Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.3068.323ON54123210491e-136
Skud_4.4048.323ON5352199001e-114
YDR145W (TAF12)8.323ON5392328941e-113
Smik_4.3898.323ON5252158741e-110
KAFR0B057208.323ON4842147603e-94
ZYRO0F10384g8.323ON5581977645e-94
TDEL0F044908.323ON5102227572e-93
NCAS0B035708.323ON5192027548e-93
Kpol_543.638.323ON5852097335e-89
KLTH0G12298g8.323ON5001696971e-84
NDAI0J010208.323ON6381936913e-82
SAKL0H15554g8.323ON5361696816e-82
Kwal_56.239168.323ON4991706771e-81
CAGL0E01397g8.323ON5752046663e-79
TPHA0A015608.323ON5402146633e-79
AGL195C8.323ON5541706531e-77
TBLA0A039408.323ON7522046624e-77
Ecym_42548.323ON5291706466e-77
KLLA0D16368g8.323ON5111706441e-76
KNAG0I008908.323ON5081726352e-75
TBLA0H012808.323ON4051133253e-32
Kpol_1016.55.435ON81282751.8
Kpol_1025.112.413ON87593742.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.306
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   408   e-136
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   351   e-114
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   348   e-113
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   341   e-110
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   297   3e-94
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   298   5e-94
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   296   2e-93
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   295   8e-93
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   286   5e-89
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   273   1e-84
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   270   3e-82
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   266   6e-82
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   265   1e-81
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   261   3e-79
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   259   3e-79
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   256   1e-77
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   259   4e-77
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   253   6e-77
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   252   1e-76
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   249   2e-75
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   129   3e-32
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    33   1.8  
Kpol_1025.11 s1025 complement(31479..34081,34759..34783) [2628 b...    33   2.3  

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  408 bits (1049), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 202/232 (87%)

Query: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISEN 369
           NVIPSANTPRANVKAPQTDQSKTKSQVTNV                IFKQTEPAIPISEN
Sbjct: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVNATASMMSNASSSKSAIFKQTEPAIPISEN 369

Query: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429
           ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV
Sbjct: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429

Query: 430 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489
           GIDEGDGETVI              FVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN
Sbjct: 430 GIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489

Query: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVPNLNPKK 541
           IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVPNLNPKK
Sbjct: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVPNLNPKK 541

 Score =  376 bits (966), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 186/202 (92%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN 101
           TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFN         YKNASVGNTTPN
Sbjct: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQAAQAYKNASVGNTTPN 101

Query: 102 AGNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATS 161
           AGNPVSLPTEKPPSLS       ARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATS
Sbjct: 102 AGNPVSLPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATS 161

Query: 162 MKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSK 221
           MKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSK
Sbjct: 162 MKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSK 221

Query: 222 KTFYVECARHNPALQKFLQEST 243
           KTFYVECARHNPALQKFLQEST
Sbjct: 222 KTFYVECARHNPALQKFLQEST 243

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  351 bits (900), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/219 (78%), Positives = 178/219 (81%), Gaps = 2/219 (0%)

Query: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISEN 369
           N +P  NTP+ N+ APQT+QSK K  VTNV                IFKQTEPAIPISEN
Sbjct: 306 NPLPVTNTPKGNINAPQTEQSKAK--VTNVNATASMMSNVSANKSAIFKQTEPAIPISEN 363

Query: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429
           ISTKAPAPV YRSNRPT+TGGSAMNA+ALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV
Sbjct: 364 ISTKAPAPVAYRSNRPTVTGGSAMNASALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 423

Query: 430 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489
           GIDEGDGETVI              FVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN
Sbjct: 424 GIDEGDGETVIDGDVEDLLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 483

Query: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAK 528
           IRIPGYSADEIRSTRKWNPSQSYNQKLQNI SDKVA AK
Sbjct: 484 IRIPGYSADEIRSTRKWNPSQSYNQKLQNITSDKVAAAK 522

 Score =  286 bits (733), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 161/207 (77%), Gaps = 5/207 (2%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAF--NXXXXXXXXXYKNASVGNTT 99
           T KF+AL+ EARNVGETTPRGKELMFQAAKIK VYDA   N         YKNAS+GN  
Sbjct: 42  TAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAYKNASMGNAN 101

Query: 100 PNAGNPVSLPTEKPPSLSXXXXXXX---ARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQ 156
           PN  N  SLPT+K P+ S          AR+NSNKFSNMIKQVLT EENQ+YEKLWQNFQ
Sbjct: 102 PNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPEENQEYEKLWQNFQ 161

Query: 157 VRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKG 216
           VR TS+KE++ FLKQN+DRL QE+NKQTDE TK+QLE+KKNELLN+ KVL IEY  L   
Sbjct: 162 VRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQQLEEKKNELLNDWKVLKIEYTKLFNS 221

Query: 217 FQNSKKTFYVECARHNPALQKFLQEST 243
           +QNSKKTFYVECARHNPAL KFLQEST
Sbjct: 222 YQNSKKTFYVECARHNPALHKFLQEST 248

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  348 bits (894), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 174/232 (75%), Positives = 183/232 (78%), Gaps = 2/232 (0%)

Query: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISEN 369
           N I + N PR NV   QT+QSK K  VTNV                IFKQTEPAIPISEN
Sbjct: 310 NTITATNNPRGNVNTSQTEQSKAK--VTNVNATASMLNNISSSKSAIFKQTEPAIPISEN 367

Query: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429
           ISTK PAPV YRSNRPTITGGSAMNA+ALNTP TTKLPPYEMDTQRVMSKRKLRELVKTV
Sbjct: 368 ISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTV 427

Query: 430 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489
           GIDEGDGETVI              FVTNVTAF+CRLAKHRKSDNLEARDIQLHLERNWN
Sbjct: 428 GIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWN 487

Query: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVPNLNPKK 541
           IRIPGYSADEIRSTRKWNPSQ+YNQKLQ+I SDKVA AKNN ++V +LN KK
Sbjct: 488 IRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNGNNVASLNTKK 539

 Score =  247 bits (630), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 135/205 (65%), Positives = 152/205 (74%), Gaps = 8/205 (3%)

Query: 43  VKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAF--NXXXXXXXXXYKNASVGNTTP 100
            KF+ L++EARNVGETTPRGKELMFQAAKIK VYDA   N         Y N S  N++ 
Sbjct: 43  AKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQAAQAYNNTSNSNSSN 102

Query: 101 NAGNPVSLPTEKPP--SLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVR 158
            A    S+PTE  P  S          R+NSNKFSNMIKQVLT EENQ+YEKLWQNFQVR
Sbjct: 103 PA----SIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVR 158

Query: 159 ATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQ 218
            TS+KEK+T+LKQNIDRL QE+NKQTDE  K+QL++KK ELLN+ KVL IEY  L   +Q
Sbjct: 159 HTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQ 218

Query: 219 NSKKTFYVECARHNPALQKFLQEST 243
           NSKKTFYVECARHNPAL KFLQEST
Sbjct: 219 NSKKTFYVECARHNPALHKFLQEST 243

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  341 bits (874), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 165/215 (76%), Positives = 171/215 (79%), Gaps = 2/215 (0%)

Query: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISEN 369
           N +P  NTPR N  APQT+QSK K  VTNV                IFKQTEPAIPISEN
Sbjct: 296 NTLPGTNTPRGNGNAPQTEQSKAK--VTNVNATASMMNNVSSSKSAIFKQTEPAIPISEN 353

Query: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429
           IS KAPAPV YRSNRPTITGGSAMNA+ALNTP  TKLPPYEMDTQRVMSKRKLRELVKTV
Sbjct: 354 ISAKAPAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQRVMSKRKLRELVKTV 413

Query: 430 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489
           GIDEGDGETVI              FVTNVTAF+CRLAKHR+SDNLEARDIQLHLERNWN
Sbjct: 414 GIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWN 473

Query: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKV 524
           IRIPGYSADEIRSTRKWNPSQSYNQKLQ+I SDKV
Sbjct: 474 IRIPGYSADEIRSTRKWNPSQSYNQKLQSITSDKV 508

 Score =  277 bits (709), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 160/208 (76%), Gaps = 6/208 (2%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAF--NXXXXXXXXXYKNASVGNTT 99
           T KF AL++EARNVGETTPRGKELMFQAAKIK VYDA   N         Y+NAS+GNT 
Sbjct: 42  TAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAYRNASMGNTN 101

Query: 100 PNAGNPVSLPTEKPPSLSXXXXXXX----ARSNSNKFSNMIKQVLTSEENQQYEKLWQNF 155
            N+ NPV++ TEK  + S            R+NSNKFS+MIKQVLT EENQ+YEKLWQNF
Sbjct: 102 SNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQEYEKLWQNF 161

Query: 156 QVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLK 215
           Q R TS+KEK+TFLKQNIDRL QE+NKQT+E  K+QL++KKNELLN+ KVL IEY  L  
Sbjct: 162 QARHTSIKEKETFLKQNIDRLEQEINKQTEEGAKQQLQEKKNELLNDWKVLKIEYTKLFN 221

Query: 216 GFQNSKKTFYVECARHNPALQKFLQEST 243
            +QNSKKTFYVECARHNPAL KFLQEST
Sbjct: 222 SYQNSKKTFYVECARHNPALHKFLQEST 249

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  297 bits (760), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 143/214 (66%), Positives = 166/214 (77%), Gaps = 5/214 (2%)

Query: 313 PSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENIST 372
           PS ++  AN+ A    + +++SQ+TNV                IFKQ++PA+PISE+IS+
Sbjct: 260 PSQSSSNANLAA---SKPRSQSQITNVNAAASNSSSSNKSV--IFKQSDPAVPISESISS 314

Query: 373 KAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGID 432
           K P PVPYR NRPTI+GGSAMNA ALNTP+ TKLPPYE+DT+RVMSKRKLRELVKT+GID
Sbjct: 315 KTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTERVMSKRKLRELVKTIGID 374

Query: 433 EGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRI 492
           EGDGETVI              FVTNVT+FAC+LAKHRKSDNLE +DIQLHLERNWNIRI
Sbjct: 375 EGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRI 434

Query: 493 PGYSADEIRSTRKWNPSQSYNQKLQNINSDKVAT 526
           PGYSADEIRSTRKWNP+QSYNQKLQ+IN DK  T
Sbjct: 435 PGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGT 468

 Score =  183 bits (465), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 133/203 (65%), Gaps = 9/203 (4%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN 101
           + +FK+LV EA+ VGETTP GKEL+ QA+K+K++YD +N          K  ++      
Sbjct: 32  SARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQ--------KQEAMAQAQAR 83

Query: 102 AGNPVSLPTEKPPSLSXXXXXXXARSNSN-KFSNMIKQVLTSEENQQYEKLWQNFQVRAT 160
             N  +       S +        RS S+ +F+ +I+Q LT E+NQQY+KL QNFQ RA 
Sbjct: 84  NNNANTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRAN 143

Query: 161 SMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNS 220
           ++K+K TFLKQNIDRLVQE+ KQTD A KKQL++K+ EL+ N K + +EY NL + + N 
Sbjct: 144 NIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNNG 203

Query: 221 KKTFYVECARHNPALQKFLQEST 243
           KK FY+ECA+ NP LQ+ LQ+ST
Sbjct: 204 KKAFYIECAKKNPDLQRLLQKST 226

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  298 bits (764), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 139/197 (70%), Positives = 157/197 (79%)

Query: 333 KSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSA 392
           KSQVTNV                IFKQ++P +PISEN++ KAP+PV Y+SNRPT+TGG+A
Sbjct: 346 KSQVTNVNATASMANNNAANKSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAA 405

Query: 393 MNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXX 452
           MNA+ LNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGID+GDGETVI            
Sbjct: 406 MNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLA 465

Query: 453 XXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 512
             FVTNVT FACRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY
Sbjct: 466 DDFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 525

Query: 513 NQKLQNINSDKVATAKN 529
           NQK+Q+IN+DK  TA+N
Sbjct: 526 NQKMQSINTDKTNTARN 542

 Score =  177 bits (448), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 137/206 (66%), Gaps = 6/206 (2%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYK----NASVGNTT 99
           KF+ LV+E++NVGE T RGKEL+ QA+KIK+VY  ++         Y+     A+ G +T
Sbjct: 45  KFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQAYEQARNGAAAGGST 104

Query: 100 P-NAGNPVS-LPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQV 157
           P +AG+ VS +P     +         +    ++ +N+IKQVLT E+NQQY+ L Q FQ 
Sbjct: 105 PQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQYDNLLQTFQT 164

Query: 158 RATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGF 217
           R  ++++K  FL+Q+++ L QE+NK+T+ A KKQLEDKK ELL N K L +EY+ L + F
Sbjct: 165 RTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSLNMEYSVLRQEF 224

Query: 218 QNSKKTFYVECARHNPALQKFLQEST 243
            N KK FYVECARHNPALQ+ LQ+ST
Sbjct: 225 TNGKKKFYVECARHNPALQRLLQKST 250

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  296 bits (757), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 141/222 (63%), Positives = 163/222 (73%), Gaps = 1/222 (0%)

Query: 312 IPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENIS 371
           +P  N  R+   +  T  S+ +SQVTNV                IFKQ++P +PISE ++
Sbjct: 283 LPQQNQVRSQSTSSNTG-SRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVT 341

Query: 372 TKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGI 431
            K P+PV Y++NRPT+TGG+AMNA ALNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGI
Sbjct: 342 AKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGI 401

Query: 432 DEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIR 491
           DEGDGETVI              FV+NVT FACRLAKHRKSDNL+ RDIQLHLERNWNIR
Sbjct: 402 DEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIR 461

Query: 492 IPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSS 533
           IPGYSADEIRSTRKWNP  SYNQK+Q INSDK  +AKN +S 
Sbjct: 462 IPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNASSG 503

 Score =  201 bits (510), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 141/207 (68%), Gaps = 6/207 (2%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN 101
           T KF+ALV+EA++VGE TPRGKEL+ +A+KIK++YD +N         +     G T P 
Sbjct: 31  TTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQGRNGGT-PG 89

Query: 102 A-----GNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQ 156
           A     G+  S+        S       +RS+ ++ +N+IKQVLT E+NQQ+E L QNFQ
Sbjct: 90  ANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTPEQNQQFEALSQNFQ 149

Query: 157 VRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKG 216
            RA S+++K TFLKQ+I+RL QEV+KQTD + KKQLE+KK EL NN K+L +EY  L + 
Sbjct: 150 ARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANNLKMLNMEYGALQQE 209

Query: 217 FQNSKKTFYVECARHNPALQKFLQEST 243
           FQN KK FYVECARHNPALQ+ LQ ST
Sbjct: 210 FQNGKKKFYVECARHNPALQRLLQRST 236

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  295 bits (754), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 137/202 (67%), Positives = 158/202 (78%)

Query: 333 KSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSA 392
           KSQVTNV                IFKQ++P +P+S+ ISTK P  VPYRSNRPT+TGGSA
Sbjct: 312 KSQVTNVNAAASMSDSSNSSKQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSA 371

Query: 393 MNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXX 452
           M+A+ALNTPV TKLPPYE+DT+RVMSKRKLRELVK++GIDEGDGETVI            
Sbjct: 372 MSASALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMA 431

Query: 453 XXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 512
             F+TNVT+FACRLAKHRKSDNLEARDIQLHLERNW+IRIPGYSADEIRS RKWNP+Q+Y
Sbjct: 432 DDFITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTY 491

Query: 513 NQKLQNINSDKVATAKNNNSSV 534
           NQKLQ IN+DK   A  N+++ 
Sbjct: 492 NQKLQQINNDKNNAASGNSTTA 513

 Score =  167 bits (424), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 135/206 (65%), Gaps = 6/206 (2%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN 101
           T KFKALV+EA+ VGE T RGKEL+ QA+K+K++YD +N          +  +V N   N
Sbjct: 30  TAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQ--QQQAVNNKVQN 87

Query: 102 AGNPVSLPTEKP---PSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVR 158
             N  ++ T      PS         + S+S + +N+++QVLT E+N  ++KL Q F+ R
Sbjct: 88  PSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQNANFDKLDQTFRSR 147

Query: 159 ATSMKEKDTFLKQNIDRLVQEVNKQTDEA-TKKQLEDKKNELLNNRKVLGIEYNNLLKGF 217
           A+++K+K TFLKQNI+RL QE+NKQ D    +KQLE+K+ ELL N K + +E+N L + +
Sbjct: 148 ASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRNLKAITMEHNTLYQKY 207

Query: 218 QNSKKTFYVECARHNPALQKFLQEST 243
           QN KK FY+ECA+ NP LQK LQ+ST
Sbjct: 208 QNGKKAFYIECAKTNPDLQKLLQKST 233

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  286 bits (733), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 160/209 (76%)

Query: 325 PQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNR 384
           P +  S  +SQVTNV                IFKQ++P++PISE+I+ KAP  V Y SNR
Sbjct: 366 PNSATSANRSQVTNVNATASSANKNIQSKSAIFKQSDPSVPISESITVKAPEAVSYISNR 425

Query: 385 PTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXX 444
           P++TGG+AMNA+ LNTP  TKLPPYE+DT+RVMSKRKLREL+K+VGIDEGDGETVI    
Sbjct: 426 PSLTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDV 485

Query: 445 XXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTR 504
                     FVTNVT+FACRLAKHRKSD+LEARDIQLHLERNWNIRIPGYS DEIRSTR
Sbjct: 486 EELLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTR 545

Query: 505 KWNPSQSYNQKLQNINSDKVATAKNNNSS 533
           KW P+QSY+QK+Q+IN++K   AKN+ S+
Sbjct: 546 KWIPTQSYSQKMQSINNEKSNIAKNSGST 574

 Score =  182 bits (463), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/211 (46%), Positives = 131/211 (62%), Gaps = 10/211 (4%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN 101
           T KFK LV+EA+ VG+ T RGKEL+ QA+ +K+VYD +N          +    G++   
Sbjct: 31  TTKFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTP 90

Query: 102 AGNPVSLPTEKPPSLSXXXXXXXAR----------SNSNKFSNMIKQVLTSEENQQYEKL 151
           AG   +       S         A           S  ++ +++IKQVLT EENQQY+KL
Sbjct: 91  AGTTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKL 150

Query: 152 WQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYN 211
            QNFQ RA+S+K++ TFLKQ+IDRL QE+N+QTDEA KKQLE  + ELL N + L  EY+
Sbjct: 151 LQNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKKQLEVNRAELLTNLRTLNTEYS 210

Query: 212 NLLKGFQNSKKTFYVECARHNPALQKFLQES 242
           NL +  +N KK FYVECAR NP LQ+ LQ+S
Sbjct: 211 NLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  273 bits (697), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 139/169 (82%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P++P+SE I+ + P PV +RSNRPTITGGSAMNA AL TPV TKLPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVK+VGIDEGDGET I              F+TNVT+FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKV 524
           + RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQKLQ INS KV
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAKV 473

 Score =  109 bits (273), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 106/204 (51%), Gaps = 19/204 (9%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPN-A 102
           KF    +EA+ VG  TP+G+EL+ QA++IK++YDA+           +  +  NT  N A
Sbjct: 36  KFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYRQRQQSAQGFEQGGATSNTGDNTA 95

Query: 103 GNPVSL--PTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRAT 160
           G P +   P   P               +N  S+ I+ +LT ++N+ Y +L Q       
Sbjct: 96  GTPTNARSPNGTP---------------NNNMSSNIQNLLTPQQNEAYGRLIQTSNENGE 140

Query: 161 SMKEKDTFLKQNIDRLVQEVNK-QTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQN 219
            +K + T+LK+ I+ L  E+ K Q D AT KQLE  K E+LN  +     Y  L +  + 
Sbjct: 141 KIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASYLALNQKLRE 200

Query: 220 SKKTFYVECARHNPALQKFLQEST 243
            KK FY+ECA  NP L++FLQ ST
Sbjct: 201 DKKKFYIECAATNPNLKRFLQAST 224

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 148/193 (76%), Gaps = 1/193 (0%)

Query: 332 TKSQ-VTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGG 390
           TKSQ VTNV                +FK  EP + IS+ ISTK P  VPYRSNRP++TGG
Sbjct: 414 TKSQSVTNVNAAASASSVHPSNKSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGG 473

Query: 391 SAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXX 450
           SAMNA+AL TPV TKLPPYE+DT+RVMSKRKLRELVK++G+DEGDGETVI          
Sbjct: 474 SAMNASALTTPVATKLPPYEIDTERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLD 533

Query: 451 XXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ 510
               FVTNVT+FACRLAKHR SD+LE RDIQLHLE+NWNIRIPGYSADEIRS RKW+P Q
Sbjct: 534 LADDFVTNVTSFACRLAKHRNSDSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQ 593

Query: 511 SYNQKLQNINSDK 523
           +YNQKLQ+IN+DK
Sbjct: 594 NYNQKLQHINNDK 606

 Score =  152 bits (385), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 130/223 (58%), Gaps = 31/223 (13%)

Query: 44  KFKALVSEARNVG-ETTPRGKELMFQAAKIKSVYDAFNXXXXXX---------------- 86
           KFKALV+EA+ +G + + RGKEL+ QA+KIK++YD +N                      
Sbjct: 47  KFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQAAAAAAAAQARVQAQVQV 106

Query: 87  ----------XXXYKNASVGNTTPNAGNPV--SLPTEKPPSLSXXXXXXXARSNSNKFSN 134
                          N ++G  TP+A  P   S+P     + S        R +SN+ ++
Sbjct: 107 QSSDVNKELPTSTANNNNIG-ATPSANTPTPNSIPISNSNTPSSLNANNGNRLSSNQLAS 165

Query: 135 MIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNK-QTDEATKKQLE 193
           ++KQVLT E+NQ+Y+KL   FQ RA ++KEK +F+KQNI+RL QE+NK   D   K QLE
Sbjct: 166 IMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPNLDPNLKTQLE 225

Query: 194 DKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQ 236
           +KK EL N  + + +E+N L + FQ  +KTFYVECA++NPALQ
Sbjct: 226 NKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQ 268

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  266 bits (681), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 121/169 (71%), Positives = 137/169 (81%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P++P+SEN++ K P  V YRSNRPTITGGSAMNA ALNTPV TKLPPYE+D++R
Sbjct: 328 IFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVDSER 387

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVK+VG+DEGDGET I              F++NVT FACRLAKHRKSDNL
Sbjct: 388 VMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKSDNL 447

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKV 524
           + RDIQLHLERNWNIRIPGYSADEIRSTRKWN + +Y QKLQ IN+ K 
Sbjct: 448 DVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINAAKA 496

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 109/202 (53%), Gaps = 9/202 (4%)

Query: 43  VKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPNA 102
           ++F AL  EA  +G  T  G+EL+ QAAKIK++YDA+N         +     G T    
Sbjct: 35  LRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQAF-----GQTNNRP 89

Query: 103 GNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATSM 162
             P +    +   ++         +++N  S+ I+ +LT E+++ Y KL + F   A ++
Sbjct: 90  PAPAAGNPPQ---VAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTKTFGDSAKNI 146

Query: 163 KEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSK 221
           + +  +L++NI+ L  E+ N++++    ++LE  K EL+   + L   +  L + F  +K
Sbjct: 147 RGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQKFHEAK 206

Query: 222 KTFYVECARHNPALQKFLQEST 243
           K FY+ECA  NP L++FLQ ST
Sbjct: 207 KKFYIECAASNPNLKRFLQAST 228

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  265 bits (677), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 122/170 (71%), Positives = 138/170 (81%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P++P+SE I+ K P  +  RSNRPTITGGSAMNA AL TPV TKLPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVK+VGIDEGDGET I              F+TNVT+FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525
           + RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQKLQ INS +V+
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVS 474

 Score =  100 bits (248), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 107/201 (53%), Gaps = 13/201 (6%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPNAG 103
           KF    +EA+ +G  TP+G+EL+ QA+ IK+VYDA+           +NA   ++  +  
Sbjct: 36  KFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYRQRQQAAQGFDQNAPGASSAGSTS 95

Query: 104 NPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATSMK 163
              +  T + P+ +           +N  S+ I+ +LT ++N+ Y +L Q+       +K
Sbjct: 96  GSPA--TARAPNGTA----------TNTISSNIQNLLTPQQNEAYGRLIQSSNENGEKIK 143

Query: 164 EKDTFLKQNIDRLVQEVNK-QTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSKK 222
            + T+LK+ I+ L  E+ K + D AT KQLE  K E+LN  K     Y  L +  +  KK
Sbjct: 144 GEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVALNQKLREDKK 203

Query: 223 TFYVECARHNPALQKFLQEST 243
            FY+ECA  NP L++FLQ ST
Sbjct: 204 KFYIECAATNPNLKRFLQAST 224

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  261 bits (666), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 145/204 (71%)

Query: 333 KSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSA 392
           +S VT V                IFK ++P +PI++ +S K P P+ +RSNRPTI+ GSA
Sbjct: 363 QSPVTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSA 422

Query: 393 MNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXX 452
           MNA ALNTPV T LPPYE+DT RVMSKRKLRELVK++GIDEGDGETVI            
Sbjct: 423 MNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLA 482

Query: 453 XXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 512
             FVTNVT FACRLAKHRKSDNLE  DIQLHLERNWNIRIPGYSADEIRS  KWN S +Y
Sbjct: 483 DDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAY 542

Query: 513 NQKLQNINSDKVATAKNNNSSVPN 536
            QKL +IN+DK A +  + ++V N
Sbjct: 543 AQKLTSINADKQAISTASANAVSN 566

 Score =  187 bits (474), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 134/206 (65%), Gaps = 4/206 (1%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGN---- 97
           T +FK LV+EA+ VGETTPRGKEL+ QAAK+K+VY+ +           +    G+    
Sbjct: 39  TARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENYTRRQQALARAQQLQQQGSNTNA 98

Query: 98  TTPNAGNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQV 157
              +  +          S S       + ++S + +N+IKQVLT E+NQQYE+L QNFQV
Sbjct: 99  AASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLANIIKQVLTPEQNQQYEQLLQNFQV 158

Query: 158 RATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGF 217
           RA+++K+K TF+KQNIDRLV E+NKQTDE  KKQL +KK ELL N K + +E+  L +  
Sbjct: 159 RASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIRLEHQALQQEL 218

Query: 218 QNSKKTFYVECARHNPALQKFLQEST 243
           QN KK FY+ECAR NPALQ+ LQ ST
Sbjct: 219 QNGKKNFYLECARQNPALQRLLQRST 244

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  259 bits (663), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 153/214 (71%), Gaps = 8/214 (3%)

Query: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISEN 369
           N++P AN        P    +  +  +TNV                IFKQ++P +PIS+N
Sbjct: 316 NLVPGAN--------PADTTNPDRLPITNVNAAASANVKNNQAKSVIFKQSDPTVPISDN 367

Query: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429
           ++ +    +PY+SNRP++TGG+AM+A ALN P  T LPPYE+DT+RVM+KRKLREL+K V
Sbjct: 368 VTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEIDTERVMAKRKLRELIKNV 427

Query: 430 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489
           GIDEGDGETVI              FVTNVT+FACRLAKHRKS+NLE+RDIQLHLERNWN
Sbjct: 428 GIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSENLESRDIQLHLERNWN 487

Query: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDK 523
           IRIPGYS DEIRSTRKW P+Q+++QKLQ+IN+DK
Sbjct: 488 IRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDK 521

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 131/232 (56%), Gaps = 41/232 (17%)

Query: 42  TVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXX----------------- 84
           T KFK LV+EA+ VGE TPRGKEL+ QA+K+K++Y+ F                      
Sbjct: 34  TNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFTKQRQAQIQQLQQQQLQQQQLQ 93

Query: 85  -------------XXXXXYKNASVGN-TTPNAGNPVSLPTEKPPSLSXXXXXXXARSNSN 130
                               NA++ N +TP    PVS       + S       + ++S 
Sbjct: 94  QQQQQTQNAIRPNTNASNVSNANIVNQSTPVGATPVS-------TTSSTPNTNTSSNSST 146

Query: 131 KFSNMIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEV---NKQTDEA 187
           + +N+IKQ+LT+E+NQQY+ L +NF  + TS+K+K  FLKQNID+L QE+   +   D  
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 188 TKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFL 239
            KK LE K+NEL+ N K L +E++ + + F+N KKTFYVECA+ NPALQK L
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  256 bits (653), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 136/170 (80%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P+IPI ENI+      V YRSNRPTIT GSAMNA+AL  PV TKLPPYE+D++R
Sbjct: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVKTVGID+GDGET +              F+TNVT+FACRLAKHRKSDNL
Sbjct: 418 VMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 477

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525
           + RDIQLHLERNWNIRIPGY+ADEIRST+KWNP+ +Y+QKLQ I+S + A
Sbjct: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAA 527

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 105/202 (51%), Gaps = 19/202 (9%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKN-ASVGNTTPNA 102
           KF+ LVSEA+ VG  TP G EL+ +A+ IK++Y+ ++          +N A  G      
Sbjct: 86  KFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQAQQAFQVRNPAPAGQLAAAG 145

Query: 103 GNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATSM 162
               + P                R  S+  SN IK +LT ++ + YEKL Q F     ++
Sbjct: 146 TGQATAP----------------RPTSSVASN-IKMLLTPQQREAYEKLTQTFNESVKNI 188

Query: 163 KEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSK 221
             +  FLK+NI+ L  E+ N+Q +  T KQLE KKNELL     L  ++  L K FQ  K
Sbjct: 189 TGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQFQALPKKFQEDK 248

Query: 222 KTFYVECARHNPALQKFLQEST 243
           K FY+ECA  N  L+KFLQ ++
Sbjct: 249 KKFYIECAATNVNLKKFLQATS 270

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  259 bits (662), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 152/204 (74%)

Query: 329 QSKTKSQVTNVXXXXXXXXXXXXXXXXIFKQTEPAIPISENISTKAPAPVPYRSNRPTIT 388
           Q++ +S +TNV                IFKQTEP +PISE+++TK P  +PYR+NRPT+T
Sbjct: 539 QNRQQSAITNVNAAASTSSKSLTKTMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLT 598

Query: 389 GGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXX 448
           GG+AMN + LNTPV TKLPPYE+DTQRVM KRKL+E+V++VG+D+GDGETVI        
Sbjct: 599 GGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIGGDVEEAL 658

Query: 449 XXXXXXFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNP 508
                 FVT+VT FAC++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNP
Sbjct: 659 LDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNP 718

Query: 509 SQSYNQKLQNINSDKVATAKNNNS 532
           + SYNQKL ++N  K ++ K+++S
Sbjct: 719 TASYNQKLNSLNPGKGSSGKHSHS 742

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 131 KFSNMIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKK 190
           + +N IKQ+LT E+N+QY++L  NFQ+RAT++KEK  FLKQ+I R   E+NK    A  +
Sbjct: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288

Query: 191 -QLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243
            +LE KK EL++N K + I+Y  L + FQN KK+FY+ CAR NP LQ+ LQ+++
Sbjct: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 37/65 (56%)

Query: 43  VKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPNA 102
            KFK LV+EA+ VGE T RGKEL+ QA KIK +YD FN         YK A     +P  
Sbjct: 66  AKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAIQAYKRAQNQINSPRN 125

Query: 103 GNPVS 107
            N +S
Sbjct: 126 ENSIS 130

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  253 bits (646), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 134/170 (78%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P+IPI E++S  +   V YRSNRPTITGGSAMNA AL TPV TKLPPYE+D++R
Sbjct: 329 IFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDSER 388

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVK+VGID+GDGET I              F+TNVT+FACRLAKHRKSDNL
Sbjct: 389 VMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 448

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525
           + RDIQLHLERNWNIR PGYSADEIRST+KWN + +Y QK+Q I S K A
Sbjct: 449 DVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAYGQKMQVITSAKAA 498

 Score = 85.5 bits (210), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 68/109 (62%), Gaps = 1/109 (0%)

Query: 136 IKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEV-NKQTDEATKKQLED 194
           IK +L  ++ + YE+L Q F   A ++K +  FLK+NI+ L  E+ N+Q++  T +QLE 
Sbjct: 133 IKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVRQLES 192

Query: 195 KKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243
           KKNELL     L  ++  L K FQ  KK FY+ECA  N  L+KFLQ ++
Sbjct: 193 KKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATS 241

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  252 bits (644), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 117/170 (68%), Positives = 134/170 (78%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFKQ  P+IPISEN++      V YRSNRPTITGGS MNA AL TPV TKLPPYE+DT+R
Sbjct: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           VMSKRKLRELVKTVGIDEGDGET I              F+TNVT FAC+LAKHRKSD+L
Sbjct: 395 VMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSL 454

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525
           + RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ +  IN++K A
Sbjct: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 113/199 (56%), Gaps = 8/199 (4%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNAS--VGNTTPN 101
           + K+LV+EA+ +G  T  GKEL+ QAA+IK++Y+A++            A   V N   N
Sbjct: 24  RLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAGAQGAVNN---N 80

Query: 102 AGNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATS 161
           A N  S+  ++            A ++SN  +N IK +LT ++ + Y +L Q ++    +
Sbjct: 81  ATNVKSM--DQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQN 138

Query: 162 MKEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNS 220
           +K +  FLK+NI  L QE+ N++ +  + +QLE  +NELL   + L  +Y+ L + +Q  
Sbjct: 139 IKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQED 198

Query: 221 KKTFYVECARHNPALQKFL 239
           ++ FY+EC++ N  L+++L
Sbjct: 199 RRKFYIECSQTNADLRRYL 217

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  249 bits (635), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 113/172 (65%), Positives = 134/172 (77%)

Query: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415
           IFK++EP++PI E+I T  PA V Y+ NRPTITGGS MNA ALNTPV  K+P YE DT R
Sbjct: 323 IFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDR 382

Query: 416 VMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFACRLAKHRKSDNL 475
           V+SKRKLRELV+TVG+DEGDGETV+              FV++VTAFACRLAKHR SD+L
Sbjct: 383 VLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSL 442

Query: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATA 527
           EARD+QLHLERNWNIR+PGY+ DEIRSTRKWN + +Y+QKL  I  D+ A A
Sbjct: 443 EARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTAAA 494

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 117/199 (58%), Gaps = 9/199 (4%)

Query: 44  KFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGNTTPNAG 103
           +FK  V EA+ VGETT  GK+L+ +AAKIK+VYD+            +  +    T N  
Sbjct: 36  RFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSVRGASAGAAAQSQQRTADGATGNVA 95

Query: 104 NPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATSMK 163
              +         +         + + + +  ++Q LT E+ QQY+K+  NFQ +A S++
Sbjct: 96  TAPA---------AAGGGGGAGNTAATQLAMAMRQALTPEQVQQYDKIATNFQNKAKSIR 146

Query: 164 EKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKT 223
           +K  +LKQNID+L  E+NKQ D + K+QL +K+NELL + + L +E+N+L   FQ S+K 
Sbjct: 147 DKHNYLKQNIDKLTAEINKQQDRSAKQQLAEKRNELLRSVRQLTVEHNSLKVNFQLSRKN 206

Query: 224 FYVECARHNPALQKFLQES 242
           FYVECA+ NP LQ+ LQ +
Sbjct: 207 FYVECAKLNPKLQQILQRT 225

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  129 bits (325), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 81/113 (71%), Gaps = 1/113 (0%)

Query: 409 YEMDTQRVMSKRKLRELVKTVGIDEGDGETV-IXXXXXXXXXXXXXXFVTNVTAFACRLA 467
           YE++++RV+SKRKLRELV++V IDE D + + I              FV+N+T+F+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 468 KHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNIN 520
           +HR S+ +  RDIQLH+ERNWNIR+PG++ADEI+S +KW  S  Y   L ++N
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 113/204 (55%), Gaps = 16/204 (7%)

Query: 45  FKALVSEAR-NVGETTPRGKELMFQAAKIKSVYDAFNXXXXXXXXXYKNASVGN-----T 98
           FK L+ +A+ N G+TT +GKEL+ +A K+K ++   +         YKN S  N      
Sbjct: 22  FKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNK-------YKNDSSSNDSTLSR 74

Query: 99  TPNAGNPVSLPTEKPPSLSXXXXXXXARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVR 158
           + +  +  ++ T    S +        RSNSN  S MIK  LT E+N+ YE L ++FQ+R
Sbjct: 75  SNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSN-LSMMIKNALTPEQNESYETLLKDFQIR 133

Query: 159 ATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQ 218
           A  +K + + +K+ ID + + +N +T+   ++ L  K+NE L   K L  +Y  L + FQ
Sbjct: 134 AAKIKREHSDVKEKIDNISKLLNSKTN--NQEALTAKRNEYLFQLKKLSKDYTELHQQFQ 191

Query: 219 NSKKTFYVECARHNPALQKFLQES 242
           N KK FY++ A+ N  LQK LQES
Sbjct: 192 NEKKNFYLKSAKQNSELQKVLQES 215

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 358 KQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALN-TPVTTKLPPYEMDTQRV 416
           +QT  A+PIS+N+    P P   R NR  +    ++N  A   T +     P  ++    
Sbjct: 329 EQTTEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANN 388

Query: 417 MSKRKLRELVKTVGIDEGDGET 438
           ++++K +E++K+ G  E + ET
Sbjct: 389 ITRKKDKEVIKSQGKGEINIET 410

>Kpol_1025.11 s1025 complement(31479..34081,34759..34783) [2628 bp,
           875 aa] {ON} complement(31479..34081,34759..34783) [2628
           nt, 876 aa]
          Length = 875

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 14/93 (15%)

Query: 146 QQYEKLWQNFQVRATSMKEKDTFLKQN-------IDRLVQEVNKQTDEATKKQLEDKKNE 198
           Q Y+  + +F+V  + +K+ D + KQ+         RL+  ++K  +E   ++LE    E
Sbjct: 573 QYYQSFFNDFKVEPSDVKKHDLYFKQDSLPFAELTRRLIDFMHKNGEEKKIEELESIVEE 632

Query: 199 LLNNRKVLGIEYNNLLKGFQNSKKTFYVECARH 231
              N       Y  +   F     T  V+C  H
Sbjct: 633 FKEN-------YGTMFTNFDKFIVTIIVQCLAH 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.124    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,469,426
Number of extensions: 1671950
Number of successful extensions: 8013
Number of sequences better than 10.0: 100
Number of HSP's gapped: 8389
Number of HSP's successfully gapped: 123
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)