Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.4875.349ON36836816910.0
YDR318W (MCM21)5.349ON36836814370.0
Smik_4.5775.349ON36836814340.0
Skud_4.5845.349ON36836814020.0
KNAG0C055205.349ON3853536912e-87
KAFR0C018705.349ON3413506811e-86
TDEL0E027805.349ON3473396812e-86
CAGL0H07139g5.349ON3583036387e-80
TPHA0D020705.349ON3733536102e-75
Kpol_1051.55.349ON3703355841e-71
SAKL0G08888g5.349ON3793215832e-71
ZYRO0D10120g5.349ON3293345619e-69
KLTH0H14806g5.349ON3462795053e-60
TBLA0H019805.349ON3592155031e-59
AGR349W5.349ON2422184084e-47
Ecym_81845.349ON2482214086e-47
Kwal_34.159865.349ON2312124068e-47
NCAS0F028505.349ON2813034053e-46
NDAI0I015505.349ON2762833723e-41
KLLA0B10142g5.349ON2931841628e-12
KLLA0A10703g1.371ON61272790.29
TDEL0G046706.4ON57388751.0
TDEL0D035203.273ON104974703.8
KLTH0C10230g6.56ON78365704.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.487
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   655   0.0  
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   558   0.0  
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   556   0.0  
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   544   0.0  
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   270   2e-87
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   266   1e-86
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   266   2e-86
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   250   7e-80
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   239   2e-75
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   229   1e-71
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   229   2e-71
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   220   9e-69
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   199   3e-60
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   198   1e-59
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   161   4e-47
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   161   6e-47
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   160   8e-47
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   160   3e-46
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   147   3e-41
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    67   8e-12
KLLA0A10703g Chr1 complement(929877..931715) [1839 bp, 612 aa] {...    35   0.29 
TDEL0G04670 Chr7 (853039..854760) [1722 bp, 573 aa] {ON} Anc_6.4...    33   1.0  
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    32   3.8  
KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} simila...    32   4.0  

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/368 (90%), Positives = 332/368 (90%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MSKIDDLQQDV                     RDKRKNQSSTNPIIQEFEDLFDQFPQLN
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180
           HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL
Sbjct: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180

Query: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300
           PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD
Sbjct: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWXXXXXXXXXXXXXXXN 360
           LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKW               N
Sbjct: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWELLLLGPLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/368 (74%), Positives = 309/368 (83%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MS+IDDLQQD+                     +DKRKN+ S NPI+QEFEDLFDQFPQLN
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           NFLFNEHPEL++ DDKDIS      PAT IPYEPKK+AKLEN+E LPE EWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180
           H+MFD  VADLLDT+ILTSPSKRKRKL +++I+TSD+S LED I+LEN+YRMFGITFFPL
Sbjct: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180

Query: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDPIDLK+KD+S EI VDREMLGIRLEVF+ERTS+FEKPHY+LLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240

Query: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300
           PS+IDVQ IF+DTNGGLVIS DDAYLFAKRVF+QLVE+QKR+Q FKDLEAKKIIH+LDLD
Sbjct: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWXXXXXXXXXXXXXXXN 360
           L+SSMVSFFVKD+KVELF+KQNEIVSCSILD+IHDF+Q NK+KW               N
Sbjct: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 309/368 (83%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MSKIDDLQQD+                     ++KRKN+ S+NPI+QEFEDLF+QFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLN 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           NFLFNEHPEL++MDD+ +S+     PAT IPYEPKK+AKL NDENLPE EWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELEEMDDRGVSIASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQPMVQ 120

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180
           H+MFD +VADLLDT+ILTSPSKRKRKL +E+IN+ DK  LEDSI++EN+YR+FGITFFPL
Sbjct: 121 HQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFFPL 180

Query: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDPIDLK+KD SDEI VDREMLGIRLEVF+ERTSKFEKPHYILLKKRIKSNSWFLFKHT+
Sbjct: 181 VDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKHTV 240

Query: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300
           PS+IDVQ IF+DTNGGLV+S DDAYLFAKRVF+QLVEIQKRQQ FKDLEAKKIIH+L+LD
Sbjct: 241 PSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLD 300

Query: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWXXXXXXXXXXXXXXXN 360
           L+SSM SFFVKDVKVELF+KQNEIVSCSILD+IHDF+  NKNKW               N
Sbjct: 301 LESSMASFFVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 306/368 (83%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MSKIDDLQQD+                     ++KRKNQ STNPIIQEFE+LFDQFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           NFLF+EHPELD+ DDKD S      PAT   +EPKK+AKL+NDEN+ E EWVL+TQPMVQ
Sbjct: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180
           H+MFDS VADLLDT+ILTSPSKRKRKL + +I+TSD++ LEDSII+EN+YRMFGITFFPL
Sbjct: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180

Query: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDP DLK+KD SDEI VDREMLGIRLEVF+ER SKFEKPHYILLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300
           PS+IDVQ IFN+TNGGLVIS D+ YLFAKRVF+QLVEIQKRQQ FKDLEAKKIIH+LDLD
Sbjct: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWXXXXXXXXXXXXXXXN 360
           LQSSMVSFFVKDVKVELF+KQNEIVSCSILDEIHDF++KNK+KW               N
Sbjct: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSF+TIF+
Sbjct: 361 HSFSTIFR 368

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  270 bits (691), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 149/353 (42%), Positives = 219/353 (62%), Gaps = 27/353 (7%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKR----KNQSSTNPIIQEFEDLFDQF 56
           M +++DL+QD+                     RDKR    + + +TN +IQEFE +F++F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 57  PQLNNFLFNEH-PELDDMDDKDISMV------------LKSTPATSIPYEPKK-KAKLEN 102
           PQL + L+N++ P+  D DD D + V             +S  AT+ P +  K KA  + 
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 103 ---DENLPEHEWVLKTQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSM 159
              DE+LPE EWVLK Q  ++H+MFD  V DLLDT+IL+SPSKRKR       + +D S 
Sbjct: 121 NRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKRN---PAQHGADTSR 177

Query: 160 LEDSIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKP 219
           L + I+LEN YR+FGIT+FP+VDP DL++   + ++V+ REMLG+R +VFN++ SKFEKP
Sbjct: 178 LHEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKP 237

Query: 220 HYILLKKRIKSNSWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQ 279
            Y+LLKK +K+  W +FKHTIP  IDV ++F+   GGL  S +D YLF+K V+V+LV+  
Sbjct: 238 FYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSS 297

Query: 280 KRQQSFKDLEAKKIIHNLDLDLQSSMVSFFVKD---VKVELFLKQNEIVSCSI 329
            R + F  L+ + +I +L  DL+S+ VSF       + V+L ++ NE+VS  +
Sbjct: 298 LRLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKLTIQNNEVVSVYV 350

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  266 bits (681), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 222/350 (63%), Gaps = 38/350 (10%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MS I++L+QD+                        R+ +   N +++EFE+LF QFPQL 
Sbjct: 1   MSNIEELEQDIASL---------------------RREKQPANTVMREFEELFQQFPQLR 39

Query: 61  NFLFNEHPE------LDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLK 114
           + L+ E+        L+ + D+++    + TP+       +K+ K ++ +NLPE EWVL+
Sbjct: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQ-TPS-------RKRPKTKSSDNLPEDEWVLQ 91

Query: 115 TQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEE---INTSDKSMLEDSIILENIYR 171
            Q  ++H +FD  V D+LDTEIL+SPSKR+++LN ++   I       L D I++ENI+R
Sbjct: 92  NQVPLEHNLFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFR 151

Query: 172 MFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSN 231
           +FGITFFP+VDP DL+M   + E+   REMLGIRL++F+E + K++KP YILLKK+IKS+
Sbjct: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211

Query: 232 SWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAK 291
           +W +FKHTIPSYI V+ IF + + GL IS +D YLF+K +++QL++   R+   K  E K
Sbjct: 212 TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEK 271

Query: 292 KIIHNLDLDLQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNK 341
            +I NL + L S+ VSF +   ++EL+L+ N I+SCS +  I D + ++K
Sbjct: 272 GLISNLRISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASVRSK 321

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  266 bits (681), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 142/339 (41%), Positives = 210/339 (61%), Gaps = 16/339 (4%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MS+++DLQQD+                     R    ++ + +P+++ F+ +F QFPQL 
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           + L  E     +   +D  + LK    T +   PKK      D             P+ Q
Sbjct: 61  DVLSEETTARHEESTQD-PISLKRKRNTDV-NSPKKDKSFRGDH-----------PPVFQ 107

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180
           H+MFD  +A  +DT ILTSPSK +R++   +    D+    + ++LEN+YRMFGIT+FP+
Sbjct: 108 HQMFDESIAQFIDTNILTSPSKARRRM---KDTKYDEDAPRNQVLLENVYRMFGITYFPV 164

Query: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDP DLK+   +++  ++REM+GIRLEVFNE  ++FEKP+YILLKK+IKS+SW LFKHT+
Sbjct: 165 VDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKHTV 224

Query: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300
           P +IDV A+FN TNGG +IS ++ YLFAK V+ QL+E+  R Q+ +DL +  +I NLDLD
Sbjct: 225 PIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLD 284

Query: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQK 339
           L+++ VSF   +V+  L L +++IVSCS++ E  D N K
Sbjct: 285 LEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVK 323

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  250 bits (638), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 200/303 (66%), Gaps = 23/303 (7%)

Query: 48  EFEDLFDQFPQLNNFLFNEHPELD----DMDDKDISMVLKSTPATSIPYEPKKKAKL--- 100
           +F D+F++ P L + L     E+D    D+DD +I           IP  P+KK++    
Sbjct: 49  DFNDIFEKNPGLRDLLLGY--EIDKSATDVDDTNI-----------IPVTPQKKSRSSVV 95

Query: 101 -ENDENLPEHEWVLKTQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSM 159
            E   +LPEHEWVLKTQP+V+H++FD  V D++DT+IL SPSKRK+K+     N++ K +
Sbjct: 96  NEKLHSLPEHEWVLKTQPLVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGK-V 154

Query: 160 LEDSIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKP 219
            ++ I  ENIYR+FGI++FPLVDP DL     +++++V R+MLGIR ++FNE +  FEKP
Sbjct: 155 SKEPIQYENIYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKP 214

Query: 220 HYILLKKRIKSNSWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQ 279
           HYILLKK  KS+ W LFK+T+P+YIDV+ IF +  GGL+ + DD YLFAK +++ LVEI 
Sbjct: 215 HYILLKKSAKSDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIV 274

Query: 280 KRQQSFKDLEAKKIIHNLDLDLQSSMVSFFVKD-VKVELFLKQNEIVSCSILDEIHDFNQ 338
            R + F  LE   II +LD+DLQS ++   ++   K+E  + Q  I++C+I  +I   ++
Sbjct: 275 IRSELFLQLEKDGIIDDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKIMSDDE 334

Query: 339 KNK 341
           K +
Sbjct: 335 KER 337

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  239 bits (610), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 212/353 (60%), Gaps = 14/353 (3%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MS +D+L+QD+                      +   N     P++QEF  LF+QFP L 
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
             L  E  +  +M  K     +  T   +   + K+   L +D+N+PEHEW+L  QP+++
Sbjct: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEA--NKRKQSEHLNDDDNMPEHEWILNKQPIIE 118

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSM----------LEDSIILENIY 170
           HK+F S++++ ++T+ILTSPSKRK+ +   EI  +D +M          LE  II EN +
Sbjct: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178

Query: 171 RMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKS 230
           R+FGI++FP+VDP DL    S++E+   REM+GIRLEVF++    FEKPHYILLKK+ KS
Sbjct: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238

Query: 231 NSWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEA 290
           N+W LFK+TIP+YID+  IF   N G++++ +D Y+FAK+V++QL+ IQ R+++   L+ 
Sbjct: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298

Query: 291 KKIIHNLDLDLQSSMVSFFV--KDVKVELFLKQNEIVSCSILDEIHDFNQKNK 341
             I+ ++ +DL   ++   +     K+ L+L+++++ S SI  E  D + + +
Sbjct: 299 ANIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIHSQKR 351

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  229 bits (584), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 198/335 (59%), Gaps = 7/335 (2%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           MS + +L+QDV                      +    + +  PI ++FEDLF   PQL 
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
           + L ++  +             +    TS     K+    E D ++ E EW+LK+QP+VQ
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGKHMTS-EISNKRVKPNEQDTDISEDEWILKSQPLVQ 119

Query: 121 HKMFDSDVADLLDTEILTSPSKRKRKL-NLEEINTSDKSM----LEDSIILENIYRMFGI 175
           HKMF+S ++D+++T+ILTSPSKRK KL N+++ + + K      L   I +EN++R+FGI
Sbjct: 120 HKMFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRLFGI 179

Query: 176 TFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFL 235
           TFFPLVDP DLKM      + + REMLGIRLE++NE  S FEKPHYILLKK++K +SW +
Sbjct: 180 TFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDSWMI 239

Query: 236 FKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIH 295
           FKHTIPSYID+++ +   N G++ + D+  +FAK V+++L+    R+Q  + L   + I 
Sbjct: 240 FKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTELEYIR 299

Query: 296 NLDLDLQSSMVSFFVKD-VKVELFLKQNEIVSCSI 329
           +   D+ SS V   + D  ++ELFLK   IVSC I
Sbjct: 300 DCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKI 334

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  229 bits (583), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 194/321 (60%), Gaps = 20/321 (6%)

Query: 34  DKRKNQSSTNPIIQ----EFEDLFDQFPQLNNFLFNEHPELDDMDDKDISMVLKSTPATS 89
           ++ +++S   P+I+    E+  +F+ FP L+  L  +  + +     D + +  STP  S
Sbjct: 40  ERLRHESEKVPVIELTTDEYGPIFEAFPHLHKLLSEKLFQQESNRGHDNTAL--STPKKS 97

Query: 90  IPYEPKKKAKLEN-DENLPEHEWVLKTQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLN 148
               P+K+   +    ++PEHEWVL+ QP V+HKMFDSD+ADL+DTEILTSPSKRK KL+
Sbjct: 98  TTISPRKRVVNQVLPPSMPEHEWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLS 157

Query: 149 LEEINTSDKSMLEDSIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEV 208
               N   K  L D + LEN+YRM GIT FP+VDP DLK+   + E  + REM+G+RLEV
Sbjct: 158 KVHNN---KQNLIDYVRLENVYRMTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEV 214

Query: 209 FNERTSKFEKPHYILLKKRIKSNSWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFA 268
           FNE  S FEKP+Y+LLKK  K +SW +FKHTIP+YID+Q +F  TNGG++      YLFA
Sbjct: 215 FNEVLSTFEKPYYVLLKKSSKRDSWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFA 274

Query: 269 KRVFVQLVEIQKRQQSFKDLEAK-KIIHNLDLDLQSSMVSFFVK----DVKVELFLKQNE 323
           K+V+  L++   + Q F+ L  +   I  ++ DL  ++VSF V       K  L +  N 
Sbjct: 275 KKVYQLLLQTSLKAQVFEVLAREDSRISQIESDLAVNVVSFKVSFKNLSFKTVLQMDWNN 334

Query: 324 IVSCSILDEIHDFNQKNKNKW 344
           +   SI       N ++  +W
Sbjct: 335 VHGASI-----KLNSEHVRRW 350

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  220 bits (561), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 130/334 (38%), Positives = 201/334 (60%), Gaps = 31/334 (9%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           M  +++L+QD+                      +K  ++ S +P+++EFE +F +FP+L 
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120
             L  E+ ++ D +D D S      P+T +     K+ KLE  +              VQ
Sbjct: 61  EVLAREN-QIVDSNDNDTS----DEPST-VDSSFVKRRKLEFSDG------------SVQ 102

Query: 121 HKMFDSDVADLL-DTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFP 179
           +KMFD  +ADLL DT   TSP KR+ KL        +   LE  + +EN YR+FGITFFP
Sbjct: 103 NKMFDKSIADLLGDTSSSTSPGKRRSKLQ-------NFKGLESQVSIENAYRLFGITFFP 155

Query: 180 LVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHT 239
           LVDP D+  + +     ++R+MLGIRLEVFNE   +FEKPHYILLK+ +K NSW LFKHT
Sbjct: 156 LVDPSDINFQRND----INRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHT 211

Query: 240 IPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDL 299
           IP++ID+++IF   + G++ + D  YLFAK+V++QL+ + +R Q  ++L+  ++I NL++
Sbjct: 212 IPAFIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEI 271

Query: 300 DLQSSMVSFFVKDVK-VELFLKQNEIVSCSILDE 332
           DLQ + VSF ++ +K V LFL+ ++++SC   D+
Sbjct: 272 DLQIAAVSFDIQGMKRVRLFLQDDQVISCDTFDD 305

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  199 bits (505), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 171/279 (61%), Gaps = 19/279 (6%)

Query: 63  LFNEHPELDDMDDKDISMVLKSTPATSIPYE-PKKK------AKLEN-DENLPEHEWVLK 114
           LF ++PEL     + I     S P T  PY  PKK+      A+L N   ++PE EWVLK
Sbjct: 49  LFQKNPELKHTLSQKIFKETDSFPQT--PYSSPKKRPLKSSAAQLSNLSPDIPESEWVLK 106

Query: 115 TQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFG 174
           TQ  V+HK FDS VADL++T+ILTSPSKRKR        +     L   + +ENIYRM G
Sbjct: 107 TQVPVEHKFFDSAVADLIETDILTSPSKRKRA-----AQSRAHEELVQKVQIENIYRMLG 161

Query: 175 ITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWF 234
           I+ FP+VDP DL+  +  DEI + R+MLG+RLE+FNE    FE P+YIL K+  K++ W 
Sbjct: 162 ISTFPVVDPSDLEGTEE-DEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWN 220

Query: 235 LFKHTIPSYIDVQAIFNDT-NGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKI 293
           +F+HT+PSY+ V+ +F    + GL+ +  + Y FAK+V+  L+ I  + Q F+  E K+ 
Sbjct: 221 IFRHTVPSYVGVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEA 280

Query: 294 IHNLDLDLQSSMVSFFVKDVK--VELFLKQNEIVSCSIL 330
           I  L++D   + VSF ++ +   V+L L   ++++CS +
Sbjct: 281 ISQLEIDPSCTSVSFHIEKLGCFVKLKLDATDVIACSCI 319

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  198 bits (503), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 148/215 (68%), Gaps = 1/215 (0%)

Query: 116 QPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGI 175
           Q  ++HK+FD +++ LL  E+++ PS+R++++ LE  N   + +L++ +ILE +YRM GI
Sbjct: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161

Query: 176 TFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFL 235
           TFFP+VDP DL+  D+   + + REMLGIRLE++N+  S FEKPHYILLK+  KS  W +
Sbjct: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221

Query: 236 FKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIH 295
           FK+TIP+YID+ ++F   N G++ +  D +LFAK V+  L  I K+ Q FK LE  K+  
Sbjct: 222 FKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFE 281

Query: 296 NLDLDLQSSMVSFFVKDV-KVELFLKQNEIVSCSI 329
           NL++DL    +SF  K +  + + LK+ +I++C+I
Sbjct: 282 NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTI 316

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  161 bits (408), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 133/218 (61%), Gaps = 8/218 (3%)

Query: 123 MFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPLVD 182
           MFD  +A  LDTE+L SPSKR + L+      S +  L + I +EN YRM GITFFPLVD
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRP-EQSKQRELRNFIEVENCYRMCGITFFPLVD 59

Query: 183 PIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIK-SNSWFLFKHTIP 241
           P  L  +D  +E +V+ EMLGIRLEVFNE T +F+ P+Y+LL++  K +  W LFKHT+P
Sbjct: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118

Query: 242 SYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLDL 301
             +D + I++ T  G + S  D YLFAK+ + +L+++  R Q    L+   +  N+  D 
Sbjct: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLD-PYLFENIRTDS 177

Query: 302 QSSMVSFFVKD----VKVELFLKQNEIVSCSILDEIHD 335
            ++M+SF +      + V + L+  E+ SC +  + HD
Sbjct: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD 215

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  161 bits (408), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 133/221 (60%), Gaps = 5/221 (2%)

Query: 119 VQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFF 178
           V+H+MFD  +A   DTEI+ SPSKR + +     +    + LE  + +EN YRM GITFF
Sbjct: 5   VEHRMFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGITFF 64

Query: 179 PLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNS-WFLFK 237
           PLVDP  L      D   +  E+LGIRLEVFNE T K+E P+YI+LK+R K+N  W L+K
Sbjct: 65  PLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYK 124

Query: 238 HTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNL 297
           HTIP  ID++ I++ T  G++    + Y+FAK+ +++L+ I  R Q   +L+  ++  N+
Sbjct: 125 HTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDP-QLFENI 183

Query: 298 DLDLQSSMVSFFVKD---VKVELFLKQNEIVSCSILDEIHD 335
            +D  + M+SF +     + V   L+   I+ C I  E H+
Sbjct: 184 KVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDIDIERHN 224

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  160 bits (406), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 126/212 (59%), Gaps = 15/212 (7%)

Query: 123 MFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPLVD 182
           MFDS VADL +T+ILTSPSKRK+      +N+     L   + +EN+YR  G++ FP+VD
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKK-----VVNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55

Query: 183 PIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242
           P D++ +D   E +  R M+G+RLE+FNE    FE PHY+L K+ +K+  W +F+HTIPS
Sbjct: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114

Query: 243 YIDVQAIFNDTNGGLVISP----DDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLD 298
           Y+ V+ +F  T     I+P       Y F K+V+  L+ I  +QQ+FK L    I+  L 
Sbjct: 115 YVGVERLFEQTK---TINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLV 171

Query: 299 LDLQSSMVSF--FVKDVKVELFLKQNEIVSCS 328
           +D   +  SF      V V+L L + +I +CS
Sbjct: 172 IDPSCTSASFQMMQGSVSVKLKLSETDITACS 203

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  160 bits (405), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/303 (35%), Positives = 164/303 (54%), Gaps = 54/303 (17%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60
           M++I DL+QD+                     + K ++ S+++PI+ E  DL  QFPQLN
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLEND----------------- 103
             L ++              V +S+ +TS   E  KK KL+N+                 
Sbjct: 61  EILLSK------------PSVTESSRSTSNEEESDKKRKLDNEKIQAFQDAKKSKLNNEN 108

Query: 104 ENLPEHEWVLKTQPMVQHKMFDSDVADLLDTEILTSPSKRKRKL-NLEEINTSDKSMLED 162
           ++LPEHEWVLK Q  V+HKMFD+ VAD+L+TE+L+SPSKR+  L N ++    +K + ++
Sbjct: 109 DDLPEHEWVLKNQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKE 168

Query: 163 SIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYI 222
             +LEN++R+ GI+FF  VDP DL           + +M+GIRL+ FN+ +    K +YI
Sbjct: 169 YRLLENVFRIVGISFFDAVDPNDL-----------ESDMIGIRLDPFNQPS----KVYYI 213

Query: 223 LLKKRIKSNS---WFLFKHTIPSYIDVQAIFNDTNGGL------VISPDDAYLFAKRVFV 273
           +LKK  K+N    W + KHTIP YI+V   F ++          + + DD YL AK V+V
Sbjct: 214 ILKKEAKNNREGLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYV 273

Query: 274 QLV 276
           +L+
Sbjct: 274 KLL 276

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  147 bits (372), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 155/283 (54%), Gaps = 18/283 (6%)

Query: 1   MSKIDDLQQDVXXXXXXXXXXXXXXXXXXXXXRDKRKNQS-STNPIIQEFEDLFDQFPQL 59
           MS I DL+QD+                     +D +K+ S +     ++ + L DQFPQL
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKDIQKDTSIAETNADRQLQSLLDQFPQL 60

Query: 60  NNFLFNEH------PELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVL 113
           ++ L +++      P L +  + D S++ +   +       K K +L    NLPEHEWVL
Sbjct: 61  HDILLSDNAIDKSSPVLHNNGEDDTSLLSRKRKSEHGSPNTKHK-RLSLSANLPEHEWVL 119

Query: 114 KTQPMVQHKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMF 173
           K QP ++HKMFD+ VAD+L T+IL+SPSKR  +    + +   +++    I+LE+ Y+  
Sbjct: 120 KMQPPIEHKMFDTSVADVLGTDILSSPSKRIIETKERQSDNLQRTL----ILLEDFYKKL 175

Query: 174 GITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSW 233
           G+ F  L DP DL+M +  + + +  +MLG+R E+    +S+  + +Y+LLKK   S+ W
Sbjct: 176 GVNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFEL---PSSEGAQKYYLLLKKETASDYW 232

Query: 234 FLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLV 276
             +KH++P+ IDV   F +       S +D YL AK +++QL+
Sbjct: 233 IPYKHSLPNIIDVNEYFVNVAAE---SHEDIYLIAKDIYLQLL 272

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 90/184 (48%), Gaps = 29/184 (15%)

Query: 160 LEDSIILENIYRMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKP 219
           + D +  EN  R+ G++ FP+          + D I    E +GIRLE+F+E + K++ P
Sbjct: 107 ITDFVQWENSVRLIGVSLFPV----------NYDNI----EFMGIRLELFDELSLKYDPP 152

Query: 220 HYILLKKRIKS-NSWFLFKHTIPSYIDV----QAIFNDTNGGLVISPDDAYLFAKRVFVQ 274
            Y++LK  +K    W LFKH +P YI++    Q I  DT+     S  +   FA   +  
Sbjct: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKD 208

Query: 275 LVEIQKRQQSFKDLEAKKI----IHNLDLDLQSSMVSFFVKD--VKVELFLKQNEIVSCS 328
           L+++  R Q F+ LE   +       L +D     VSF +    +K+++    +EI+ C+
Sbjct: 209 LLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIKVDDGDDEIIDCT 268

Query: 329 ILDE 332
              E
Sbjct: 269 FNGE 272

>KLLA0A10703g Chr1 complement(929877..931715) [1839 bp, 612 aa] {ON}
           some similarities with uniprot|Q08157 Saccharomyces
           cerevisiae YOL019W Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cell periphery and vacuole
          Length = 612

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 53  FDQFPQLNNFLFNEHPELD------DMDDKDISMVLKSTPATSIPYEPKKKAKLENDENL 106
           +   P  ++FL   +PE           +   S  L S PA+S+ Y+P  + +L    NL
Sbjct: 537 YSAGPSASDFLLQSNPEFSIGTGPASYGNSQRSAGLNSAPASSMHYKPAYRKRLPRKNNL 596

Query: 107 PEHEWVLKTQPM 118
           P H    +T PM
Sbjct: 597 PLHP-CQETVPM 607

>TDEL0G04670 Chr7 (853039..854760) [1722 bp, 573 aa] {ON} Anc_6.4
           YPL269W
          Length = 573

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 57  PQLNNFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQ 116
           PQ NNF       +  M+ K +  ++K TP +++   P  +     + N+P    +LKT 
Sbjct: 422 PQRNNF---GALLMKKMNIKPV--IIKGTPQSAVKVNPFYEKSPTKERNMPTEGLILKTA 476

Query: 117 PMVQHKMFDSDVADLLDT-EILTSPSKR 143
           P++ +    S   D+ +  E  +SP+ R
Sbjct: 477 PLLPYSSQHSSAEDIFEAFETSSSPTSR 504

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 91  PYEPKKKAKL-ENDENLPEHEWVLKTQPMVQHKMFDSDVADLLDTEILTSPSKRKR-KLN 148
           P  P+ +  L E ++   E E ++   P  QH   D +V D  + EILTSPS+R    L+
Sbjct: 740 PMPPRHEQLLKEGEKQKREEELLIAFSPPKQHG--DQNVGDRPNPEILTSPSRRGNLDLS 797

Query: 149 LEEINTSDKSMLED 162
             E++ S + +++D
Sbjct: 798 YNEMDFSQEDLMKD 811

>KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} similar
           to uniprot|Q99287 Saccharomyces cerevisiae YOR165W SEY1
           Synthetic Enhancement with YOP1
          Length = 783

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%)

Query: 183 PIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242
           P+DL  ++ SD     +E+  + L+ ++   S++ KP Y+  ++ +       FK TI  
Sbjct: 319 PVDLHCRELSDLAGKLQELKSLCLQEYDTYASRYAKPVYMDNRRDLSHKIENKFKETISK 378

Query: 243 YIDVQ 247
           ++DVQ
Sbjct: 379 FLDVQ 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,287,971
Number of extensions: 1878647
Number of successful extensions: 7188
Number of sequences better than 10.0: 80
Number of HSP's gapped: 7419
Number of HSP's successfully gapped: 81
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)