIGEYSKS 427
           E K KG   FK+ D  N+++ YE         + LR+    +  SNI A    + +  K 
Sbjct: 160 ELKNKGNQYFKSKDNENAIKYYE---------YALRLDQDPVFYSNISACYFAMNQLDKV 210

Query: 428 IENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
           IE+S+ AL L P                      + K ++RRA ++E L + K AL
Sbjct: 211 IESSNKALELKPD---------------------YSKALLRRANAYEALGNNKEAL 245

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 81/195 (41%), Gaps = 49/195 (25%)

Query: 315 GILVEDALRKEEPQRE--DNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNE 372
           G+L  D +  E+ ++   D   D   D+++  +   +   D     V+ + DI       
Sbjct: 172 GVLPADYVVPEDAEKTPTDEFGDNYDDSLADDSKVDLENVDSVLKAVSAVKDI------- 224

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHP-------------LRIIALSNIIASQL 419
               GTSLFK   +  +L +YEKS + L    P             LRI    NI    +
Sbjct: 225 ----GTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAI 280

Query: 420 KIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESF 479
           K G+Y K++ ++   +     + ++ +DK SK+           K + RR  ++ HL+  
Sbjct: 281 KTGDYQKALTSTTEVV-----HDAAADDK-SKA-----------KALYRRGLAYYHLKDP 323

Query: 480 KNAL------ETYQE 488
           + A+       TYQ+
Sbjct: 324 EMAITDLEFATTYQQ 338

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
           FK +G +  K  +Y+ +++ Y +++       P + I  SN   +QLK+  +   + + D
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAIEL----DPTQSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 433 TALALFPANKSSWNDK 448
            AL L P N  +++ +
Sbjct: 71  VALRLDPKNIKAYHRR 86

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431
            K KG  LFK   + ++++ Y  +L    LK  P   I  SNI A    + +Y K IE +
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALK---LKDDP---IYYSNISACYASLLQYEKVIEYA 166

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K+++RRA ++E + +F +A+
Sbjct: 167 TKALKLRPT---------------------FSKVLMRRALAYEAMGNFGDAM 197

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 367 LSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSK 426
           +  ++  KAKG   FK  DY  ++  Y+K++ + P  +P   I  SN     +K+ ++S+
Sbjct: 1   MEDFDTLKAKGNVFFKKCDYETAVLYYQKAITADP-SNP---IGYSNNAMGLIKLEKWSE 56

Query: 427 SIENSDTALALF 438
           +++  +  L + 
Sbjct: 57  AVDACNKGLKMI 68

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIE 429
           + ++K +G   FK G Y  + + Y+K ++  P ++P   I  SN   + +K+G Y++ +E
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEP-ENP---IGYSNKAMALIKLGRYTEVVE 58

Query: 430 NSDTALALFP 439
                L   P
Sbjct: 59  LCRKGLTFTP 68

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 27/131 (20%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           +FK KG    K  DY ++++ Y K++         + I  SN   + LK   +  ++ + 
Sbjct: 14  DFKNKGNEYIKKSDYDSAIEFYSKAI----ALDSTQSIYFSNRALAHLKQDNFYSAVVDC 69

Query: 432 DTALALFPANKSSWNDK-------------------ISKSDPQRSYNDIWPKIMIRRAES 472
           D AL L P N  +++ +                   + K+ P    NDI     ++  E+
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKP----NDITASNALKVCEN 125

Query: 473 FEHLESFKNAL 483
           F   E FKNA+
Sbjct: 126 FIREERFKNAI 136

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           E+K +G +  K  DY  ++++Y+K++         + +  SN     LK+  +  + ++ 
Sbjct: 11  EYKNEGNACVKVQDYAKAIEKYDKAIEL----DDTQSVYFSNRALCHLKLDNFQCASQDC 66

Query: 432 DTALALFPANKSSWNDK 448
           D ALAL P N  +++ +
Sbjct: 67  DKALALDPKNVKAYHRR 83

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 55/139 (39%), Gaps = 25/139 (17%)

Query: 372 EFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENS 431
           EFK +G    K  DY  +++ Y +++    L   + I   SN     LK+  +   I + 
Sbjct: 14  EFKNRGNDAIKTQDYPGAIELYTEAIK---LDDTVSIY-FSNRAMGHLKMDNFQSGINDC 69

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVT 491
           D AL + P N  +++                     RR  S+  L  FKNA +  + ++ 
Sbjct: 70  DKALEIDPKNIKAYH---------------------RRGMSYIGLLEFKNAQKDLKIVLA 108

Query: 492 RNFFDDKIMQGKRRCQDFV 510
               D    +G   C+ F+
Sbjct: 109 SKPNDATAKRGLDVCEKFI 127

>TBLA0C05380 Chr3 (1300875..1302041) [1167 bp, 388 aa] {ON}
           Anc_3.468 YPR133C
          Length = 388

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 66/154 (42%), Gaps = 30/154 (19%)

Query: 309 SPSPPPGILVED------ALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTN-PVAP 361
           SPSP P  L++D       L+ EE +R D          S   +    R    T+ P A 
Sbjct: 13  SPSPEPNNLMDDNQNDNVQLKIEEQERNDRQRKHIEAGTSDDEDEIDDRAKRITSVPSAD 72

Query: 362 ISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHP---------------- 405
              IE   Y+E+++ GTS + +    NS +E E+ L+ + LK P                
Sbjct: 73  NQTIERPAYDEYQSGGTSNYSDVSG-NSRKEIEERLDRI-LKKPKVRRNRRDEDDLEQML 130

Query: 406 ----LRIIALSNIIASQLKIGEYSKSIENSDTAL 435
               LR+    N IA+Q+ I   +K IE  DT+L
Sbjct: 131 DEKVLRLKDEMN-IAAQMDIDTLNKRIETGDTSL 163

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 28/112 (25%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE---LKEDP---VFYSNLSACYVSVGDLKKVVEMS 155

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K+++RRA + E L  F +A+
Sbjct: 156 TKALELKPD---------------------YSKVLLRRASANEGLGKFADAM 186

>Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032W
           (REAL)
          Length = 394

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%)

Query: 367 LSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSL 400
           L   N  K  GT LFK  DY N+L +Y KSLN +
Sbjct: 238 LEAANIIKESGTLLFKKKDYSNALFKYRKSLNYI 271

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALE---LKDDP---VFYSNLSACYVSVGDLKKVVEMS 155

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K+++RRA + E L +F +A+
Sbjct: 156 TKALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186

>TBLA0B01980 Chr2 complement(452814..455924) [3111 bp, 1036 aa] {ON}
            Anc_1.509 YJR061W
          Length = 1036

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 318  VEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKAKG 377
            ++  +  E+ +  D L  F+ D + + NNS  S+ +G  +P   I D     YN+F   G
Sbjct: 944  IQRVIEVEKQKVADQLWSFTND-LYNRNNSLFSKYNGYDDPFNGIDDN--GKYNDFNNFG 1000

Query: 378  TSLFKNGDYVN 388
             +LF N D  N
Sbjct: 1001 INLFNNSDVKN 1011

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431
            K KG   F+N  Y ++++ Y  +L    LK  P   +  SN+ A  + +G+  K +E S
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALE---LKEDP---VFYSNLSACYVSVGDLKKVVEMS 155

Query: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
             AL L P                      + K+++RRA + E L +F +A+
Sbjct: 156 TKALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 26/111 (23%)

Query: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432
            K KG   FKN  + ++L+ Y     SL ++     +  SN  A  + +G+  K +E++ 
Sbjct: 99  LKDKGNEFFKNKQFEDALKYY-----SLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTT 153

Query: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483
            AL L P                      + K ++RRA + E L  F +A+
Sbjct: 154 AALKLKPD---------------------YSKCLLRRASANESLGKFADAM 183

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLP 401
           ++ FK +G   FK G+Y ++++ YEK +   P
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINP 34

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 6/81 (7%)

Query: 367 LSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSK 426
           +  + EFK KG + +K  ++ +++  Y+K++       P   +  SN   + +K+  Y+ 
Sbjct: 1   MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITY----DPTNPVGYSNCAMALIKLNNYAD 56

Query: 427 SIENSDTALALFPANKSSWND 447
           + +       LF  N+ + ND
Sbjct: 57  ASQMCQR--GLFYVNEQTDND 75

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIE 429
           + E K +G  LFK GDY  + + Y+  +    ++ P   I  SN   S +K   + ++I 
Sbjct: 3   FEENKTEGNRLFKLGDYTAANKFYDLCI----MEEPTNPIGYSNKAMSLIKQEHFDQAIR 58

Query: 430 NSDTAL 435
             +T L
Sbjct: 59  TCNTGL 64

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 370 YNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIE 429
           +N+ K +G + F+ GDY  +   Y++ +       P   I  SN   S +K G +  ++E
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKL----EPTNPIGYSNKAMSLIKQGNHGLAVE 58

Query: 430 NSDTAL 435
                L
Sbjct: 59  TCQEGL 64

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 75/167 (44%), Gaps = 28/167 (16%)

Query: 358 PVAPIS-DIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIA 416
           P  P+  D++     + KA+G  L+K   +  ++ +YE++ N   L+    I  L+N  A
Sbjct: 245 PPEPMEVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWN---LQKD--ITYLNNRAA 299

Query: 417 SQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476
           ++ + G+Y+ +I+              + N+ + +    R+   +  K   R   ++  L
Sbjct: 300 AEYEKGDYNSAIK--------------TLNEAVEQGRELRADYKVIAKSFARLGNAYYKL 345

Query: 477 ESFKNALETYQELVTRNFFDDKIMQ--------GKRRCQDFVNPAPA 515
           +  K A+E Y++ +T +   D + +         KR  + +++P  A
Sbjct: 346 DEVKKAVEYYEKSLTEHRTPDVLNKLRNLEREIKKREAEAYIDPEKA 392

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,482,621
Number of extensions: 2804985
Number of successful extensions: 9038
Number of sequences better than 10.0: 118
Number of HSP's gapped: 9303
Number of HSP's successfully gapped: 138
Length of query: 659
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 543
Effective length of database: 40,180,143
Effective search space: 21817817649
Effective search space used: 21817817649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)