Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2898.286ON33533514960.0
Skud_4.3878.286ON33633513450.0
YDR126W (SWF1)8.286ON33633612701e-176
Smik_4.3728.286ON33533512071e-167
NDAI0J010008.286ON3393158151e-107
TDEL0F041308.286ON3283087871e-103
Kpol_1033.168.286ON3213127781e-102
NCAS0B035908.286ON3293137711e-101
ZYRO0D06600g8.286ON3303137595e-99
TBLA0D040408.286ON3293157579e-99
KAFR0B053708.286ON3293117371e-95
TPHA0C010708.286ON3333167205e-93
CAGL0B01991g8.286ON3303187083e-91
KNAG0H031108.286ON3313146562e-83
KLTH0G13112g8.286ON3493275748e-71
Kwal_56.236978.286ON3383195684e-70
SAKL0H16434g8.286ON5552775835e-70
KLLA0F19690g8.286ON3243135632e-69
Ecym_42828.286ON3403165485e-67
AGR065W8.286ON3263115404e-66
TBLA0H009208.389ON3601442035e-17
Suva_10.3428.389ON356542026e-17
NDAI0G022508.389ON389891973e-16
Skud_12.3218.389ON356541964e-16
TPHA0C023608.389ON4041311957e-16
Smik_12.3068.389ON359541938e-16
ZYRO0C04092g8.389ON3661261931e-15
YLR246W (ERF2)8.389ON359541921e-15
NCAS0C029208.389ON374891893e-15
AGL125C8.389ON3671221894e-15
Kwal_23.33028.389ON3531251851e-14
CAGL0G08217g8.389ON3261271794e-14
Ecym_41788.389ON368551805e-14
KLLA0D18370g8.389ON3551711796e-14
TDEL0F051308.389ON359841796e-14
KLLA0C06204g6.28ON377891797e-14
SAKL0H13860g8.389ON3521231771e-13
KAFR0H019808.389ON361541761e-13
YOL003C (PFA4)6.28ON378691734e-13
Smik_15.1676.28ON378661726e-13
KAFR0A051306.28ON396911726e-13
ZYRO0C07546g6.28ON377751701e-12
KLTH0F08668g8.389ON358501691e-12
Kwal_56.224596.28ON3831571691e-12
KNAG0F029306.28ON3861441654e-12
Skud_15.1596.28ON379591638e-12
Suva_15.1726.28ON398681621e-11
NCAS0E013003.12ON3271421601e-11
CAGL0E02497g6.28ON376511593e-11
KNAG0A027108.389ON3541101583e-11
SAKL0E01518g6.28ON379691584e-11
NCAS0D021406.28ON376621565e-11
Ecym_30326.28ON3771721558e-11
TDEL0G044106.28ON381621541e-10
Kpol_1037.236.28ON378651541e-10
NDAI0C026506.28ON389621532e-10
KNAG0K025703.12ON3281341502e-10
TPHA0P015603.12ON331601503e-10
TPHA0J003906.28ON380491513e-10
NDAI0G013403.12ON3351421503e-10
Kpol_1014.293.12ON3261561494e-10
KLTH0C10978g6.28ON3771621495e-10
Kwal_55.221263.12ON3601621495e-10
KAFR0A085903.12ON3311411469e-10
Ecym_20143.12ON3391171432e-09
TDEL0A003103.12ON329641432e-09
KAFR0I011105.579ON370491433e-09
ACL003C6.28ON375371381e-08
KLLA0E02069g3.12ON3251251371e-08
SAKL0C13596g3.12ON333601362e-08
KLTH0F19580g3.12ON3421271362e-08
TBLA0H001503.12ON345511362e-08
Kpol_1004.575.579ON362541301e-07
ADL197C3.12ON390591282e-07
ZYRO0C03410g3.12ON3271221282e-07
TBLA0B004806.28ON377531273e-07
TBLA0E028305.579ON386481273e-07
CAGL0D02508g3.12ON332671263e-07
Suva_14.153.12ON330641254e-07
Smik_14.63.12ON3341371246e-07
KNAG0C028305.579ON3541331237e-07
KLTH0G04972g5.579ON3671051237e-07
Kwal_47.183665.579ON3561391239e-07
Skud_14.153.12ON336621211e-06
YNL326C (PFA3)3.12ON336681202e-06
Skud_4.7345.579ON3801641184e-06
CAGL0K06347g5.579ON352541175e-06
Smik_4.7375.579ON378521141e-05
Ecym_41145.579ON372441112e-05
Suva_2.6345.579ON388531113e-05
KLLA0D06149g5.579ON349791113e-05
SAKL0G06160g5.579ON364571095e-05
YDR459C (PFA5)5.579ON374521095e-05
ABR203W5.579ON359901085e-05
NCAS0F013905.579ON374441061e-04
TDEL0A044405.579ON365511015e-04
NDAI0H018905.579ON40654980.001
ZYRO0D13860g5.579ON365113910.007
Smik_4.5155.626ON76462860.041
SAKL0C05918g1.199ON87544810.15
Skud_4.5275.626ON76448800.19
TBLA0J008305.626ON739133800.21
TPHA0C003705.626ON75950760.62
KAFR0H005705.626ON75743740.99
CAGL0M08712g5.626ON763155741.0
Suva_2.4325.626ON76341741.1
ZYRO0C11132g5.626ON75954741.1
KLTH0E02420g5.626ON73453731.3
YDR264C (AKR1)5.626ON76441721.9
NDAI0H008505.626ON78649721.9
Suva_8.875.626ON73055712.3
KNAG0C062305.626ON75243712.9
Suva_6.178.22ON540102694.1
Skud_15.1995.626ON74158694.2
TBLA0C001508.107ON41760694.4
Kpol_526.325.626ON77765685.9
KNAG0A028008.359ON933131678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.289
         (335 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   580   0.0  
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   522   0.0  
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   493   e-176
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   469   e-167
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   318   e-107
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   307   e-103
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   304   e-102
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     301   e-101
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   296   5e-99
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   296   9e-99
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   288   1e-95
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   281   5e-93
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   277   3e-91
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   257   2e-83
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   225   8e-71
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   223   4e-70
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   229   5e-70
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   221   2e-69
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   215   5e-67
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   212   4e-66
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    83   5e-17
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    82   6e-17
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     80   3e-16
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    80   4e-16
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    80   7e-16
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    79   8e-16
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    79   1e-15
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    79   1e-15
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     77   3e-15
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    77   4e-15
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    76   1e-14
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    74   4e-14
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    74   5e-14
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    74   6e-14
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    74   6e-14
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    74   7e-14
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    73   1e-13
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    72   1e-13
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    71   4e-13
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    71   6e-13
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    71   6e-13
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    70   1e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    70   1e-12
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    70   1e-12
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    68   4e-12
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    67   8e-12
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    67   1e-11
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    66   1e-11
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    66   3e-11
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    65   3e-11
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    65   4e-11
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    65   5e-11
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    64   8e-11
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    64   1e-10
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    64   1e-10
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      64   2e-10
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    62   2e-10
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    62   3e-10
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    63   3e-10
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      62   3e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    62   4e-10
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    62   5e-10
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    62   5e-10
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    61   9e-10
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    60   2e-09
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    60   2e-09
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    60   3e-09
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    58   1e-08
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    57   1e-08
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    57   2e-08
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    57   2e-08
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    57   2e-08
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    55   1e-07
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    54   2e-07
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    54   2e-07
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    54   3e-07
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    54   3e-07
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    53   3e-07
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    53   4e-07
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    52   6e-07
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    52   7e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    52   7e-07
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    52   9e-07
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    51   1e-06
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    51   2e-06
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    50   4e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    50   5e-06
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    49   1e-05
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    47   2e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    47   3e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    47   3e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    47   5e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   5e-05
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    46   5e-05
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    45   1e-04
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    44   5e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    42   0.001
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    40   0.007
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    38   0.041
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.15 
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    35   0.19 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    35   0.21 
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    34   0.62 
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    33   0.99 
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    33   1.0  
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    33   1.1  
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    33   1.1  
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    33   1.3  
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    32   1.9  
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    32   1.9  
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    32   2.3  
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    32   2.9  
Suva_6.17 Chr6 (24763..26385) [1623 bp, 540 aa] {ON} YFL040W (REAL)    31   4.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    31   4.2  
TBLA0C00150 Chr3 (20449..21702) [1254 bp, 417 aa] {ON} Anc_8.107...    31   4.4  
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    31   5.9  
KNAG0A02800 Chr1 complement(331934..334735) [2802 bp, 933 aa] {O...    30   8.5  

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/335 (88%), Positives = 297/335 (88%)

Query: 1   MSWNAXXXXXXXXXXXXXXXXXFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60
           MSWNA                 FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS
Sbjct: 1   MSWNALVVPLVGIVLLVLLSPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60

Query: 61  IYLYLVFTYHTRVEPLIKNELFXXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGST 120
           IYLYLVFTYHTRVEPLIKNELF                     AMVTKAEDSNNHKLGST
Sbjct: 61  IYLYLVFTYHTRVEPLIKNELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGST 120

Query: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180
           EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY
Sbjct: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180

Query: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG
Sbjct: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYD 300
           MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYD
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYD 300

Query: 301 HHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335
           HHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI
Sbjct: 301 HHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/335 (74%), Positives = 266/335 (79%)

Query: 1   MSWNAXXXXXXXXXXXXXXXXXFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60
           M WN                  FKSTWPFST YRRVFQPFV+DD KYRWKFHLVPLFYTS
Sbjct: 1   MLWNVLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTS 60

Query: 61  IYLYLVFTYHTRVEPLIKNELFXXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGST 120
           IYLYLV+TYH +VEPLIKN+LF                     AMVTKAEDSN H+ GST
Sbjct: 61  IYLYLVYTYHAKVEPLIKNDLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGST 120

Query: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180
           EKYPYDYL+YYP V+CSTCR  K ARS+HCSICNRC+LVADHHCIWVNNCIGKGNY+QFY
Sbjct: 121 EKYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFY 180

Query: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFL SNI SMSYAFLRL  IS  S+  LPRAVLTL+ILCGCFTIICAIFTYLQLAIV+EG
Sbjct: 181 LFLISNIVSMSYAFLRLCSISLKSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVREG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYD 300
           MTTNEQDKWYTIQEYMREGKLVRSL+DD +SWFLK TEKGD  +PLQDQ  TFYSTNAYD
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQGTFYSTNAYD 300

Query: 301 HHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335
           H RY L HY TIKDASEITN+YDKGTFLAN  DLI
Sbjct: 301 HKRYILMHYITIKDASEITNVYDKGTFLANFTDLI 335

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  493 bits (1270), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 253/336 (75%), Positives = 266/336 (79%), Gaps = 1/336 (0%)

Query: 1   MSWNAXXXXXXXXXXXXXXXXXFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60
           MSWN                  FKSTWPFSTFYR VFQPF+ DD KYRWK HLVPLFYTS
Sbjct: 1   MSWNLLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60

Query: 61  IYLYLVFTYHTRVEPLIKNELFXXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGST 120
           IYLYLV+TYH RVE  IKNELF                     AMV++AEDS +HK GST
Sbjct: 61  IYLYLVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGST 120

Query: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180
           E+YPYDYLLYYP +KCSTCR +K ARSKHCSICNRCVLVADHHCIW+NNCIGKGNYLQFY
Sbjct: 121 EEYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180

Query: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFL SNIFSM YAFLRL++IS NST+ LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG
Sbjct: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTE-KGDTGQPLQDQHVTFYSTNAY 299
           MTTNEQDKWYTIQEYMREGKLVRSLDDD  SWF K TE K D  +PLQDQHVTFYSTNAY
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300

Query: 300 DHHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335
           DH  Y L HY TIKDASEI NIYDKGTFLANL DLI
Sbjct: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  469 bits (1207), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 244/335 (72%), Positives = 261/335 (77%), Gaps = 1/335 (0%)

Query: 1   MSWNAXXXXXXXXXXXXXXXXXFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60
           MSWN                  FKSTWPFSTFYR VFQPF+ DD KYRWKFHLVP+FYT 
Sbjct: 1   MSWNVLFVLLVGVVVLILLSPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTL 60

Query: 61  IYLYLVFTYHTRVEPLIKNELFXXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGST 120
           IYLYLV+TYHTRVE L+++ELF                      MVTKAEDS +HK GST
Sbjct: 61  IYLYLVYTYHTRVEWLVRSELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGST 120

Query: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180
           EKYPYDYLLYYP VKCSTC  IK ARSKHCSICNRC+LVADHHCIWVNNCIGKGNYLQFY
Sbjct: 121 EKYPYDYLLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFY 180

Query: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFL SNIFS+ YAFLRL+ IS NS   LPRAVLTLTILCGCFTIIC IFTYLQL IV+EG
Sbjct: 181 LFLISNIFSLLYAFLRLWCISLNSKTALPRAVLTLTILCGCFTIICIIFTYLQLTIVREG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYD 300
           MTTNEQDKWYTIQEYMREGKLVRSL+D+ +SWFLK TE  DT +  QDQH TFYSTNAYD
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLNDNCQSWFLKLTE-DDTTKLTQDQHATFYSTNAYD 299

Query: 301 HHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335
           H +Y L HY TIKDASEI+NIYDKGTFLAN  DLI
Sbjct: 300 HKQYNLAHYITIKDASEISNIYDKGTFLANFTDLI 334

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 153/315 (48%), Positives = 203/315 (64%), Gaps = 8/315 (2%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           +K+  PFS +YR VFQP V D H+YRWK+HLVP FY ++++YL + Y+T+VEPLI ++L+
Sbjct: 24  YKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPLIASQLY 83

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTE--KYPYDYLLYYPGVKCSTCR 140
                                 MVT     NN +       +YPYD ++YYP ++C TC 
Sbjct: 84  FIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPNIECRTCG 143

Query: 141 TIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFI 200
            +K ARSKHC ICN C+L+ DHHC+WVNNCIG+GNYL FY FL  N  +M+Y+F+RL+ +
Sbjct: 144 IVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFIRLFLM 203

Query: 201 SFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGK 260
                A   R +LTL ILCG F +ICA FT+LQL +VK+GMTTNEQDKW+T+QEYMR+GK
Sbjct: 204 YCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTLQEYMRDGK 263

Query: 261 LVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLK--HYTTIKDASEI 318
           L+R+ D++   WF+      D      +    FYSTNAYDH  Y L    YT ++D  +I
Sbjct: 264 LIRTKDEN--KWFI--ANPNDDATITINADTIFYSTNAYDHEGYHLSSDEYTIVEDPRQI 319

Query: 319 TNIYDKGTFLANLVD 333
           TN+YD G F  NL D
Sbjct: 320 TNLYDSGDFFTNLKD 334

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  307 bits (787), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 150/308 (48%), Positives = 197/308 (63%), Gaps = 16/308 (5%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           +K  WPFS +Y R+F+P + +D ++RWKF++VP FY S+Y Y++F     V P+I N L 
Sbjct: 25  YKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGNRLL 84

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                +M  KA+ S   + GS ++Y YDY+LYYP V+C TC   
Sbjct: 85  SVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIE 144

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARS+HC++C  CVLVADHHC+WVNNCIGKGNY  FY FL  N+ S+SY FLR+ +IS 
Sbjct: 145 KPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLWISV 204

Query: 203 ---NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
               S  V PR++L  TILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ MREG
Sbjct: 205 MKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIMREG 264

Query: 260 KLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEIT 319
            LVR+LD     +F++     D   P Q     FYSTNAYD   Y  ++Y+ + D  +IT
Sbjct: 265 NLVRTLDGQ---FFIQ-----DQQNPNQ-----FYSTNAYDSKLYVPQNYSIVNDPKDIT 311

Query: 320 NIYDKGTF 327
           NIYD+G+F
Sbjct: 312 NIYDQGSF 319

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  304 bits (778), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/312 (47%), Positives = 191/312 (61%), Gaps = 15/312 (4%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FK TWP S +Y + ++PF  D  +YRWK++LVP  Y  +YL+++  YH RV  ++   L+
Sbjct: 22  FKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNPHLY 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                 M+TK E+S  H + S  +Y +D +LY+P V C TCR  
Sbjct: 82  WFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTCRKP 141

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARSKHCSIC++C+L+ DHHCIWVNNCIG GNY  FYLF+  N  +M Y F RL FIS 
Sbjct: 142 KPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLFISI 201

Query: 203 NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLV 262
                  RA+LT+ ILCG F IIC++FTYLQL +V +G+TTNE DKWYTI EY R+GKL 
Sbjct: 202 KYKVTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYCRDGKLA 261

Query: 263 RSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITNIY 322
           RS    S +WF            L D + TFYSTN YDH RY    YT I D ++I NIY
Sbjct: 262 RS---KSGNWF------------LIDSNNTFYSTNIYDHTRYSPTQYTIINDPTDIQNIY 306

Query: 323 DKGTFLANLVDL 334
           DKG+   N +D+
Sbjct: 307 DKGSCWLNFIDI 318

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  301 bits (771), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 207/313 (66%), Gaps = 9/313 (2%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           ++  WPFS +Y++VF P + D+ K++ KF+++P+FY  +YLYL++ Y+++V P I N+L+
Sbjct: 23  YRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIYCYYSKVAPFINNQLW 82

Query: 83  XXXXXX-XXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRT 141
                                  M TK   +  +      +Y +D L++YP + C TC++
Sbjct: 83  AFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILCRTCQS 142

Query: 142 IKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFIS 201
            K ARSKHCSIC+RCVLVADHHCIWVNNC+GKGNY  FY+FL +N FS++YAF+RL  I 
Sbjct: 143 YKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLLTIF 202

Query: 202 FNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKL 261
           + +   LP+  LTLTILCGCF++IC IFT+LQL + +EGMTTNE+DKW+T+ E+MR+GKL
Sbjct: 203 YTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEKDKWFTVHEFMRDGKL 262

Query: 262 VRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITNI 321
           VR+    S  W+       D       +   FYSTN YDH  Y L+++  I+D S ITNI
Sbjct: 263 VRT---QSGRWYFADPHDSDIS-----EDSVFYSTNGYDHTEYTLRNFEIIEDPSRITNI 314

Query: 322 YDKGTFLANLVDL 334
           YD+G FLANL DL
Sbjct: 315 YDRGDFLANLRDL 327

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  296 bits (759), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 195/313 (62%), Gaps = 8/313 (2%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FK  WPFS +Y+ VF P   D+ ++RWKF+LVPLFY+SIYL +V      V P +   L 
Sbjct: 22  FKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQLSPGLN 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                A +   E + + K  + +K+ YD LL+YP + C TC+  
Sbjct: 82  FFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCRTCQLP 141

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLR-LYFIS 201
           K ARSKHC++CN+CVL  DHHCIW+NNC+G GNYL FYLFL  N  SMSYAF+R +  + 
Sbjct: 142 KPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRSMSIVG 201

Query: 202 FNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKL 261
                  PR++L   +L GCF +IC +FTYLQL +V+EGMTTNE+DKW+TI EYMRE +L
Sbjct: 202 LKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHEYMREKRL 261

Query: 262 VRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITNI 321
           V+S    S  W+   T++ D      DQH  F+STN YD   YRL+ YT I+DA  I NI
Sbjct: 262 VKS---SSGKWYYDLTDRLDLP---TDQH-EFFSTNPYDGRLYRLQSYTLIEDAERINNI 314

Query: 322 YDKGTFLANLVDL 334
           YD+G+F+ANL  L
Sbjct: 315 YDEGSFMANLRTL 327

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  296 bits (757), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 200/315 (63%), Gaps = 14/315 (4%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FK+T   S +Y+  ++P V D+ KYRWKFH+VP+FY ++++YLV  ++ +VEPLI ++L 
Sbjct: 24  FKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLT 83

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                 M+   + +  +   S +KY YD +LY+P  +C TC+  
Sbjct: 84  YFERFFFIPISIISTPFFGIITMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTCKVE 143

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARSKHC++C++C+LV DHHC+WVNNCIG+GN+L FYLFLF N   MSYA +RL  I+ 
Sbjct: 144 KPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASMRLLEITL 203

Query: 203 N---STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           N   +   +PR V+TL ILCGCF  IC  F+Y+QL IVK+GMTTNE+DKWYTIQ  M + 
Sbjct: 204 NFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLMEDK 263

Query: 260 KLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEIT 319
           KLV+S D++   W++ F    D G+        FYSTNAYDH +Y+L  Y  I +  +I 
Sbjct: 264 KLVKSSDNN---WYISFV--NDQGE------TEFYSTNAYDHKKYQLTEYKVIDNVEDIP 312

Query: 320 NIYDKGTFLANLVDL 334
           NIYDKG+   N  D 
Sbjct: 313 NIYDKGSLWKNFKDF 327

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  288 bits (737), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 145/311 (46%), Positives = 189/311 (60%), Gaps = 9/311 (2%)

Query: 24  KSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELFX 83
           K  W FS +Y+R+F PF+ DD KY+WK+HLVP+FY ++Y Y+V  Y T++ P+IK++L  
Sbjct: 25  KEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVLLYFTKLNPIIKSQLTI 84

Query: 84  XXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTIK 143
                                M  + E S        + + +D L++YP   CSTCR  K
Sbjct: 85  LERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTCRLEK 144

Query: 144 AARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISFN 203
            ARSKHC+ICNRCVL++DHHCIW NNCIG GNY  FY FL SN   + YAFLR+  ++  
Sbjct: 145 PARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIILLTAY 204

Query: 204 STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVR 263
           S    P  VLT  IL G F  I  +FTYLQ A+V +GMTTNE+DKW+TIQE+MREG+L+R
Sbjct: 205 SDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREGRLIR 264

Query: 264 SLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITNIYD 323
           +   D+  W +   E+         Q   FYSTNAYDH  Y   ++  I    EI NIYD
Sbjct: 265 T---DNGQWLIAHPEEP------AGQATRFYSTNAYDHTIYCPVNFRPITHHDEIPNIYD 315

Query: 324 KGTFLANLVDL 334
           KG+FL NL +L
Sbjct: 316 KGSFLKNLKEL 326

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  281 bits (720), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 147/316 (46%), Positives = 197/316 (62%), Gaps = 17/316 (5%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
            K+ WPFS +YRR++ P++ D + Y+WK+H+VP FY SIYLYLV+ Y+ +VE LI N L 
Sbjct: 22  LKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVNHLN 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEK----YPYDYLLYYPGVKCST 138
                                 MVTK  + + + +   +K    +P+D ++Y+ G  CST
Sbjct: 82  LFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNVCST 141

Query: 139 CRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLY 198
           C   K ARSKHC+IC  C+L+ DHHCIWVNNCIG GNY  F++FL  N  S+SYAFLRL 
Sbjct: 142 CNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFLRLL 201

Query: 199 FISFNSTAVLPRA--VLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256
            I+ +   V P++  +L L IL G F++IC +F YLQ+  V  GMTTNE DKWY +QE M
Sbjct: 202 HITLSKPDV-PKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAVQELM 260

Query: 257 REGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKH-YTTIKDA 315
           REGKL++S D++   WF   TE         D     YSTN YD+  Y++ + Y  +KDA
Sbjct: 261 REGKLIKSEDNN---WFALSTEDA------PDSPSQVYSTNFYDNKTYKISNDYHIVKDA 311

Query: 316 SEITNIYDKGTFLANL 331
           SEI N+YD+GTFL NL
Sbjct: 312 SEIPNVYDRGTFLDNL 327

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  277 bits (708), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 131/318 (41%), Positives = 198/318 (62%), Gaps = 16/318 (5%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           F+  + F  +Y  V++P + D+ +YR KF++VP+FY S+Y Y+V+ +++R   +I   L 
Sbjct: 23  FRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPMLT 82

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                +M+ K + SN H++GS ++YPYD LLY+P  +C TC+ +
Sbjct: 83  SIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCKQV 142

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARSKHC++CN C+ +ADHHC+W+NNC+G GNY+ FY FL SN+  +SY+F+RL FI F
Sbjct: 143 KPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFIQF 202

Query: 203 NSTA-----VLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMR 257
           N +A        +++L L+ILCG FT+I A++ Y    +V  GMTTNE+DKW  + +Y+ 
Sbjct: 203 NKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDYIN 262

Query: 258 EGKLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASE 317
            G LVR   D    +F+K+   G+  +        FYST++YD  +Y +  Y T+K  +E
Sbjct: 263 TGDLVR---DPEGKYFIKYQNGGNNYE--------FYSTDSYDGTQYTIVDYFTVKSPAE 311

Query: 318 ITNIYDKGTFLANLVDLI 335
           ITNIYDKG F+ NL + I
Sbjct: 312 ITNIYDKGNFINNLREFI 329

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  257 bits (656), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 135/314 (42%), Positives = 189/314 (60%), Gaps = 17/314 (5%)

Query: 27  WPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELFXXXX 86
           WP S +Y +V++PF+ D  +YR K+++VP+FY S+Y Y++  Y + + P+I   L+    
Sbjct: 27  WPLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIEL 86

Query: 87  XXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLG---STEKYPYDYLLYYPGVKCSTCRTIK 143
                             M T+ E       G   S  ++PYD +LYYP   C +C T+K
Sbjct: 87  YFFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVK 146

Query: 144 AARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF--IS 201
            ARSKHCSIC RC+ +ADHHCIW N CIG+GN+  FY+FL  +   ++YAF RL+F  + 
Sbjct: 147 WARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVVV 206

Query: 202 FNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKL 261
            ++     R+ LTL +L G F ++  +FTY Q+ +VKEGMTTNEQDKW+ I EYMR+GK 
Sbjct: 207 ADNKLTSTRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKC 266

Query: 262 VR-SLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITN 320
           V  S +  ++ WFL+  E G            FYSTNAYDH  Y L +Y  +K+ASEI N
Sbjct: 267 VNVSCNGSTKKWFLESDEDGK-----------FYSTNAYDHTAYTLTNYHIVKNASEIIN 315

Query: 321 IYDKGTFLANLVDL 334
           +YDKG+F  N  D+
Sbjct: 316 MYDKGSFWENFKDM 329

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  225 bits (574), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 175/327 (53%), Gaps = 24/327 (7%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           F++   F  +Y RVF P   D +++RWKF  +P FY SIY Y  F +   +E LI++ LF
Sbjct: 24  FRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLF 83

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                 +  K + +      S     YD L+++ GV C TC+  
Sbjct: 84  GVERLLIIPVALSAPIITGLLTIWIKPKST----YASPMLDAYDELIFHSGVSCRTCKLP 139

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K AR+KHC IC++CV +ADHHC+W NNCIG+GNY  FYLFL SN+F  +Y FLRL F+  
Sbjct: 140 KFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFL-- 197

Query: 203 NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLV 262
               V  R +L L+IL GCF +I A+F+Y Q  +V++GMTTNE++KW  I + +R  ++V
Sbjct: 198 -QRFVHSRQLLILSILLGCFGVILAVFSYFQFVLVRDGMTTNEENKWLVIHDMIRARQMV 256

Query: 263 ---------RSLDDDSRSWFLKFTEKGDTGQPLQDQHV--------TFYSTNAYDHHRYR 305
                    R L D         T    + Q   + H+         +YSTN YD+  Y 
Sbjct: 257 TDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHLNDSSPDIYVYYSTNPYDNATYD 316

Query: 306 LKHYTTIKDASEITNIYDKGTFLANLV 332
           +K+   I   + ITNIYD+G F  NL+
Sbjct: 317 VKNPKEILSTAAITNIYDEGGFWKNLM 343

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  223 bits (568), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 176/319 (55%), Gaps = 22/319 (6%)

Query: 29  FSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELFXXXXXX 88
           F  +YR VF P   D  K+R+KFH+VP+ Y +IYLY    +   +E LI + L+      
Sbjct: 28  FKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYAIERWF 87

Query: 89  XXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTIKAARSK 148
                           M+ K E +  +     +++  D +L++ GV+C TC+  K ARSK
Sbjct: 88  IIPVALMTPISCGLLTMLVKPEST--YIAPPVDQF--DGILFHAGVECRTCKMPKYARSK 143

Query: 149 HCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISFNSTAVL 208
           HC+IC RC  +ADHHC+W NNCIGKGNY  FYLFL SN+F   Y F RL ++      V 
Sbjct: 144 HCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYL---QPTVK 200

Query: 209 PRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVRSLDDD 268
            R +LTL +L G F +I  IF+Y Q+ ++K+GMTTNE+ KW  + + MR  KLV    D+
Sbjct: 201 SRTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVV---DN 257

Query: 269 SRSWFLKFTEKGDTGQP------------LQDQHVTFYSTNAYDHHRYRLKHYTTIKDAS 316
           +  ++ +  E  D+  P                  TFYSTN YD+  Y +K+   I D  
Sbjct: 258 AGKFYYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPREIVDYE 317

Query: 317 EITNIYDKGTFLANLVDLI 335
           EITNIYDKG+F  NL D I
Sbjct: 318 EITNIYDKGSFCNNLKDRI 336

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  229 bits (583), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 164/277 (59%), Gaps = 8/277 (2%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FKS  PF  +Y  +F P   D  +YRWK+++VPLFYTSIY+Y V  ++  +   +   L 
Sbjct: 22  FKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPYLL 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                 M  + + +   K  +  + P+D ++++PG  C TC  I
Sbjct: 82  FLERFLIVPLLLLGPIITGYLCMTIEPDST---KSLADCRVPFDEIIFHPGTICQTCHKI 138

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARSKHCSICN+C+L+ DHHCIWVNNCIGKGNY  FY FL SN+  +SY+FLRL  I  
Sbjct: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTSIQL 198

Query: 203 NSTA--VLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGK 260
            S    +  + +L LTIL GCF II A+F Y Q  +V +GMTTNEQDKW+T+QE+MR+G 
Sbjct: 199 MSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGN 258

Query: 261 LVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTN 297
           LVR   D    ++ +  ++  + +  +++  ++ S N
Sbjct: 259 LVR---DKKGHYYFRILDESSSDRDQKEEEDSYRSNN 292

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%)

Query: 293 FYSTNAYDHHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335
           FYSTN YD   Y ++ Y  IKD  ++ NIYDKG F ANL D I
Sbjct: 511 FYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  221 bits (563), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 169/313 (53%), Gaps = 14/313 (4%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FK    F  +Y+ ++ P  TD  +YRWK+ LVP FY  I ++ V  ++ ++   +   L+
Sbjct: 22  FKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLY 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                  V          L +  ++  DY++++P   C TC+TI
Sbjct: 82  SLEKAFIPITIAFTSLTGVASVFVKPL------GLQAGPQFQPDYIIFHPSAVCQTCKTI 135

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K  RSKHC IC RC+ + DHHCIW+NNC+G GNY  FY FL SN   ++YA LRL  +  
Sbjct: 136 KVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLTLFR 195

Query: 203 NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLV 262
            +     +  L+L +L   F++I  +FTY QL +V +GMT NEQDKWY +QEYMR G LV
Sbjct: 196 ITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLV 255

Query: 263 RSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEITNIY 322
           +  D D   ++   +    T +P+      FYSTN YDH +Y L +   I    EI N+Y
Sbjct: 256 K--DMDGVLYYRSMSTDAQTAEPI------FYSTNLYDHSKYHLINPAKILSHEEIINLY 307

Query: 323 DKGTFLANLVDLI 335
           D+G+FL NL + I
Sbjct: 308 DRGSFLDNLKERI 320

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  215 bits (548), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 176/316 (55%), Gaps = 12/316 (3%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
           FKS  PF  +Y  VF+P    + +Y+WK+ LVP FYT IY+Y  F ++  V   I++ L+
Sbjct: 24  FKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLY 83

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                 +VT   D+  +      + P+D ++++  + C +CR  
Sbjct: 84  TLEARCLPVVLALPLLSGYY-TIVTSPHDTITY---VGPEIPFDGIIFHDNIVCRSCRLK 139

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           KAARSKHCSIC RC+LVADHHC+W+NNCIG GNY  FYLFL SN   +SYA +RL  ++ 
Sbjct: 140 KAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAP 199

Query: 203 NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLV 262
           +      ++ L+L IL  CF +I   FTY+Q A+V++GMTTNE+DKWYTI + MR  +L+
Sbjct: 200 SGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNEQLL 259

Query: 263 RSLDDDSRSWF-----LKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLK--HYTTIKDA 315
           + L++D + +         +    T          +YSTN YD   Y L    Y  +   
Sbjct: 260 K-LNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPYDPKTYSLSDTSYHVVNSY 318

Query: 316 SEITNIYDKGTFLANL 331
            +I NIYD+ +F  NL
Sbjct: 319 QDIPNIYDRCSFWQNL 334

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  212 bits (540), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 164/311 (52%), Gaps = 26/311 (8%)

Query: 23  FKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKNELF 82
            ++ WPFS +Y  VF+  + D  ++RWK+   P FY  +Y Y V+ ++  V   I   L+
Sbjct: 22  LRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWLFYGEVYAEIAKALW 81

Query: 83  XXXXXXXXXXXXXXXXXXXXXAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTI 142
                                A       +            YD LL++ GV+C TCR  
Sbjct: 82  VPERWVLPAAVV---------APAAAGVAAAATPAAVPADAAYDGLLFHDGVECRTCRVR 132

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K ARS+HC +C RCV +ADHHC+W+NNC+G+GNY  FYL L ++   ++Y  +RL   + 
Sbjct: 133 KPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLTYGAVRLPLAA- 191

Query: 203 NSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLV 262
                 PRA+L L +L   F ++C  FT  Q+A+V++GMTTNEQDKWY +QE MREG LV
Sbjct: 192 -PAGRWPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKWYAVQESMREGTLV 250

Query: 263 RSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRL--KHYTTIKDASEITN 320
           R      R  F    E GD         V FYSTNAYDH  Y L  + Y  +    EI N
Sbjct: 251 R-----LRGRFYHRVEGGDG--------VEFYSTNAYDHRTYALHNEPYAVVTSHEEIPN 297

Query: 321 IYDKGTFLANL 331
           +YD G+F  NL
Sbjct: 298 VYDTGSFCENL 308

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 82.8 bits (203), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 9/144 (6%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           CSTC   +  R+ HCSIC  C+ V DHHCIW+NNC+G  NY  F +FL   I S  +  +
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFIII 249

Query: 196 R--LYFISFNSTAVLPRAVLTLTILCGCFTII-CAIFTYLQLAIVKEGMTTNE-QDKWYT 251
              ++       +  P A+  L I+ GC TII   I     +A+   G TT E     + 
Sbjct: 250 NCSIHVARIRRASNAPVAI--LLIVYGCLTIIYPGILLGYHIALTGTGQTTREFLHTLHG 307

Query: 252 IQEYMREGKLVRSLDD--DSRSWF 273
           I+  M   ++ R+ D+  DS S+F
Sbjct: 308 IKNPMLS-RVTRARDNAFDSGSFF 330

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 82.4 bits (202), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 40/54 (74%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS 189
           C++CR  +  RS HCS CN CV+V DHHCIWVNNCIGK NY  F +FL S IFS
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFS 228

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 48/89 (53%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C+TCR  +  RS HCSIC  C++  DHHCIWVNNCIG+ NY  F  FL S  F+  +  +
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLII 276

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTI 224
                   +  V    V  L I+ G  TI
Sbjct: 277 NASIDIARTPKVRDTPVAVLLIIYGGLTI 305

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS 189
           C +CR  +  R+ HCS CN CV+V DHHC+WVNNC+GK NY  F +FL S IFS
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFS 228

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 6/131 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TCR  +  RS HCSIC+ CV+  DHHC+W+NNC+GK NY  F +FL S I ++ +  +
Sbjct: 196 CRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLLI 255

Query: 196 RLYF-ISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLA----IVKEGMTTNEQDKW- 249
                I  N     P + + +TIL   +  +   +  + LA    +     TT E  K+ 
Sbjct: 256 NTGIHIGKNRHEKKPASNIPVTILLTVYGSLSISYPIILLAYHLVLTGTNQTTREFLKYV 315

Query: 250 YTIQEYMREGK 260
           Y I++  R+ K
Sbjct: 316 YEIRDQHRKSK 326

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 79.0 bits (193), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS 189
           C +CR  +  RS HCS CN CV+V DHHCIWVNNCIGK NY  F +FL S + S
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVIS 228

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 9/126 (7%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C++CR  +  R+ HCS C  C+L  DHHCIWVNNCIG+ NY  F LFL S I S  +   
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLIA 240

Query: 196 RLYFISFNSTAVLPRAVLTLTILC-GCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQE 254
                 ++   +  +  +T+ +L  G   II     Y  L ++   + T  Q    T +E
Sbjct: 241 NCSIHIYHHRNLPSKVPVTILLLIYGGLAII-----YPMLLLIYHILMTGRQQ---TTRE 292

Query: 255 YMREGK 260
           ++RE  
Sbjct: 293 FLREAN 298

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (68%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS 189
           C +CR  +  RS HCS CN CV+V DHHCIWVNNCIGK NY  F +FL   I S
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILS 228

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 48/89 (53%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TCR  +  RS HCSIC  CVL+ DHHC+WVNNC+G+ NY  F  FL S+  +  +  +
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLIV 243

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTI 224
                   +  V    V  L I+ G  TI
Sbjct: 244 NAAIDVARTPDVTDTPVAVLLIVYGFLTI 272

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 8/122 (6%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C+TCR  +  R+ HC++C+ C+L  DHHC W+NNCIG+ N+  F  FLFS++ S S   L
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLS-SIWLL 245

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
               +          A ++L ++C C     +I+  L LAI    +T  +Q    T  EY
Sbjct: 246 TCCALKLRHAGSPSAAPVSLLLICYCAV---SIWYPLLLAIYHLFLTGTQQ----TTHEY 298

Query: 256 MR 257
           ++
Sbjct: 299 LK 300

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 68/125 (54%), Gaps = 8/125 (6%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TCR  +  R+ HCS+C  C+L  DHHC WVNNCIG+ NY  F  FL S+  +     +
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVICIV 232

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
                  ++T ++  AV  L ++   +  +C+ + +L L +    +T+ +Q    T +EY
Sbjct: 233 SCAIRIAHATRLVKVAVAILLLI---YCALCSCYPFL-LLLYHVFLTSTQQ----TTREY 284

Query: 256 MREGK 260
           ++ G+
Sbjct: 285 LKGGR 289

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 73.6 bits (179), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 10/127 (7%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS----MS 191
           C TC+  +  R+ HCS+C  CVL  DHHCIWVNNC+G+ NY  F  FL S+  +    ++
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLIA 219

Query: 192 YAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYT 251
              L L+        V  R +    +LC    ++C ++  + L      M+  +Q    T
Sbjct: 220 NCALHLHRALHEGIRVSHRPLPVAVLLCVYAAVLC-VYPVILLG-YHVAMSGTQQ----T 273

Query: 252 IQEYMRE 258
            +EY+R 
Sbjct: 274 TREYLRS 280

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (70%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSM 190
           C+TCR  +  R+ HCS CN C++  DHHCIWVNNC+G+ NY  F  F++S + ++
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTI 243

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 78/171 (45%), Gaps = 24/171 (14%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TCR  +  RS HCS+C+ CVL  DHHC W+NNCIGK NY  F  FL ++  S     L
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLIL 233

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
              F    S  V    V +L I+C C      I+  L L I    +   +Q    T  EY
Sbjct: 234 LSSFRLSYSPQVRYTPV-SLLIICYCGL---GIWYPLILFIYHIFLAGTQQ----TTHEY 285

Query: 256 MRE--------GKLVRSLDD--DSRSWF-----LKFTEKG-DTGQPLQDQH 290
           +R          K+ R+ D   D  S F     L F E+G +   P + QH
Sbjct: 286 LRSIGSKHPIFHKITRNRDSPYDRNSMFFNLIHLWFQERGWNLVDPRRKQH 336

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C++CR  +  R+ HCS C  CV+  DHHCIWVNNC+G+ NY  F +FL   + +  +   
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLIA 240

Query: 196 RLYFISFNSTAVLPRAVLTLTILC 219
                    ++ +P  +L L   C
Sbjct: 241 NCSIHIARRSSQVPVTILLLVYAC 264

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  CR  K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  IFS +Y   
Sbjct: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLF 139

Query: 196 ----RLYFI-SFNSTAVLPRAVLTLTILC 219
               R+Y + S   TA   R+   +  +C
Sbjct: 140 LLIGRIYLLWSIRHTAFHHRSTSEIIFIC 168

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 8/123 (6%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C+TCR  +  R+ HCS C  C++  DHHC WVNNCIG+ NY  F+ FL S + + ++   
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFIIA 231

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
               I  + +     A + + +L  C  ++C  F  L   I    +T ++Q    T +EY
Sbjct: 232 NCA-IRVSRSVHAKDAPVAILLLIYCGLVVCYPFILLVYHIF---LTGSQQ----TTREY 283

Query: 256 MRE 258
           ++ 
Sbjct: 284 LKS 286

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFS 189
           C TCR  +  R+ HCSIC  CV+  DHHCIW+NNC+G+ NY  F  FL S   +
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLA 231

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C++ K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FLF  I + S  F 
Sbjct: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFC 139

Query: 196 ----RLYFI 200
               R+YFI
Sbjct: 140 IQAKRIYFI 148

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 132 PGVK---CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIF 188
           PG+    C  C+  K  RS HC  CN+CVL+ DHHC W  NC+G GNY  F  FLF  I 
Sbjct: 73  PGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLFWIII 132

Query: 189 SMSYAF 194
           + S  F
Sbjct: 133 TTSILF 138

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 51/91 (56%), Gaps = 8/91 (8%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF----SNIFSMS 191
           C  C   K  R+ HC  CN+C+L+ DHHC W  NC+G  NY  F  FLF    +  F ++
Sbjct: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140

Query: 192 YAFLRLYFISFN---STAVLPR-AVLTLTIL 218
             F R+ FI  N   S+A++ R  ++ LTIL
Sbjct: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF- 194
           C  CR  K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  I +  Y   
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139

Query: 195 ---LRLYFISFNSTA 206
              LR YFI  N  +
Sbjct: 140 ELCLRAYFILSNHNS 154

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFS 185
           C+TCR  +  R+ HCS C  CVL  DHHC WVNNCIG+ NY  F  FL S
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLAS 227

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 64/157 (40%), Gaps = 37/157 (23%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C+T K  R+ HC  C++CVLV DHHC W  NC+G  N+  F  FL   I + SY   
Sbjct: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139

Query: 196 RLY------------------------FISFNSTAVLPRAVLTLTILCGCFTIICAIFTY 231
            L+                        FI+    A +   ++ L + C     +C     
Sbjct: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLC----- 194

Query: 232 LQLAIVKEGMTTNEQDKWYTIQEYMREGKLVRSLDDD 268
                   GMT  E+ +W  I+     G+L+  L ++
Sbjct: 195 --------GMTQIERWEWERIENQFNNGRLIPQLLEN 223

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 63/144 (43%), Gaps = 18/144 (12%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMS---- 191
           C+ C   K  RS HC  C +CVL+ DHHC W  NC+G GN+ QF  FL   I + S    
Sbjct: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFW 141

Query: 192 YAFLRLYFI-------------SFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVK 238
           Y  LR+  I             S  +  ++   VLT   L   FTI  A+F       V 
Sbjct: 142 YLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMDLFVLFTIT-ALFVRCVTNQVI 200

Query: 239 EGMTTNEQDKWYTIQEYMREGKLV 262
            GMT  E  +   +Q      KL+
Sbjct: 201 GGMTQIESWEMERLQNMFYSKKLL 224

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF 194
           C  C++ K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FLF  I + S  F
Sbjct: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILF 138

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF- 194
           C  C+  K  RS HC  CN+CVL+ DHHC W  NC+G  NY  F  F+F  I +  + F 
Sbjct: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159

Query: 195 LRLYFISF 202
           ++L  +SF
Sbjct: 160 IQLKRVSF 167

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC+  K  R  HCS C++C+L  DHHC W   CIG  N   F  FL   I+  +Y+ +
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFL---IYCTAYSIV 157

Query: 196 RLYFISFN----------STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L+F S               ++   +LT+ IL    T+    F+   +  + +  TT E
Sbjct: 158 VLFFTSCELHYWFSGKQYEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQTTIE 217

Query: 246 QDKWYTIQEYMREGKLVRSLDD 267
               Y ++   R+ +L+R L+D
Sbjct: 218 M---YGMKREKRDLELLRGLED 236

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 31/51 (60%)

Query: 134 VKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           V C  C+  K  RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FLF
Sbjct: 78  VYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFLF 128

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C+ C+  +  R+ HC IC  CV   DHHC W+NNC+G+ NY  F  FL +   + +  F+
Sbjct: 186 CTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLFV 245

Query: 196 RLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
                  + T  +P  ++  + +   + ++  ++    + +   G TT E
Sbjct: 246 SSAIHLSHETRAVPIVLVAYSGIALWYPLVLLVY---HVCMTATGQTTRE 292

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNI----FSMS 191
           C+ C   K  R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FLF  I    F ++
Sbjct: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFLFWVIETTSFLLT 139

Query: 192 YAFLRLYFI 200
           Y   R+ F+
Sbjct: 140 YLVKRILFL 148

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C+  K  R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FLF  + +  +   
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139

Query: 196 RL 197
           +L
Sbjct: 140 QL 141

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 79/172 (45%), Gaps = 14/172 (8%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYA-- 193
           C  C+  K  R+ HC  C +CVLV DHHC +  NC+G  N+  F  FLF  I + +Y   
Sbjct: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139

Query: 194 --FLRLYFI--SFNSTA--VLPRAVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243
             F R +F+    +STA  V  + ++ LTIL      +    + L    +K     GMT 
Sbjct: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199

Query: 244 NEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTE--KGDTGQPLQDQHVTF 293
            E  +   I+      +LV  L  +    +    +  KG+  + L ++ ++F
Sbjct: 200 IEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISF 251

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C+  K  R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL   I + ++   
Sbjct: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139

Query: 196 RL 197
           +L
Sbjct: 140 QL 141

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FLF  I + +Y   
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYL-- 137

Query: 196 RLYFI 200
            LYF+
Sbjct: 138 -LYFL 141

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL   I +  +  +
Sbjct: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143

Query: 196 RL 197
            L
Sbjct: 144 HL 145

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGN---YLQFYLFLFS-NIFSMS 191
           C +CR  K  R  HCS C+RC+L  DHHC W+  C+G  N   ++QF L+  +  IF +S
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 192 YAFLRLYFISFN---STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
              ++LY   +N      ++   +L L I      I   +F+   ++ V +  TT E   
Sbjct: 163 MTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQTTIEM-- 220

Query: 249 WYTIQEYMREGKLV 262
            Y +Q +  + +++
Sbjct: 221 -YGVQRWRNQARIL 233

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC   K  RS HCS CNRCVL  DHHC W + CIG  N   F  FL   I++ +YA++
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFL---IYNTTYAYV 166

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 28/49 (57%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           C  C   K  RS HC  CN+CVL+ DHHC W  NCIG  N+  F  FL 
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 63/142 (44%), Gaps = 16/142 (11%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC+  K  R  HCS CN+C+L  DHHC W   CIG  N   F  FL   I+   YAF+
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFL---IYCTIYAFV 165

Query: 196 RLYFISFN----------STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L  IS+               +   +L + +L    +I    F+   +  V +  TT E
Sbjct: 166 ALGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTIE 225

Query: 246 QDKWYTIQEYMREGKLVRSLDD 267
               Y I+ Y R+  ++   ++
Sbjct: 226 M---YGIRRYNRDFAILNGTEE 244

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 67/156 (42%), Gaps = 25/156 (16%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC   K  R  HCS C++C+L  DHHC W   C+G  N   F  FL   I++  YA L
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFL---IYTTVYAIL 162

Query: 196 RLYFISFN----------STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            + + SF            T ++   +L + IL     +    FT   +       TT E
Sbjct: 163 VMTYTSFQIYDWFKNELYETEIIKIRLLMVWILSVAVFLTVTCFTGFSIYQTINNRTTIE 222

Query: 246 QDKWYTIQEYM---------REGKLVRSLDDDSRSW 272
               YT+++Y          R+ +L R++ D   +W
Sbjct: 223 M---YTLRKYREELELYGNYRDSQLTRNIFDLGSTW 255

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 66/162 (40%), Gaps = 11/162 (6%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + + SY  L
Sbjct: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139

Query: 196 RLYFISFNSTAVL-PRAVLTLTILCGCF------TIICAIFTYLQLAIVK----EGMTTN 244
            L   +F+  A    R  +  + LC  F        I    + L    VK     GMT  
Sbjct: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQI 199

Query: 245 EQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPL 286
           E  +   I+      +LV  L D+ +  F + T      Q L
Sbjct: 200 ESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKL 241

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 71/162 (43%), Gaps = 21/162 (12%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSN------IFS 189
           C TC   K  R  HCS CN+C L  DHHC W  +C+G  N   F  FL         +F 
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVFF 192

Query: 190 MSYAFLRLYFIS--FNSTAV-LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQ 246
           ++ A L ++F S  +N   + LP  +L + IL    TI    FT   + +V +  TT E 
Sbjct: 193 LTGADLLMWFRSQGYNQELINLP--LLIVWILSLVITISMLAFTSYTIYLVAKNQTTIEM 250

Query: 247 DKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKG--DTGQPL 286
            +W   +        VR LD         F +K   D G PL
Sbjct: 251 YEWTNYRNQRNIMDEVRGLD--------TFEDKNVFDLGSPL 284

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 63/141 (44%), Gaps = 16/141 (11%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC   K  R  HCS CNRC+L  DHHC W   CIG  N   F  FLF   +  SY+ +
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLF---YCTSYSII 162

Query: 196 RLYFIS------FNSTA----VLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L+  S      F ST+     +   +LT+ +L     I   +FT   +  +    TT E
Sbjct: 163 VLFVTSIQIYHWFRSTSYEYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTTIE 222

Query: 246 QDKWYTIQEYMREGKLVRSLD 266
               Y  + Y  E  ++  LD
Sbjct: 223 L---YAYRRYKAELNIIGDLD 240

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 64/117 (54%), Gaps = 7/117 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL-FSNIFSMSY-- 192
           C+TC   K  RS HCS CN+C L  DHHC W ++CIG  N   F  FL +S ++S+S   
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIFI 169

Query: 193 -AFLRL--YFISFN-STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            A L++  +F + N +T  +   +L + +L    ++    FT   + ++ +  TTNE
Sbjct: 170 AATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQTTNE 226

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C TC   K  R  HCS CNRC+L  DHHC W+ +C+G  N   F  FL   +++  YAF 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFL---MYATLYAFN 164

Query: 196 RLYF 199
            L F
Sbjct: 165 VLIF 168

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           CS C  +K+ RS H S+ N C+   DH+CIW+   IGK NY QF +FLF
Sbjct: 119 CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLF 167

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 25/37 (67%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIG 172
           C+ C T K  R+ HC  CN+CVLV DHHC W  NC+G
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL-FSNIFS----- 189
           C TC   K  R  HCS CN+C L  DHHC W  +C+G  N   F  FL ++ ++S     
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 190 MSYAFLRLYFISFN-STAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           M+ A L  +F      + +L   +L + +L     I    FT   + +V +  TT EQ +
Sbjct: 165 MTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQYE 224

Query: 249 WYTIQ 253
           W  I+
Sbjct: 225 WGNIR 229

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C+  K  RS HCS CN+C L  DHHC W  +CIG  N   F  FL    +   + F+
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (45%), Gaps = 11/127 (8%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSN------IFS 189
           C  C   K  R  HCS C +C L  DHHC W  +C+G  N   F  FL         IF 
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFL 165

Query: 190 MSYAFLRLYFIS--FNSTAV-LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQ 246
           +S   L L+F +  +N   + LP  +L + IL    +I    FT   + ++ +  TT E 
Sbjct: 166 LSGTELLLWFKNQRYNQEMIQLP--LLVVWILSVAISISMLAFTSYTVYLITKNQTTIEM 223

Query: 247 DKWYTIQ 253
            +W  ++
Sbjct: 224 YEWSNLK 230

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 28/51 (54%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSN 186
           C TC   K  R  HCS C+RC+L  DHHC W   CIG  N+  F  FL  N
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYN 156

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           YP + C TC+++K  R+ H      C+   DHHC+WV   IGK NYL F  F+F
Sbjct: 120 YP-IWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVF 172

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAF 194
           C  C+  K  R  HCS C++C L  DHHC+W   CIG  N+  F  FL   +++  YAF
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFL---LYASVYAF 226

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 57/122 (46%), Gaps = 17/122 (13%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGN---YLQFYL---------FL 183
           C TC   K  R  HCS C++C+L  DHHC W   CIG  N   ++Q+ L         FL
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIFL 166

Query: 184 FSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTT 243
           FS+I  + +   + Y        ++   +L++ +L    ++  + FT   +  V +  TT
Sbjct: 167 FSSIQLLHWFNTKQY-----EVELIDFHLLSVWLLGVAVSVSLSFFTGFSIYQVTKNQTT 221

Query: 244 NE 245
            E
Sbjct: 222 VE 223

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%)

Query: 145 ARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRL 197
            R+ HC  CN CV++ DHHC W  NC+G  NY  F  FL   I S +    +L
Sbjct: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQL 151

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183
           CS C+++K  R+ H S    CV   DH+C+WV   IGK NYL F  F+
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFV 170

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C +C + K  R  HCS CN CVL  DHHC W   C+G  N   F  FL   I+   Y+ L
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFL---IYCTVYSIL 162

Query: 196 RLYFISF 202
            L   S 
Sbjct: 163 VLILSSM 169

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R  HCS C+ C+L  DHHC W   C G  N   F  FL    F   YAFL
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTF---YAFL 162

Query: 196 RLYF 199
            L +
Sbjct: 163 VLIY 166

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 61/137 (44%), Gaps = 16/137 (11%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R  HCS C+ CVL  DHHC W   C G  N   F  FL   +++  YAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFL---MYTTCYAFL 162

Query: 196 RLYFIS------FNSTA----VLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L +        FNS +    ++   +L + +L     I    FT   +  V +  TT E
Sbjct: 163 VLIYTCYELGTWFNSGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTTIE 222

Query: 246 QDKWYTIQEYMREGKLV 262
               + ++ Y R+ +++
Sbjct: 223 V---HGMRRYRRDLEII 236

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 20/133 (15%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLF-------LFSNIF 188
           C+ C+++K+ R+ H      CV   DH+C W+   IG GNYL F  F       L     
Sbjct: 126 CAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLLIMWI 185

Query: 189 SMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFT---------IICAIFTYLQLAIVKE 239
           SMS  F+R+Y    +   +   A+  L++ C  F          +I    T L+  I+K+
Sbjct: 186 SMS-PFIRVYTFRRDGNLI---AIYILSVWCSLFVTGLLTAHIYMISLNLTSLEGIILKK 241

Query: 240 GMTTNEQDKWYTI 252
               N + K Y +
Sbjct: 242 TPKKNAEPKPYYV 254

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 11/105 (10%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNY-----LQFYLFLFS 185
           YP + C+ C++IKA R+ H S    C+   DH+C+W+   +G+ NY       FY + F+
Sbjct: 128 YP-IWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFA 186

Query: 186 NIFSMSYAFLRLYFISFNSTAVLPRA---VLTLTILCGCFTIICA 227
               +S A      I   S   +PR    +L +  LCG  T++  
Sbjct: 187 IFVIVSTASFLPKII--RSQPHVPRVNPNILIMMGLCGMATLMVG 229

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 14/139 (10%)

Query: 105 MVTKAEDSNNHKLGSTE-----KYPYDYLLYYPG--VKCSTCRTIKAARSKHCSICNRCV 157
           +V  +E  ++ K GS       K P  Y     G  + C+ C+++K+ R+ H S    C+
Sbjct: 87  IVADSESESDEKDGSEAATRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCI 146

Query: 158 LVADHHCIWVNNCIGKGNY-----LQFYLFLFSNIFSMSYA-FLRLYFISFNSTA-VLPR 210
              DH+C+W+   +G+ NY       FY +LF+     S A FLR    S +    V P 
Sbjct: 147 PRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIASIASFLRRIIKSRSQIPRVNPN 206

Query: 211 AVLTLTILCGCFTIICAIF 229
            ++ L + C    ++  +F
Sbjct: 207 ILVVLALCCMAMLMVGPLF 225

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R  HCS C+ C+L  DHHC W   C G  N   F  FL    F   YAFL
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTF---YAFL 162

Query: 196 RL 197
            L
Sbjct: 163 VL 164

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C  C   K  R  HCS C+ C+L  DHHC W   C G  N   F  FL   +++  YAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFL---MYTTLYAFL 162

Query: 196 RLYFISFN 203
            L +  + 
Sbjct: 163 VLIYTCYE 170

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 71/164 (43%), Gaps = 16/164 (9%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL--FSNIF 188
           YP + CS C+++K  R+ H S    CV   DH+C+W    IG+ NY  F  F+  FS + 
Sbjct: 128 YP-IWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSILL 186

Query: 189 SMSYAFLRLYFIS-----------FNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIV 237
            + +A + +Y               N   +L  A   L  L    T+  AIF   Q    
Sbjct: 187 LIMWASICVYTKEITQRHHSQGPRINVNVMLTLAFAILGWLLTTSTLGSAIFYMSQNKTS 246

Query: 238 KEGMTTNEQDKWYT--IQEYMREGKLVRSLDDDSRSWFLKFTEK 279
            E +  +++ K+ T  I  Y  E   +R + +  RS F  F  K
Sbjct: 247 LEAIMDSKRKKFGTRKIFSYYSESNKLRFVVEFDRSEFHAFWSK 290

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           YP V CS C+++K  R+KH S    CV   DH+C+W+   IG  NY  F  F+F
Sbjct: 112 YP-VWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVF 164

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLF 182
           YP + CS C+++K  RS H S    C+   DH+C+W+   IG+ NY  F  F
Sbjct: 127 YP-IWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF 177

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQF 179
           CSTC+++K  RS H  +   CV   DH+C+W+   IG+ NY  F
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLF 170

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183
           YP + CS C+++K  R+ H S    CV   DH+C+WV   IG+ NY  F  F+
Sbjct: 133 YP-IWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 106 VTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCI 165
           V+      ++ +   + YP D   Y   + CS C+++K +R+ H +    CV   DH+C+
Sbjct: 100 VSSESAVPDNSIAPPDIYPCDERGY--PIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCV 157

Query: 166 WVNNCIGKGNYLQFYLFLF 184
           W+   +G+ NY  F  F F
Sbjct: 158 WIGTVLGRLNYKLFVQFTF 176

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNY---LQFYLFLF 184
           YP + CS C+++K  R+ H +    CV   DH+C+W+   +G+ NY   +QF ++ F
Sbjct: 123 YP-IWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMYFF 178

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLF 182
           YP + CS C+++K  R+ H S    C+   DH+C+W+   IG+ NY  F  F
Sbjct: 127 YP-IWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSM 190
           YP V CS C+++K  R+ H      CV   DH+C+W+   IG+ NY  F  FL       
Sbjct: 118 YP-VWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM------ 170

Query: 191 SYAFLRLYFISFNSTAVLPRAVLTLTILCG 220
              FL    I F S   L R + +   + G
Sbjct: 171 --CFLMHALIIFVSVVSLQRRIASSARMRG 198

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQF 179
           C+ C+++K +RS H     RC+L  DH+C W+   I + NY  F
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNY---LQFYLFL 183
           CS C ++K  R+ H S    CV   DH C W+   IG+ NY   +QF +++
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYM 177

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 131 YPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           YP + C+ C+++K  R  H      C+   DH+C W+   IG+ NY  F  ++F
Sbjct: 113 YP-IWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVF 165

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 29/113 (25%)

Query: 105 MVTKAEDSNNHKLGSTEKY---------------PYDYLLYYPGVKCSTCRTIKAARSKH 149
           ++  A++S+   LG++EKY               P  Y ++     C+ C+++K  R+ H
Sbjct: 89  LILSAQESD---LGASEKYQNHGSDGSSICYQCDPNGYPIW-----CTNCQSLKTERAHH 140

Query: 150 CSICNRCVLVADHHCIWVNNCIGKGNY---LQFYLFL---FSNIFSMSYAFLR 196
                 CV   DH C ++ + IGK NY   +Q+ +F+    + I++   A++R
Sbjct: 141 SRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWTSIVAYIR 193

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           C    T K  RSK+ S+ N  V   DH+C W+ N +G  N+  F +F  +++ S  + FL
Sbjct: 472 CIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITSMESGIFTFL 530

Query: 196 RL 197
            L
Sbjct: 531 AL 532

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 132 PGVKCSTCRTIKAARSKHCSICNRCVLVADHH-CIWVNNCIGKG 174
           P V CS C+  K+   K    C+ CV + D   C ++N  +GKG
Sbjct: 9   PTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183
           C    T K  RSK  S+ N  V   DH+C W+ N +G  N+  F  F+
Sbjct: 472 CIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 20/133 (15%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYFISF 202
           K  RSK   +    V   DH+C WV N IG  N+ +F +F+F +  ++ ++F+ + F  F
Sbjct: 475 KPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTI-WSFVIVCFEYF 533

Query: 203 NSTAVLPRAVLTLT--------ILCGCFTIICAIFTYLQLAIVK-----------EGMTT 243
           +   V   A   L         +L   FT++  +++ LQ   V             G+T 
Sbjct: 534 DELEVEEDAKCLLMGGGSVCKGVLKSRFTLLLMVWSMLQGVWVMFLICVQLFQMLRGITN 593

Query: 244 NEQDKWYTIQEYM 256
           NE +K     E M
Sbjct: 594 NEFNKLANAHESM 606

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFS 185
           C    T K  RS++  + N  V   DH+C WV N +G  N+  F  F+ S
Sbjct: 464 CIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILS 513

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFS 185
           K  RSK  +  N  V   DH+C WV N IG  N+  F  F+ S
Sbjct: 470 KPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 25/155 (16%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFS---NIFSMSYAFLRLYF 199
           K  RSK+  + +  +L  DH+C W+ N +G  N+  F  F+ +    IFS     L+ YF
Sbjct: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLK-YF 521

Query: 200 ISFNSTA---VLPRAVLTLTILCGCFTI-------ICAIFTY----LQLAIVKEGMTTNE 245
              +      +L    L   ++   FT        I A++ +    +QL  + +G+T +E
Sbjct: 522 DELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKGLTNSE 581

Query: 246 QDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKG 280
                 +   +REG+ V  +D  + + F     +G
Sbjct: 582 ------LNALIREGRRV-DIDSQTHNEFFNTVPEG 609

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183
           K  RS+  S+ N  V   DH+C W+ N +G  N+  F  F+
Sbjct: 478 KPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYL-FLFSNIFSMSYAFL 195
           K  RS+  S+ N  V   DH+C WV N IG  N+  F +  L   I  + + +L
Sbjct: 471 KPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILMLLFNYL 524

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195
           K  RSK        ++  DH C W+ N +G  N+ QF  FL S +  +S  F+
Sbjct: 461 KPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCFFI 513

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183
           K  RSK   + N  V   DH+C W+ N +G  N+  F  F+
Sbjct: 479 KPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF 184
           C    T K  RSK+  + N  V   DH C W+ N +G  N+  F  F+ 
Sbjct: 474 CLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 24/55 (43%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSM 190
           C      K  RSK+       V   +H+C WV N IG  N+  F  F FS  + M
Sbjct: 431 CVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQYEM 485

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 143 KAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFS 185
           K  R K  S  +R VL  DH+C WV N +G  N+ +F  ++ S
Sbjct: 467 KPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMS 509

>Suva_6.17 Chr6 (24763..26385) [1623 bp, 540 aa] {ON} YFL040W (REAL)
          Length = 540

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/102 (20%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query: 190 MSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKW 249
           +++ +L  + ++F    ++     T  I+ G FT I ++         K GM+  + DK+
Sbjct: 431 ITFGWLGNFVLTFLCPVMIETLKGTTFIIFGGFTFIISLIVLFLFPETK-GMSMEDVDKF 489

Query: 250 YT----IQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPLQ 287
           +     +  ++ E K +++ D +S    ++ +E+G+  QP++
Sbjct: 490 FEFENRVDPHLHEEKGIKTPDSNSNIGSIRSSEEGELHQPIK 531

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNY---------LQFYLFLF 184
           C      K+ RSK+       V   DH+C W+ N IG  N+         +Q+++FLF
Sbjct: 442 CVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMTVQYHMFLF 499

>TBLA0C00150 Chr3 (20449..21702) [1254 bp, 417 aa] {ON} Anc_8.107
           YGL164C
          Length = 417

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 259 GKLVRSLDD--DSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDAS 316
           G+L++  DD  DS    +KF++  D   P +D+ V +Y  + YD     + + T  +D S
Sbjct: 281 GRLLKLDDDNEDSPVLIVKFSKLNDKDTPKEDKTVEWYGLSVYDEFPDEIDNETDNEDKS 340

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSM-SYAF 194
           C      K  RS++  + +  V   DH C W+ N IG  N+  F LF+   +  +  Y +
Sbjct: 479 CIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIGIWEYTY 538

Query: 195 LRLYF 199
           L + +
Sbjct: 539 LAMEY 543

>KNAG0A02800 Chr1 complement(331934..334735) [2802 bp, 933 aa] {ON}
           Anc_8.359 YLR148W
          Length = 933

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 47/131 (35%), Gaps = 23/131 (17%)

Query: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180
           EK+   Y +  PGV C +C  I   R      C  C         + N+C+ K       
Sbjct: 822 EKFRERYQILEPGVSCDSCHRILQTRKFLVFPCGHC---------FHNDCLIKK------ 866

Query: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
             L SN F      L+    +F       +    LT L    T  C + + L +  +   
Sbjct: 867 -ILLSNDF-----MLKSQIENFQKRLARDKKYGQLTELESLMTTKCCLCSDLNINTLDNL 920

Query: 241 MTTNEQD--KW 249
           +T N+ D  KW
Sbjct: 921 VTVNQADIEKW 931

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,655,170
Number of extensions: 1337472
Number of successful extensions: 4822
Number of sequences better than 10.0: 129
Number of HSP's gapped: 4797
Number of HSP's successfully gapped: 134
Length of query: 335
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 225
Effective length of database: 40,868,139
Effective search space: 9195331275
Effective search space used: 9195331275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)