Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.4865.348ON41541522200.0
Skud_4.5835.348ON41541517790.0
Smik_4.5765.348ON41541016690.0
YDR317W (HIM1)5.348ON41441016270.0
TDEL0E027905.348ON4114186484e-80
ZYRO0F00550g5.348ON4153846293e-77
Kpol_1051.45.348ON4264225502e-65
CAGL0H07161g5.348ON4244175267e-62
Kwal_34.159895.348ON5064584374e-48
KLTH0H14784g5.348ON5144524095e-44
TPHA0D020605.348ON4964714042e-43
Ecym_81855.348ON4713973935e-42
AGR348W5.348ON5422323808e-40
SAKL0G08910g5.348ON5054533692e-38
KAFR0C018805.348ON3453053471e-36
TBLA0A031005.348ON3721832744e-26
KLLA0B10120g5.348ON3482772621e-24
KNAG0L00930singletonON2291531112e-05
YER004W (FMP52)7.148ON2311731085e-05
TBLA0F033107.148ON1611731039e-05
TBLA0A105007.148ON2371781032e-04
Kwal_47.188627.148ON224179997e-04
Ecym_44797.148ON224104988e-04
Smik_5.1187.148ON23174970.001
Suva_5.917.148ON22974960.002
Skud_5.1037.148ON227128910.007
NCAS0E02080singletonON225207900.010
NCAS0E020907.148ON225130890.011
KLTH0H00264g7.148ON22272890.013
ZYRO0D09548g7.148ON225143820.092
Suva_6.2341.192ON452125760.77
Kpol_1018.175singletonON81695722.4
Kpol_387.87.274ON94462697.0
YGL001C (ERG26)4.126ON34941678.2
Suva_7.2814.126ON34950678.8
Ecym_21976.219ON50467679.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.486
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   859   0.0  
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   689   0.0  
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   647   0.0  
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   631   0.0  
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   254   4e-80
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   246   3e-77
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   216   2e-65
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   207   7e-62
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   172   4e-48
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   162   5e-44
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   160   2e-43
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   155   5e-42
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   150   8e-40
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   146   2e-38
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   138   1e-36
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   110   4e-26
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...   105   1e-24
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               47   2e-05
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    46   5e-05
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    44   9e-05
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    44   2e-04
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    43   7e-04
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    42   8e-04
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    42   0.001
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    42   0.002
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    40   0.007
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      39   0.010
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      39   0.011
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    39   0.013
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    36   0.092
Suva_6.234 Chr6 (419509..420867) [1359 bp, 452 aa] {ON} YJL155C ...    34   0.77 
Kpol_1018.175 s1018 complement(444710..447160) [2451 bp, 816 aa]...    32   2.4  
Kpol_387.8 s387 complement(17142..19976) [2835 bp, 944 aa] {ON} ...    31   7.0  
YGL001C Chr7 complement(495453..496502) [1050 bp, 349 aa] {ON}  ...    30   8.2  
Suva_7.281 Chr7 complement(487068..488117) [1050 bp, 349 aa] {ON...    30   8.8  
Ecym_2197 Chr2 (388255..389769) [1515 bp, 504 aa] {ON} similar t...    30   9.3  

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/415 (100%), Positives = 415/415 (100%)

Query: 1   MTNINNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNK 60
           MTNINNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNK
Sbjct: 1   MTNINNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNK 60

Query: 61  HIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF 120
           HIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF
Sbjct: 61  HIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF 120

Query: 121 EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWP 180
           EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWP
Sbjct: 121 EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWP 180

Query: 181 KLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVD 240
           KLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVD
Sbjct: 181 KLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVD 240

Query: 241 YHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELII 300
           YHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELII
Sbjct: 241 YHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELII 300

Query: 301 LRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEV 360
           LRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEV
Sbjct: 301 LRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEV 360

Query: 361 IASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           IASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA
Sbjct: 361 IASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/415 (77%), Positives = 373/415 (89%)

Query: 1   MTNINNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNK 60
           M++  + FTD ILLFGSSGLAG+GTLENLLDINFYIKNVSDLQDKLDSL EI E+VVLNK
Sbjct: 1   MSDNISVFTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIKEDVVLNK 60

Query: 61  HIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF 120
           H+FCINR++VTEQKSF+KTIDYVNMKSI WKGGRYYLRSR  N+  RET +++TF YD+F
Sbjct: 61  HVFCINRRNVTEQKSFLKTIDYVNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNF 120

Query: 121 EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWP 180
           EEG IR +  + +KG FSFAYN+KQFSY+LHYAC K+ESFGIKYNF VTQL+IP S SWP
Sbjct: 121 EEGFIRGAAYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWP 180

Query: 181 KLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVD 240
           +LL  +FS  QKLE+FD+D++ YV+DKSLP+L  IGTMVC LGS++ARVR++QVPNSFVD
Sbjct: 181 RLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVD 240

Query: 241 YHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELII 300
           YHL F+LAQEF NTT+K+LVV+TSFNND L RTFEYFRIKAKLENDLEEALPNKLKEL+I
Sbjct: 241 YHLVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVI 300

Query: 301 LRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEV 360
           LRPGPMCGQHG+PV+V++D+Q+NPT SER  YYPRY+LKYK+Q ISE RKVGLRT+LSE+
Sbjct: 301 LRPGPMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSEL 360

Query: 361 IASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           IASSIYRMPGSALLGYSVPVSKVSYV SL AIEK+SKEAGPKVE+INSYQIDMIA
Sbjct: 361 IASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKRSKEAGPKVEMINSYQIDMIA 415

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/410 (74%), Positives = 356/410 (86%)

Query: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCI 65
           NAFTD ILLFGSSGLAGKGTLEN+LDINFYIKNVSDLQDKL+SLTEI  +VVLNKH+FCI
Sbjct: 6   NAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNKHVFCI 65

Query: 66  NRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGII 125
           NR+S+TE+KSF+K+IDY+NMKSI WK GRYYLRSR ENETK+   N +TFCYD FEEG I
Sbjct: 66  NRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEEGFI 125

Query: 126 RNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPE 185
           + + D++ K  F   YN+K+FSYAL+YA GK E F I Y F VTQL+IP+S +W +LL  
Sbjct: 126 KKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSY 185

Query: 186 VFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSF 245
           +FSGTQKLE+FD +++ YV+ KSLP L  I TMVC LGS++ARVR++QVPNSFVDY L F
Sbjct: 186 IFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPF 245

Query: 246 NLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGP 305
           +LAQEFTNTTDK+LV+ITSFNN FLS TFEYFRIKAKLENDLEE LPNK KELIILRPGP
Sbjct: 246 SLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGP 305

Query: 306 MCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSI 365
           MCGQHGN + VE+D+Q+N T S++  YYPRY+L YK+Q ISEVRK+GLRT+LSE+IASS 
Sbjct: 306 MCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASST 365

Query: 366 YRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           YRMPGSALLGYSVPVSKVSYVASLMAIE+KSKEAGPK+EVINSYQIDMIA
Sbjct: 366 YRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/410 (70%), Positives = 357/410 (87%), Gaps = 1/410 (0%)

Query: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCI 65
           N FTD +LLFGSS L GKG LENLLDIN YIKNVSDLQ KLDSL+EI  NVVLNKH+FC+
Sbjct: 6   NTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEIKGNVVLNKHVFCV 65

Query: 66  NRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGII 125
           NR+ + E+KSF+KTIDY+NM+S+ W+GGRYYLRSR E +T++   + NTFCYD+FEEG I
Sbjct: 66  NRRCINEEKSFMKTIDYINMRSVTWQGGRYYLRSRKEKDTEKVPSSPNTFCYDNFEEGFI 125

Query: 126 RNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPE 185
           +N+ ++  K  +SF YN+KQFSY LHYACGK++   I  NF VTQL+IP+S +WPKLLP 
Sbjct: 126 KNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWPKLLPR 185

Query: 186 VFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSF 245
           +FSGTQKLE+FD+D+++YV  +SLP+L  I TMVC+LGS++ARVR++QVP+SF DY+L F
Sbjct: 186 IFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPF 245

Query: 246 NLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGP 305
           NLAQEFTNTT+K+LVV T+FNNDFLS+TFEYFRIKAKLENDL+EALPNKLKEL+ILRPGP
Sbjct: 246 NLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGP 305

Query: 306 MCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSI 365
           MCGQHGNP++VE+  ++N T  E+ FYYP Y+L YK++ ISE R++GLRT+LSE+IASSI
Sbjct: 306 MCGQHGNPINVELG-KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEIIASSI 364

Query: 366 YRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           YRMPGSALLGY+VPVSKVSYVASLMAIE+KSKEAGPK+EVI+SYQIDMI 
Sbjct: 365 YRMPGSALLGYAVPVSKVSYVASLMAIERKSKEAGPKLEVISSYQIDMIV 414

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  254 bits (648), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 147/418 (35%), Positives = 228/418 (54%), Gaps = 25/418 (5%)

Query: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEIN-ENVVLNKHIFCIN 66
           + D  L FGSSGL G  TL+ LL  + Y+ N  ++Q +L++   +N  N   NK I+CIN
Sbjct: 7   YNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYCIN 66

Query: 67  RKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGIIR 126
           RK +  +   +    Y+       K  +    S  + + + E   S            + 
Sbjct: 67  RK-IGYKNILLDNEQYL-------KADKLAPISFNKADYRFEKITSICPSVKKHSNQSLV 118

Query: 127 NSMDKDKKGTF---------SFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQST 177
           N++  D+ GT             Y+R   +Y + Y     +   I +NF++ Q+  P S+
Sbjct: 119 NNVS-DESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSS 177

Query: 178 SWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNS 237
            W +LLP++FSG   L R + +  D  ++K LP L+ I TM+C LG+ +   R+S+    
Sbjct: 178 KWCELLPDIFSGCVAL-RSEAEP-DGTTNK-LPPLDEIPTMICTLGAGS---RQSKAKRH 231

Query: 238 FVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297
           +VDY L+F LAQ F N   K+LV++T+FNN  +     YFR K+KLENDL+  L  +L +
Sbjct: 232 YVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGK 291

Query: 298 LIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRL 357
           L++LRPGP+ G+HG P+   + I  +  + ++  YY  Y  + K     E R++G RTR 
Sbjct: 292 LVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRA 351

Query: 358 SEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           SE+IA ++YR PGS +LGY +P +K +YVA+  A ++ S EA   VE+I S Q+D IA
Sbjct: 352 SELIARTMYRKPGSWMLGYCIPATKAAYVAASKATDEASDEASDPVEIITSEQMDHIA 409

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  246 bits (629), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/384 (35%), Positives = 219/384 (57%), Gaps = 13/384 (3%)

Query: 5   NNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSL--TEINENVVLNKHI 62
           + +F D ILLFGS+GL G  TLE LL +  Y+   +DLQ KL+    ++IN +  LNK  
Sbjct: 10  HQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDIN-HFTLNKFF 68

Query: 63  FCINRKSVTEQKSFIKT--IDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF 120
           +C+NRK   E++S      ++      ++++G  YYL +           ++ +   + F
Sbjct: 69  YCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVF 128

Query: 121 EE-GIIRNSMDKDKKG-TFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTS 178
           EE G I+ +   D +  T  F   RK  SY L Y     ++  I ++F + QLV   ST 
Sbjct: 129 EEDGTIQLTKTVDNRSVTLRFRQTRK--SYQLEYISKDLKNLLITFHFTIVQLVFEDSTR 186

Query: 179 WPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSF 238
           W  LLP +FSG  +L    V      +   LP L+ + TM+C LG +++  + S     F
Sbjct: 187 WADLLPSIFSGEVEL----VPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYF 242

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           V+Y L+F + Q F +  DK+LV++TSFNN  +S  F YF+ K +LENDL+  +   L +L
Sbjct: 243 VEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQL 302

Query: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358
           ++LRPGP+ G H N    ++ ++ +P+L E+  +Y  +  +YK+  + E+RK+G +T+ S
Sbjct: 303 VVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKAS 362

Query: 359 EVIASSIYRMPGSALLGYSVPVSK 382
           E++A ++YR PGS++LGY VP SK
Sbjct: 363 ELVAKAMYRKPGSSVLGYCVPASK 386

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  216 bits (550), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/422 (32%), Positives = 228/422 (54%), Gaps = 30/422 (7%)

Query: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEIN--------ENVVLN 59
           F++ I + GS+GL  K  L +LLDINFY+ N ++++ KL+  ++I           + + 
Sbjct: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74

Query: 60  KHIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDD 119
           K+IFCINR+S T        ++ V +  I +K   Y L     ++T  ET   +++  ++
Sbjct: 75  KNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRL-----DKTPGETSYESSYLTNE 129

Query: 120 FEEGIIRNSMDKDKKGTFS-FAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTS 178
            E G     ++ D +  FS  ++  ++    L Y   +     I++   V  ++IP S  
Sbjct: 130 IESG----KINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQ 185

Query: 179 WPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSF 238
           WP LLP +F+    +E+ + D  + +    LP L +I TM+ +LG +  +    +     
Sbjct: 186 WPTLLPRIFNPATVIEKVE-DKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRA 244

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+  L Q F N  +KKLVVIT+FNN  +S+ F YF  K K+E  L+  L  KL +L
Sbjct: 245 IDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304

Query: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLS------ERFFYYPRYILKYKQQCISEVRKVG 352
           +ILRPGP+ G    P+   ++ + NP L       E+     +Y+L YK   + + R  G
Sbjct: 305 VILRPGPIVGV---PMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTG 361

Query: 353 LRTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEK--KSKEAGPKVEVINSYQ 410
           +  RL++++A ++YR PG+++LGY +P +KV+ VA+L AIE    S  + P V++I S Q
Sbjct: 362 IAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQIITSRQ 421

Query: 411 ID 412
           ID
Sbjct: 422 ID 423

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  207 bits (526), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 219/417 (52%), Gaps = 24/417 (5%)

Query: 7   AFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKL-DSLTEINENVVLNKHIFCI 65
            F  +ILLFGS+GL G    E LLD  FY+ +  +L++ L +++ E  ENV +   ++C 
Sbjct: 18  TFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLENVTIKTCLYCF 77

Query: 66  NRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRG-----ENETKRETCNSNTFCYDDF 120
           NRK       ++K+    +     + G +Y+  ++G     + +   ET N  TF     
Sbjct: 78  NRKIGEPLDKYLKSPSANSFGPFCFNGSQYHY-NKGTCVPLDIDQDIETSNDATF----- 131

Query: 121 EEGIIRNSMDKDK----KGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQS 176
            +G +    DK K    K   S  Y  K++ Y L Y   +     + + F   QL+I  S
Sbjct: 132 -DGFLYYK-DKGKNVTGKNPISGEYYGKEYMYYLEYMSAEGNLLKLNFIFNHIQLIIKNS 189

Query: 177 TSWPKLLPEVFSGTQKLERFDVDSRDYVSDKS-LPALNSIGTMVCALGSSAARVRKSQVP 235
            SWP ++P +FS   +   F    R+ +  K   P L+ I TM+  +G++  R + S   
Sbjct: 190 FSWPSVIPIIFSDEVEAISF----REKMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTT 245

Query: 236 NSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKL 295
            + +DY L+ +L + F+NT DK ++++TSFNN  +S    YF+IK KLE+ L  A+   L
Sbjct: 246 YNDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPL 305

Query: 296 KELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRT 355
           K L ILRPGP+ G+H +       I +N +L ER   + +  L+  +  + ++R  G+  
Sbjct: 306 KTLTILRPGPLVGRHSDIYPTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSI 365

Query: 356 RLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQID 412
           + SE++A + YR+PGS LLGY +P  KV+Y  S+ A++K   E  P   V+ S ++D
Sbjct: 366 KASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDKYLHEE-PLTRVVTSEEMD 421

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  172 bits (437), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 215/458 (46%), Gaps = 70/458 (15%)

Query: 5   NNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINE---------- 54
           +N   DS L+FG +GL G     NL     Y+   +DLQ K+ SL   ++          
Sbjct: 72  SNRTVDSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMR 131

Query: 55  --------------NVVLNKHIFCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSR 100
                         +V + K++FC  R+SVT ++  +  +D     SI +KG +      
Sbjct: 132 RTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKM----- 186

Query: 101 GENETKRETCN-SNTFCYDDF-EEGIIRNSMDKDKKGTFSFAYNRKQFSYALHYACGKD- 157
                    C+  N  C + F + G      D       +     ++F+Y L+Y   +D 
Sbjct: 187 --------VCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDV 238

Query: 158 ------ESFGIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPA 211
                  +  I+    +  +V   S  WP LL  +F          V   +     + P 
Sbjct: 239 HGETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPP 298

Query: 212 LNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEF----TNTTDKKLVVITSFNN 267
           L  I TMV +LGS +   +K ++   F DY L+  LA  F    T   +KK+V+ITSFNN
Sbjct: 299 LTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNN 358

Query: 268 DFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLS 327
            FLS T +YF+ K  LE DL   +   L +L++LRPGP+ G H + +       Q+P++ 
Sbjct: 359 LFLSSTSDYFQSKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTHQL-------QSPSII 410

Query: 328 ERFFYYPRY---ILKYKQQCIS-------EVRKVGLRTRLSEVIASSIYRMPGSALLGYS 377
           ++  + P     +LK+K+ CI        E+ +VG+RT+LSE++A   Y+   S LLG+ 
Sbjct: 411 DKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHV 470

Query: 378 VPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           VP  KV++VAS+ A+   S ++   VE+I S +I+ +A
Sbjct: 471 VPAYKVAFVASIRAVF--SPDSASFVELIKSDEIEKMA 506

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  162 bits (409), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 138/452 (30%), Positives = 209/452 (46%), Gaps = 63/452 (13%)

Query: 9   TDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCINRK 68
           TD++L+ G++GL G   L NL     Y+   +DLQ K+DSL   +       +IF     
Sbjct: 80  TDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIF----- 134

Query: 69  SVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSR----------GENETKRETCNSNTFCYD 118
            V + KS +  I  V  KSI      Y L  R          G + +   T     F   
Sbjct: 135 -VKKPKSPLCNI-LVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLI 192

Query: 119 DFEEGIIRNSMDKDKKGTFSFAYNR-----------KQFSYALHYACGKD-------ESF 160
             + GI R+   +     +  A              + FS+ L Y   +D        + 
Sbjct: 193 CGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHAL 252

Query: 161 GIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDV---DSRDYVSDKSLPALNSIGT 217
            +K N  V  ++   S  WP LL +VF G Q ++R  +      + +S    P+L  +GT
Sbjct: 253 MVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVGT 311

Query: 218 MVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEF----TNTTDKKLVVITSFNNDFLSRT 273
           +V ALGS+  + RKS +P  +VDY L+  LAQEF       T KK+VV+TSFN+  LS  
Sbjct: 312 LVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTV 371

Query: 274 FEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYY 333
             YF+ K KLE DL   + + +  L++LRPGP+ G H           Q P  + +F + 
Sbjct: 372 SNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNH-------TPHAQTPPATNKFTFL 423

Query: 334 PR---YILKYKQQC-------ISEVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKV 383
           P    +IL  K++C       + ++ KVGLR +LSE+ A   Y+ P   L+       KV
Sbjct: 424 PAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKV 483

Query: 384 SYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
           ++ A+  AI   S ++   VE+I S +I+ +A
Sbjct: 484 AFFAASRAI--YSPDSASFVELIKSDEIEKMA 513

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  160 bits (404), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 221/471 (46%), Gaps = 71/471 (15%)

Query: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQ-----DKLDSLTEINENVVLNKHI 62
           F+D+IL+ GS+GL G+  L++  D + YIK+  +L+      + DS T I E V + K  
Sbjct: 31  FSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKE-VTIKKTA 89

Query: 63  FCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLR--------SRGENE-------TKR 107
           + + RK  + +    KTI    +K +   G  +YL+          GE +       T +
Sbjct: 90  YSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTK 149

Query: 108 ETCNSNTF-------CYDDFEEGI-IRNS----MDKDKKGTFSFA--------------- 140
           +   + T              +GI +RN     + KDK   FS                 
Sbjct: 150 KMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQE 209

Query: 141 -------YNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKL 193
                  +N +Q+  +L +A    +   I ++  +  L    ST WP LLP +F    KL
Sbjct: 210 YSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKL 269

Query: 194 --ERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEF 251
              +  +++ D  ++K LP L+ +  M+ +LGS +   +     N  +DY L+ +L   F
Sbjct: 270 VPNKGLIENIDLTNEK-LPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF 326

Query: 252 TNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHG 311
            NT+DKK+++ITS N    +    Y   K  LE DL+  L NK+ EL+ILRPGP+    G
Sbjct: 327 NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLV---G 383

Query: 312 NPVHVEM------DIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSI 365
            P+  ++       +++N +  ++   Y R+   YK   +  ++  G     + ++A + 
Sbjct: 384 TPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTF 443

Query: 366 YRMPGSALLGYSVPVSKVSYVASL--MAIEKKSKEAGPKVEVINSYQIDMI 414
           YR PG++LLGY++P SKV+ V     + +  ++     KVE++ S  ID++
Sbjct: 444 YRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLL 494

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  155 bits (393), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 195/397 (49%), Gaps = 60/397 (15%)

Query: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCI 65
           N   D++++ GS+GL G   L+  +   +    + DL+              L K+I+C 
Sbjct: 96  NEKGDNVIILGSTGLTGSQVLKGCM-APWTSGVLYDLK--------------LTKNIWCF 140

Query: 66  NRKSVTEQKSFIKTIDY-VNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGI 124
           NR+        +KT+D+ ++     W     Y    GE    R+           ++  I
Sbjct: 141 NRR--------LKTVDFSISKLPPTWTAVVNY---GGEPHIIRK-----------YDLKI 178

Query: 125 IRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLP 184
            ++  +  K     F ++  QF + L      DE   +  N  V Q++   S  W K   
Sbjct: 179 KQHITEIGKLDGLEFQWD--QFDWELKLPT--DEVKNVTVN--VFQIIQNDSKKWDKTFS 232

Query: 185 EVFSGTQKL--ERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYH 242
           E+F+G +K   +R +V          LP+++ + T++  LGSS+   RK + P SFVDY 
Sbjct: 233 ELFTGNRKPLNDRIEV---------YLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283

Query: 243 LSFNLAQEFTNTTDKKL----VVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           L+ ++A+ F     K L    V++TSFNN  L     YFR K KLENDL   +P  L  L
Sbjct: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHL 342

Query: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358
            ILRPGP+ GQHG  + +   +     +  + + + R +LK K   +S+V+ VG   +++
Sbjct: 343 TILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVT 402

Query: 359 EVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKK 395
           E+IA + Y +PG+ ++GYS+P SKV+ +A+  A+ K+
Sbjct: 403 ELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKR 439

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  150 bits (380), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 136/232 (58%), Gaps = 12/232 (5%)

Query: 168 VTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAA 227
           V Q+V P S  WP L  ++F+G   +  F+  S  Y     +PA+  I T++  LGS++ 
Sbjct: 286 VVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY-----MPAVTEIETLISTLGSTSW 338

Query: 228 RVRKSQVPNSFVDYHLSFNLAQEFT----NTTDKKLVVITSFNNDFLSRTFEYFRIKAKL 283
             RKS+ P +FVDY L+  +A+ F       T K +V++TSFN+  L    +YFR K +L
Sbjct: 339 EARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRL 398

Query: 284 ENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQ 343
           ENDL   +P  L  L ILRPGP+ G+HG+   +         +  R + Y + +++ +  
Sbjct: 399 ENDLTYDVPG-LTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFN 457

Query: 344 CISEVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKK 395
            +++V++VG  T+++E++A + Y +PG+ ++GYS+P  +V+ +A+  A+ K+
Sbjct: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKR 509

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  146 bits (369), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 225/453 (49%), Gaps = 60/453 (13%)

Query: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINE----------- 54
           N  TDS LL G++GL G   L +L +   Y+   +D+QDK+  + E  +           
Sbjct: 70  NLLTDSYLLLGTTGLTGGIILNSLAEPWLYLGTTNDVQDKIQMMFEAGDLSSESNPPNVK 129

Query: 55  -----------NVVLNKHIFCINRK-SVTEQKSFIKTIDYVN---MKSIIWKGGRYYLRS 99
                      ++ + K++FC NRK ++ E  S   T +Y+N     SI +KG +Y+ + 
Sbjct: 130 RTFGQILRGEKSIEITKNLFCFNRKLALLEIPS---TPEYINDYWEYSIDYKGTKYHSKK 186

Query: 100 RGENETKRETCNSNTFCYDDFEEGIIRNS-----MDKDKKGTFSFAYNRKQFSYALHYAC 154
                      N+ +F     + G + NS      ++ +   F + +  ++   ++    
Sbjct: 187 -----------NNISFGVPTLKFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLR 235

Query: 155 GKDESFGIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNS 214
            + ++  I     V Q++ P S  WP LL   F  T       V  +   +    P+L+ 
Sbjct: 236 TRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDTDTNVALHVQGQ-VPTPMIFPSLSK 294

Query: 215 IGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTD-----KKLVVITSFNNDF 269
           + T+V ALGS+    +KS V   FVDY L+F +A+EFT  +      KK+VVITSFNN  
Sbjct: 295 VNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFA 354

Query: 270 LSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQ--NPTLS 327
           LS T  YF  K KLE DL   +P +L EL+ILRPGP+ G H  P  +  D  +  N  L 
Sbjct: 355 LSSTSPYFHTKLKLEQDLATRIP-ELDELVILRPGPLIGSH-TPEFIPGDPPKSTNGLLK 412

Query: 328 --ERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKVSY 385
                 YY +    +K+  +  V +VGL+T+++EV A  IYR   S + GYSVPV+KV+ 
Sbjct: 413 PLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSVPVAKVAV 472

Query: 386 VASLMAIEK---KSKEAGPKVEVINSYQIDMIA 415
           VA++  I+K     +  G +V++I S ++D++ 
Sbjct: 473 VAAIRTIQKIQNDPESGGIRVQLIKSDELDVMV 505

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  138 bits (347), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 158/305 (51%), Gaps = 20/305 (6%)

Query: 10  DSILLFGSSGLAGKGTLENLLDINFYIKN-VSDLQDKLDS-LTEINENVVLNKHIFCINR 67
           + IL FGSSGL G G+L NLL+ NF + N  ++  D ++S +     ++  +K I+C NR
Sbjct: 7   EHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVSGVYDIAFDKIIYCFNR 66

Query: 68  KSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGIIRN 127
               +   +    D+       + G +Y L +  E     E+     F  +D EE I   
Sbjct: 67  --TPQNIRYKYHSDFEKNSQFDFGGTKYTLSNNPEPNNSFESKGQLQFAINDVEERI--- 121

Query: 128 SMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPEVF 187
                        Y    +S    ++  +++   + YN    Q+V  +S  WP LLP +F
Sbjct: 122 ----------KIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILF 171

Query: 188 SGTQ--KLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSF 245
           +G    K+ R   D R +     L  +N I T+VC LG+S+A  +K  +  + +DY L++
Sbjct: 172 TGENEIKIARKRKD-RLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTY 230

Query: 246 NLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGP 305
           NL + FT T +KK++++TSFNN  +S  F YFR K +LENDL+  L   +KEL ILRPGP
Sbjct: 231 NLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGP 290

Query: 306 MCGQH 310
           + G+H
Sbjct: 291 IKGKH 295

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  110 bits (274), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 102/183 (55%), Gaps = 18/183 (9%)

Query: 162 IKYNFIVT--QLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYV-------SDKSLPAL 212
           IK N+I+   Q V+P+S +W ++LP +F  T  L      + +Y+       S+  LP L
Sbjct: 187 IKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKL 246

Query: 213 NSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSR 272
             I  M+C LG++    +K       +D+ L+F L+  F+N   KKLV++T+FNN  LS+
Sbjct: 247 EDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSK 300

Query: 273 TFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHG-NPVHVEMDIQQNPT--LSER 329
           TF YF +K +LE  L+  L   L EL+ILRPGP+ G H  NP   +  +  + T  L + 
Sbjct: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQL 360

Query: 330 FFY 332
           +FY
Sbjct: 361 WFY 363

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 9/64 (14%)

Query: 13 LLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINE--------NVVLNKHIFC 64
          + FGS+G+ G  TL NLL+IN Y++   D Q  +D+L +  +        ++ L K+IFC
Sbjct: 8  IFFGSTGMTGFTTLTNLLNINSYLQ-AKDPQSAIDNLPQDFQWQACDDSLDLYLVKNIFC 66

Query: 65 INRK 68
          INR+
Sbjct: 67 INRR 70

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score =  105 bits (262), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 135/277 (48%), Gaps = 36/277 (12%)

Query: 147 SYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSD 206
           S  + Y+    +   I  N  VT +  P ST W +++P                  +++D
Sbjct: 85  SNTISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMIPH---------------HIFIND 129

Query: 207 KSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTN--TTDKKL---VV 261
            S        +++  LGS++AR +++ V   +VD  L+ ++ +   N     +KL   ++
Sbjct: 130 PSADL-----SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDILSQKLSQYII 184

Query: 262 ITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQ 321
           +TSFNN  +SR F YF+ K +LE + +  L N    ++ILRPGP+ G+HG+     +   
Sbjct: 185 MTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHGSTSSFTV--- 241

Query: 322 QNPTLSERFFY----YPRYILKYKQQCISEVRKVGLRTRLSEVIASSIYRMPGSALLGYS 377
             P L +R  +    Y + I  +  + ++E + VG+ TR SE++A   Y MPG+  +GY 
Sbjct: 242 --PELDDRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMPGAFFVGYP 299

Query: 378 VPVSKVSYVASLMAIEK-KSKEAGP-KVEVINSYQID 412
           V V   ++V     ++  K     P KV   +S QID
Sbjct: 300 VKVLDCAHVIVTERVKHFKLPSLQPQKVTYFSSQQID 336

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 65/153 (42%), Gaps = 16/153 (10%)

Query: 213 NSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSR 272
            ++  ++CALG++ AR    +     VD+ L+  LA           VV+ S        
Sbjct: 67  GNLDVLICALGTTRARSNAEE--QYAVDHDLTLELATVAKREKHAHTVVVVSSTGAHPES 124

Query: 273 TFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERF-- 330
            F Y R+K  +E D+ E    +    ++LRPG + G+   P      +     L  RF  
Sbjct: 125 RFFYARMKGDVERDITEL---QFNHTVLLRPGILLGERYKP-----HVGYRDFLGTRFGA 176

Query: 331 -FYYPRYILKYKQQCI--SEVRKVGLRTRLSEV 360
            FY  R+   +    I  SEV KVGL   L E+
Sbjct: 177 LFYRSRF-QAWALYPIRGSEVAKVGLHLALEEL 208

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 42/173 (24%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+  LAQ       + +V+++S      SR F Y ++K ++E D+   +    K +
Sbjct: 89  IDHDLNLQLAQAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIERDV---IALDFKHI 144

Query: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358
           IILRPGP+ G+  N                                    ++ G    L+
Sbjct: 145 IILRPGPLLGERTNS-----------------------------------KQSGFGGNLT 169

Query: 359 EVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQI 411
             + + +YR     LLGY V   +V  V   +A+    K+   KV+ ++S  I
Sbjct: 170 AALGTRVYRSRFQRLLGYPVYGDEVGKVGVHLALNTSGKD---KVQFVSSKDI 219

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 40/173 (23%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D++L+ +LA++         V+++S   +  SR F Y ++K ++E DLE         L
Sbjct: 20  IDHNLNIHLAKKAKENGCSTFVLVSSSLANADSR-FTYLKMKGEIERDLEAI---GFDHL 75

Query: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358
           IILRPG + G+  N                                       G    + 
Sbjct: 76  IILRPGKLLGERQNDFK------------------------------------GFANSMF 99

Query: 359 EVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQI 411
             + +SIYR     +L Y V  ++V  V   +A++    ++ P+V+++ S +I
Sbjct: 100 TALGNSIYRSRLQCVLQYPVFGNEVGQVGVYLALKAIQDKSSPRVQIVESSEI 152

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 75/178 (42%), Gaps = 40/178 (22%)

Query: 238 FVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297
           ++D+ L+ + A++         VV++S      SR F Y ++K ++E DL+         
Sbjct: 89  YIDHDLNIDFAKKAKENGCSTFVVVSSAGASADSRFF-YLKMKGEIERDLKAI---DFDH 144

Query: 298 LIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRL 357
           LIILRPGP+ G+           Q+N              LK            G     
Sbjct: 145 LIILRPGPLLGER----------QEN--------------LK------------GFGNST 168

Query: 358 SEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415
              + + +YR    AL+G+ V   +V  V   +A++    ++  KV+++ S +I  IA
Sbjct: 169 FTTLGNWVYRSRLQALVGHPVFGDEVGQVGVHLALKALKDKSSEKVQIVESNEILCIA 226

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 72/179 (40%), Gaps = 45/179 (25%)

Query: 238 FVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297
           +VD+ L+  LAQ+      K  V+++S      S  F YF+ KA++E D+   L    ++
Sbjct: 88  WVDHDLNLQLAQKAKENGCKTFVLVSSAGASEKSPFF-YFKTKAEIERDI---LALNFEK 143

Query: 298 LIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRL 357
            IILRPG + G    P                                      G+ +R 
Sbjct: 144 TIILRPGALFGARDKP-------------------------------------KGIVSRA 166

Query: 358 SEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQI-DMIA 415
           S  + S +YR     L GY V   +V  V  L+A +  +  +   V ++ S +I D+ A
Sbjct: 167 SAKLGSYLYRTRFQFLFGYPVSGDEVGKVGVLLATDPSNTAS---VRIVESAEILDLAA 222

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 9/104 (8%)

Query: 208 SLPALNSIGTMVCALGSSAARVRKSQVPNSF-VDYHLSFNLAQEFTNTTDKKLVVITSFN 266
           S+P  + I  +  ALG++ A      + N + +D+ L+  +A+       K LV+++S  
Sbjct: 59  SIP--DGINVLFSALGTTKAAA--GSIENQYKIDHGLNLAVAKAAKEKGCKTLVLVSSLG 114

Query: 267 NDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQH 310
               SR   YF++K +LE D+   L    +  I+LRPG + G+ 
Sbjct: 115 ASIESR-LPYFKMKGELERDV---LALGFERTILLRPGVLLGER 154

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+  LA+   +   + +V+++S      SR F Y ++K ++E D+   +    K  
Sbjct: 89  IDHDLNLQLARAAKDKGCETIVLVSSAGAHADSR-FGYMKMKGEIERDV---IALNFKHT 144

Query: 299 IILRPGPMCGQHGN 312
           IILRPGP+ G+  N
Sbjct: 145 IILRPGPLLGEREN 158

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+  LA+   +     +V+++S      SR F Y ++K ++E D+   +    K  
Sbjct: 89  IDHDLNMQLARAAKDRGCDTIVLVSSAGAHVDSR-FGYMKMKGEIERDI---IALNFKHT 144

Query: 299 IILRPGPMCGQHGN 312
           IILRPGP+ G+  N
Sbjct: 145 IILRPGPLLGKRTN 158

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 20/128 (15%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+  LA+       + +V+++S      SR F Y ++K ++E D+   +    K  
Sbjct: 89  IDHDLNLQLARAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIERDV---IALNFKHT 144

Query: 299 IILRPGPMCGQH--------GNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRK 350
           IILRPGP+ G+         G  +   +  +   ++ + +  YP Y          EV K
Sbjct: 145 IILRPGPLLGERTKSKQSGFGGNLTAALGTRVYRSILQSWLGYPVY--------GDEVGK 196

Query: 351 VGLRTRLS 358
           VG+   L+
Sbjct: 197 VGVHLALN 204

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 80/207 (38%), Gaps = 52/207 (25%)

Query: 163 KYNFIVTQLVIPQSTSWPKLLPE----VFSGTQKLERFDVDSRDYVSDKSLPALNSIGTM 218
           K + I TQ+V P ++ W  L+PE    +F+G                         +   
Sbjct: 39  KSDSIATQIVEPDNSKWSHLIPENTKYLFTG-------------------------LSMT 73

Query: 219 VCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFR 278
             ALG    + +        +D+ L+  LA+         +VV++S      SR F Y R
Sbjct: 74  SYALGGFDNQYK--------IDHDLNLELAKAAKAKGCSTIVVVSSDRASLDSR-FSYMR 124

Query: 279 IKAKLENDLEEALPNKLKELIILRPGPMCGQ------HGNPVHVEMDIQQNPTLSERFFY 332
           +K ++E D+   +       IILRPG + G+      H +  H  M +        R  +
Sbjct: 125 MKGEIERDI---VALDFDHTIILRPGILLGERDPQTAHKSFTHDAMRMIGGMFYRSRLAW 181

Query: 333 YPRYILKYKQQCISEVRKVGLRTRLSE 359
              Y + Y      EV KVG+   L++
Sbjct: 182 LAEYPI-YGD----EVGKVGVHLALNK 203

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 54/130 (41%), Gaps = 21/130 (16%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           +D+ L+ +LA+         +V+++S      SR F Y R+K ++E D+   L       
Sbjct: 86  IDHDLNVDLAKAAKEKGCSTVVLVSSSGASLDSR-FSYMRMKGEIERDI---LALDFDHT 141

Query: 299 IILRPGPMCGQH---------GNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVR 349
           IILRPG + G           GN   + +      +  +R   YP Y          EV 
Sbjct: 142 IILRPGILLGDRDKGINHKGFGNGTAMCIGGWLYRSRVQRLVGYPVY--------GDEVG 193

Query: 350 KVGLRTRLSE 359
           KVG+   L E
Sbjct: 194 KVGVHLALRE 203

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298
           VD+ ++  LA+          VV++S   D  S  F Y + K +LE D+   L    +  
Sbjct: 88  VDHDMNLQLARSAKEKGYSTYVVVSSTGADENS-MFYYMKTKGELERDI---LALGFERT 143

Query: 299 IILRPGPMCGQH 310
           IILRPGP+ G+ 
Sbjct: 144 IILRPGPLLGER 155

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 58/143 (40%), Gaps = 32/143 (22%)

Query: 168 VTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAA 227
           V Q+V   S+ W +L PE               + Y S        + GT   A GS+  
Sbjct: 44  VKQIVETDSSKWAQLFPET------------GVKFYFS--------AFGTTRAAAGSAEN 83

Query: 228 RVRKSQVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDL 287
             +        +D+ L+  LA+         +V+++S   +  S    YF+ K ++E D+
Sbjct: 84  FYK--------IDHDLNVELAKAAKTKGCTTMVLVSSVGANENS-MLPYFKDKGEIERDI 134

Query: 288 EEALPNKLKELIILRPGPMCGQH 310
              L       IILRPGP+ G+ 
Sbjct: 135 ---LALDFDHTIILRPGPLLGRQ 154

>Suva_6.234 Chr6 (419509..420867) [1359 bp, 452 aa] {ON} YJL155C
           (REAL)
          Length = 452

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 26/125 (20%)

Query: 268 DFLSRTFEYFRIK-------------AKLENDLEEALPNKLKE---------LIILRPGP 305
           DFL+R  +Y R                KL N +EE + NK++          ++ +RP P
Sbjct: 165 DFLNRIEQYERFYEPLDAQTDRDMTFVKLVNIVEEVIINKIRTYLESRIVFYVMNIRPKP 224

Query: 306 MC---GQHGNPVH-VEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVI 361
            C    +HG  ++ VE  I  + +LSER F Y + +    ++   +V+     + L    
Sbjct: 225 KCIWLSRHGESIYNVEKKIGGDSSLSERGFQYAKKLKHLVKESAGDVKLTAWTSTLKRTQ 284

Query: 362 ASSIY 366
            ++ Y
Sbjct: 285 QTAKY 289

>Kpol_1018.175 s1018 complement(444710..447160) [2451 bp, 816 aa]
           {ON} complement(444710..447160) [2451 nt, 817 aa]
          Length = 816

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 240 DYHLSFNLAQEFTNTTDKKL--VVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKE 297
           +++L+ +      +T DK L  +++ S + +   +  EY++ K +  N LE  L + L++
Sbjct: 80  EFNLTTDTVNSIISTLDKALRRLIVKSISPEVKIKVDEYYQNKFRTRNSLE--LLSYLED 137

Query: 298 LIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFY 332
           L     G  C QH  PV+ EM+   + +L E+  +
Sbjct: 138 LY----GKKCVQHIAPVYFEMNSIHSKSLEEKTIW 168

>Kpol_387.8 s387 complement(17142..19976) [2835 bp, 944 aa] {ON}
           complement(17142..19976) [2835 nt, 945 aa]
          Length = 944

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 141 YNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTS-WPKLLPEVFSGTQKLERFDVD 199
           YN  ++  A+ YA   +ESF I       + ++ QS   +  L  + F+ T + E+ ++D
Sbjct: 70  YNLGEYEPAVKYALAAEESFNIDEKSQYVETIVTQSIEMYIMLTTQNFNATTEAEKVEID 129

Query: 200 SR 201
            R
Sbjct: 130 PR 131

>YGL001C Chr7 complement(495453..496502) [1050 bp, 349 aa] {ON}
          ERG26C-3 sterol dehydrogenase, catalyzes the second of
          three steps required to remove two C-4 methyl groups
          from an intermediate in ergosterol biosynthesis
          Length = 349

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 10 DSILLFGSSGLAGKGTLENLLDIN----FYIKNVSDLQDKL 46
          DS+L+ G SG  G   ++   DIN     +I +V DL +KL
Sbjct: 5  DSVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKL 45

>Suva_7.281 Chr7 complement(487068..488117) [1050 bp, 349 aa] {ON}
          YGL001C (REAL)
          Length = 349

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 9/50 (18%)

Query: 1  MTNINNAFTDSILLFGSSGLAGKGTLENLLDIN----FYIKNVSDLQDKL 46
          M+NI     DS+L+ G SG  G   ++   DIN     +I +V DL +KL
Sbjct: 1  MSNI-----DSVLIIGGSGFLGLHLIQQFYDINPKPDIHIFDVRDLPEKL 45

>Ecym_2197 Chr2 (388255..389769) [1515 bp, 504 aa] {ON} similar to
           Ashbya gossypii AFL098W
          Length = 504

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 11/67 (16%)

Query: 241 YHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELII 300
           Y + F+L ++FT      +VV ++F      +TF Y R+            PN +   + 
Sbjct: 150 YRIPFDLLEQFTMAASDLVVVNSNFTKSIFFKTFRYLRMN-----------PNVVYPCVE 198

Query: 301 LRPGPMC 307
           L   P+C
Sbjct: 199 LASSPIC 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,475,046
Number of extensions: 2089654
Number of successful extensions: 6262
Number of sequences better than 10.0: 49
Number of HSP's gapped: 6420
Number of HSP's successfully gapped: 54
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)