Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2778.270ON64964933180.0
Skud_4.3788.270ON65264326020.0
Smik_4.3628.270ON64864224850.0
YDR118W (APC4)8.270ON65264824690.0
TDEL0F039708.270ON6194988831e-109
ZYRO0C01474g8.270ON5994778521e-105
KAFR0B054608.270ON6105188431e-103
Kpol_392.18.270ON4244217471e-91
KNAG0H031908.270ON6224256512e-75
NCAS0B037908.270ON6125736274e-72
TPHA0J007908.270ON6855296053e-68
NDAI0J012708.270ON7356305951e-66
CAGL0B01859g8.270ON6224265513e-61
TBLA0C045708.270ON6084035214e-57
KLTH0G13508g8.270ON6454134857e-52
Kwal_56.237668.270ON7404714763e-50
SAKL0H16852g8.270ON6444304621e-48
Ecym_43008.270ON7154031645e-11
AGR078C8.270ON7154291564e-10
KLLA0F19316g8.270ON6711961191e-05
YGL111W (NSA1)6.144ON46369724.1
TPHA0D001308.4ON72048706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.277
         (649 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...  1282   0.0  
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...  1006   0.0  
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   961   0.0  
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   955   0.0  
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   344   e-109
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   332   e-105
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   329   e-103
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   292   1e-91
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   255   2e-75
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   246   4e-72
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   237   3e-68
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   233   1e-66
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   216   3e-61
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   205   4e-57
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   191   7e-52
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   187   3e-50
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   182   1e-48
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    68   5e-11
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    65   4e-10
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    50   1e-05
YGL111W Chr7 (299978..301369) [1392 bp, 463 aa] {ON}  NSA1Consti...    32   4.1  
TPHA0D00130 Chr4 (14561..16723) [2163 bp, 720 aa] {ON} Anc_8.4 Y...    32   6.9  

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score = 1282 bits (3318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/649 (98%), Positives = 637/649 (98%)

Query: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60
           MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI
Sbjct: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60

Query: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120
           FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI
Sbjct: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120

Query: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180
           RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL
Sbjct: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180

Query: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240
           PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG
Sbjct: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240

Query: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300
           YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG
Sbjct: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300

Query: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLT 360
           EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQ       DLT
Sbjct: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLT 360

Query: 361 AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY 420
           AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY
Sbjct: 361 AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY 420

Query: 421 FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS 480
           FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS
Sbjct: 421 FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS 480

Query: 481 RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE 540
           RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE
Sbjct: 481 RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE 540

Query: 541 SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFXXXXXX 600
           SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNF      
Sbjct: 541 SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFGGEEDD 600

Query: 601 XXXXXXTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPKETSSIK 649
                 TITIPTYITENEKTEGFIACTTKISVDGRGASLVFPKETSSIK
Sbjct: 601 DEEDDGTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPKETSSIK 649

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/643 (74%), Positives = 553/643 (86%)

Query: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60
           +NDYFIDYNPRFPIFA R+ KGLAIHRVSDHAR+A+IPVRNIALVANY+WD ++GKFLSI
Sbjct: 5   INDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSI 64

Query: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120
           FFKDGT+RIHDIFKDGRLVSFLR+P TKISRGIWDRIPLK E  +  FA NVID+LPKLI
Sbjct: 65  FFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLI 124

Query: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180
           RFVKDSKRV+I PYTPPN LWRGPDEDDPE+ E LD+HVIFNEGNDKIT+FFNGDY ILL
Sbjct: 125 RFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILL 184

Query: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240
           P+ DIENE+IL+SVVKVQ+GFYHCFYNDG+V T NL+ LL+S+PSVDLL Y+MVIKELIG
Sbjct: 185 PMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIG 244

Query: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300
           YLLAH+E INREL TPY+DFVKRICDEAYGY+KLKSEL+CLFLLGEV  DL+DWLCN+VG
Sbjct: 245 YLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304

Query: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLT 360
           EKN K+WK LGCEAYQKT Q+ TL FVPTCERIIIFV+KL+G LEAFS+Q       DLT
Sbjct: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLT 364

Query: 361 AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY 420
           AVELLLK SQELLN TLKSII LG++ETLFEKF +WFNDRIHE LDEDYK KFEFEDDPY
Sbjct: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424

Query: 421 FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS 480
           FGYDLL +F+K LS R+TESSSVI+MKLYR+LIN+M+ MEKDIAKNNV+ HIQ+Q+L+  
Sbjct: 425 FGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQLLINI 484

Query: 481 RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE 540
           R DV+SQ YPSS++ LLDAIKL  Q+YIVYLI+VT+  + +E S   NT KLY+GTLKDE
Sbjct: 485 RKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGTLKDE 544

Query: 541 SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFXXXXXX 600
           SLDI+SRESSI++PE FK+Y  ++ARFA KMVPNFIRE E   S+Y  S N+ +      
Sbjct: 545 SLDIISRESSIRIPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTEEEND 604

Query: 601 XXXXXXTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPK 643
                 +ITIPTY+TENEK E +IACT+KISVDGR ASLVFPK
Sbjct: 605 NGEDDGSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPK 647

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/642 (71%), Positives = 531/642 (82%), Gaps = 1/642 (0%)

Query: 2   NDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIF 61
           NDYFIDYNPRFPIFA R  KGLAI+RVSDHARLA IP+RNI LVANYNWD  TGKFLSIF
Sbjct: 6   NDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIF 65

Query: 62  FKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIR 121
           FKDGTIRIHDIFKDGRLVSFLRIP TKIS+G WDRIPL+ ES N N A N+ID LPKLIR
Sbjct: 66  FKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIR 125

Query: 122 FVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLP 181
           +VKDSKR+ I PYTPPNSLWRGPDED+PEN E LDIH+IFNEG+DKITVFFNGDYAI +P
Sbjct: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVP 185

Query: 182 VSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGY 241
           V   ENE+ +KS+VK+Q+GFYHCFY+DGTV T NL  LL+SEPS+++L+Y+M IKELIGY
Sbjct: 186 VGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGY 245

Query: 242 LLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGE 301
           LL HIEFINREL TPY++FV R+CDEAYGY KL SEL+CLFLLGEV  DL+DWLCN+VGE
Sbjct: 246 LLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGE 305

Query: 302 KNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTA 361
           KNFKRWK LGCEAYQKT Q+ TL FVP CERIIIFV+KL+GILEAFSIQ       DLTA
Sbjct: 306 KNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSDLTA 365

Query: 362 VELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYF 421
           V+ LLK SQELL ITLKSI+DLGKDETLFE F +W NDRIHEVLDEDYK K +FEDDPYF
Sbjct: 366 VDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYF 425

Query: 422 GYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQSR 481
           GYDLL +F   +S+R  E+S V++MKLYRDLINSM+ MEK+IA++NVN HIQ+ +LV+SR
Sbjct: 426 GYDLLTYFHN-ISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHILVESR 484

Query: 482 ADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDES 541
            DV+S+ YPSS+I + DA+KL K NYI+YLIQVTE+K  QEA  E + +KLYIGTLKD++
Sbjct: 485 TDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTLKDDN 544

Query: 542 LDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFXXXXXXX 601
           LD++SRESSIK+PELF+ Y  + ARF  K VPN IRE E  + +Y+  HN  +       
Sbjct: 545 LDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKEGDDEN 604

Query: 602 XXXXXTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPK 643
                 ITIPTYIT NEK+E FIACT KISVDGR ASLVFPK
Sbjct: 605 GEDDGAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPK 646

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/648 (70%), Positives = 536/648 (82%)

Query: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60
           +NDYFIDYNP FPIFA R+ KGLAI+RVSDHARLAVIP+RNI LVANY+WD +TGKFLSI
Sbjct: 5   INDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSI 64

Query: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120
           FFKDGTIRIHDIFKDGRLVSFLRIP TKIS+GIWDRIPL+YE +NR+FA N+ID LPKLI
Sbjct: 65  FFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLI 124

Query: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180
           RFVKDSKR+ I PYT PNSLWRGPDEDD ++ E LD+HV+FNEGNDKITVFFNGDYA+ L
Sbjct: 125 RFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFL 184

Query: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240
            V +IENE  LKS++KVQ+GFY CFY DGTV T NL  LLQS+ SV+LL Y+MVIKELIG
Sbjct: 185 SVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIG 244

Query: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300
           Y+L H+EFINREL TPY+DFVKR+CDEAYGY KLKSEL+ LFLLGE+  DL+DWLCN+VG
Sbjct: 245 YMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVG 304

Query: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLT 360
           EKNFKRWK LGCEAYQKTVQ+ TL FVP CERIII+V+KL+ IL+AFSIQ       DLT
Sbjct: 305 EKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLT 364

Query: 361 AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY 420
           AVE+LLK SQ+LL +TL SII LG+DETLFEKF +WFNDR+HE LDEDYK KF+FEDD Y
Sbjct: 365 AVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLY 424

Query: 421 FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS 480
           FGYDLL++F++ LS + TE SS+ID+KLYRDLINSM+ MEKDIA++NVN HIQ+ +LV  
Sbjct: 425 FGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDL 484

Query: 481 RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE 540
           + DVF+Q+YPSS+INLLDAIKL K NYIVYLIQVT+    QE   E N +KLYIGTLKDE
Sbjct: 485 KTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDE 544

Query: 541 SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFXXXXXX 600
           +L I+S+ESS+K+P LFKSY L+S RF P  V + +R+    +S+Y+ SH T++      
Sbjct: 545 NLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRGENYE 604

Query: 601 XXXXXXTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPKETSSI 648
                 TI IP YI EN + + FIACT K+SVDGR ASLVFPKE  ++
Sbjct: 605 NEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQNV 652

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  344 bits (883), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 174/498 (34%), Positives = 303/498 (60%), Gaps = 14/498 (2%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67
           YNP + ++A +  KGL+I RV+D+A++A + VR++ ++A + WD  TGK +++F+KDG  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 68  RIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSK 127
           RI+D F+ G+L++ LRI +T++   IWDRI L  +     F + V++ +PK+IRF +D++
Sbjct: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130

Query: 128 RVTIAPYTPPNSLWR-GPDEDDPENCEN--LDIHVIFNEGNDKITVFFNGDYAILLPVSD 184
           ++ I PY PPN  WR   +E+D    E   LD+H++  E N  + +  +GD+ + L    
Sbjct: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG-LVLMLDGDFILRLAAG- 188

Query: 185 IENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLA 244
             +   LK +V    G YHCFY D TV + +L++L+Q + ++ L+++ + IK+L  YL  
Sbjct: 189 -PSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247

Query: 245 HIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNF 304
           H++ I R+L  PY +F+ +ICD A+GY  L  EL+ L L G +  +L++W C  VGEKNF
Sbjct: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYTVGEKNF 307

Query: 305 KRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTAVEL 364
           K+WK +G E YQKT+Q+ TL+F+P CER+I+  ++ +  L+A  +        D +    
Sbjct: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL-IESSTTTDSSEFAN 366

Query: 365 LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYFGYD 424
           L   SQ  L  T+++I  +   E LF+ FL WF+DR+HE LDEDYK K   + +   GY 
Sbjct: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQ 426

Query: 425 LLNFFE-KFLSDRNTE-SSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQSRA 482
           +  + + +   D+ +E  +  + ++ +++++++M+   + I    + P + +++   +R 
Sbjct: 427 IATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKITRVNRH 486

Query: 483 DVFSQRYPSSKINLLDAI 500
           ++     P+S+  +L A+
Sbjct: 487 NL-----PNSENQILLAV 499

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/477 (37%), Positives = 282/477 (59%), Gaps = 22/477 (4%)

Query: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60
           M+  ++DYNP +P++  +  +G ++HR++D AR+A I VR+++ VA Y WD  TGKFLSI
Sbjct: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60

Query: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSN---RNFANNVIDVLP 117
           F+KDGT+RI+D F+ GRLVS LR        GIWDRI L +   N    +  ++V +++P
Sbjct: 61  FYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120

Query: 118 KLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYA 177
           K+++F +DS+++ + PYT P+ +WR    DD      LD HVI    +D ++V F+G++ 
Sbjct: 121 KMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNAL--LDAHVI--RCHDSLSVMFDGEFT 176

Query: 178 ILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKE 237
           I + ++ I +   L   V  Q+  Y  FY DG+V  F+L  L++   S+ LL+ ++ +++
Sbjct: 177 ISIQLAAIPSP--LVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQ 233

Query: 238 LIGYLLAHIEFINRELTTPYMDFVKRICDEAY-GYSKLKSELKCLFLLGEVPSDLDDWLC 296
           L  YL  HIE I R+L  PY +F++R C  A+ GY  L+ +L  L L+G+V  +L+DWL 
Sbjct: 234 LHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLV 293

Query: 297 NAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXX 356
           N++GEKN KRW+ LG +AY KT+QV TLA +P CER+I   Q+  G L +  +       
Sbjct: 294 NSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPLL 353

Query: 357 XDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFE 416
             +  ++  LK         L++I  L   + L   FL WF+DR+ E +DEDYK +F   
Sbjct: 354 PPIDCLQFFLKN-------VLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLH 406

Query: 417 DDPYFGYDLLNFFEKFLSDRNTESSSVID----MKLYRDLINSMTAMEKDIAKNNVN 469
           D+   G D  ++ +  L + + E SSV D    +    D ++S+ ++  D   + +N
Sbjct: 407 DNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKIN 463

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  329 bits (843), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 168/518 (32%), Positives = 294/518 (56%), Gaps = 18/518 (3%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67
           YN + P++  +  KGL ++R SD+  +A   ++   LVA   WD  +GK+LSIFF+DG+I
Sbjct: 14  YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRDGSI 73

Query: 68  RIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSK 127
           RI D+FKDG+LV+FLR     +    WDRI  +  +  + F  N++D++P LI+FV  + 
Sbjct: 74  RIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFVSSAN 133

Query: 128 RVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL--PVSDI 185
           ++++ PYTP N+ WR  D    +N   +D+H +     D   +  NGDY + L  P +D+
Sbjct: 134 KLSLIPYTPSNANWRELDAKWKKN-RVIDMHCLHQSETDSFLMVLNGDYYLTLKTPETDL 192

Query: 186 ENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAH 245
             +    S++K  N  Y C Y DG+    +    L S+  +DLL  ++ +K++  Y   H
Sbjct: 193 SEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNH 252

Query: 246 IEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFK 305
           ++ + R +  PY+DF+++ICD A+G  KL +ELK  FLLG +  +L DWL  +VG+KN  
Sbjct: 253 LDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGDKNVT 312

Query: 306 RWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTAVELL 365
           +W+ L  +AYQ+T ++FT+A +  CER+I+  ++  G++ AF  +        L  +  L
Sbjct: 313 QWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSRLHELNEL 372

Query: 366 LKQSQELLNITLKSIIDLGKDET----LFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYF 421
           +   Q++L    KSII   ++      + + FL W NDR+HE LD+DYKP+     +   
Sbjct: 373 MSNLQDML----KSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSNT 428

Query: 422 GYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNN---VNPHIQRQVLV 478
            Y L   FE  L +   +S  +++  + +   +++  +E +I++ N   + P ++ ++ +
Sbjct: 429 CYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPILENKIAI 485

Query: 479 QSRADVFSQRY-PSSKINLLDAIKLSKQNYIVYLIQVT 515
            ++   F   Y P   + + D +K+S+  Y++Y++Q++
Sbjct: 486 DTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLS 523

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  292 bits (747), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 243/421 (57%), Gaps = 20/421 (4%)

Query: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63
           Y+  YNP F ++  R  +GLA++R+ D ++LA I +++   VA Y WD  +G+F+S+F  
Sbjct: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69

Query: 64  DGTIRIHDIFKDGRLVSFLRIPRTK-ISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRF 122
           DGTIRI+DIFK+GRLVS++R    K +   +WDR      S  + F +N+I+ LP LI+F
Sbjct: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129

Query: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCEN------LDIHVIFNEGNDKITVFFNGDY 176
           VKDS+ + I  Y PPN  WR  D++  +  +       LD+H+  N   D  T+  NG Y
Sbjct: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189

Query: 177 ---AILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMM 233
               I++P  DI   ++ + ++K+ NG Y  FY +G     N   LL    S  LL  ++
Sbjct: 190 EINGIVMP--DISKSEVYQ-LLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246

Query: 234 VIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAY--GYSKLKSELKCLFLLGEVPSDL 291
            I+ L  Y+  H++ I REL  PY DFVK+IC +AY  G +KL  EL+ L L GE+ ++ 
Sbjct: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306

Query: 292 DDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX 351
            DWL N +G++N K+W+ LG + ++K V++ TLA +P+CER +I++++  G L  +    
Sbjct: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY---- 362

Query: 352 XXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKP 411
                 D   +  L +   +L+  ++  I  L      FE F  W ND+I+E+ DEDYK 
Sbjct: 363 -MKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKN 421

Query: 412 K 412
           +
Sbjct: 422 R 422

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  255 bits (651), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 233/425 (54%), Gaps = 7/425 (1%)

Query: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63
           ++ + N   P++  R  K L ++R +D + +A   +R+ + V +Y WD   G+ +S+ F+
Sbjct: 11  FYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQ 70

Query: 64  DGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVI-DVLPKLIRF 122
           DG+IRI+D+  D +LV+ LR  RT +   +WDRI L   + +  +  ++I   LP+L++F
Sbjct: 71  DGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKF 130

Query: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPV 182
           +      +++PY P N  WR P+         LD+H +  +  D +    NG+Y + L  
Sbjct: 131 MGSDASPSMSPYLPTNHSWRFPNSGAAGGI--LDVHFLHQKLGDTLVALLNGEYQLQLTG 188

Query: 183 SDIENEKILKSVVKVQNG---FYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELI 239
              E++  L+ ++   +     Y+C+Y  G V   +L   ++ + ++ LL   ++ ++ +
Sbjct: 189 PHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYL 248

Query: 240 GYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAV 299
           GY LAH+E I  E   PY +F++R+C++A+G  KL+  L   FL+G +  +L DWL  ++
Sbjct: 249 GYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSL 308

Query: 300 GEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKG-ILEAFSIQXXXXXXXD 358
           GE+N + WK L   AY++T QV  +  VP  ER+II  ++L+  +L A   +       +
Sbjct: 309 GERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE 368

Query: 359 LTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDD 418
           ++    LL+  QELL + L+++  L KD    + FL+W  + +   +++DY P F   + 
Sbjct: 369 ISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSEC 428

Query: 419 PYFGY 423
             FG+
Sbjct: 429 GKFGF 433

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  246 bits (627), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 152/573 (26%), Positives = 280/573 (48%), Gaps = 18/573 (3%)

Query: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60
           + +  + YNP +P    +   G A+ R  D  ++  I +RN+  V    W+     +L++
Sbjct: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63

Query: 61  FFKDGTIRIHDIFKDGRLVSFLRIP---RTKISRGIWDRIPLKYESSNRNFANNVIDVLP 117
            F DG+ RIHDIF++G+L++ LR+    +  +  GIW ++ ++ + +   F  ++  ++P
Sbjct: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMP 123

Query: 118 KLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYA 177
             I+FV ++ ++ + PY    + WR  D+    N + +DIH+  N   D+  +  NG Y 
Sbjct: 124 SPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVN-DIIDIHMAHNSNTDEYLLMINGVYK 182

Query: 178 ILL-PVSDIEN--EKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMV 234
           + + P S  EN   ++ K +   +   +HCFY D   ST +L  L++S P V LL  +  
Sbjct: 183 LTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTE 242

Query: 235 IKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDW 294
           +K+L  Y++ H++ I+ +L  P  DF++           L   LK   L G +   L+ W
Sbjct: 243 MKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHW 300

Query: 295 LCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXX 354
           LCN VGEKN K+WK L    YQK +Q+ +LA +P  E++ +   + + ++ A ++     
Sbjct: 301 LCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALP-ASG 359

Query: 355 XXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFE 414
              +L   + L + +  L N  L       ++E     F++W  D I E +DEDY PK  
Sbjct: 360 HMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLN 419

Query: 415 FEDDPYFGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQR 474
             +D      L+   ++F  D  T+  S     L ++L+ S++   ++I  + V   + +
Sbjct: 420 ICEDGSVVPTLMEIIDQFFQD-TTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLK 478

Query: 475 QVLVQSRADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYI 534
            + ++  A  F++ +    + +LD    +K  ++VYL++        +AS++      YI
Sbjct: 479 TMKIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVEKRSNTQDVKASVK------YI 531

Query: 535 GTLKDESLDIVSRESSIKMPELFKSYDLNSARF 567
           GT    +L  +S    +  P    S  +   +F
Sbjct: 532 GTANSINLRTISAAKKVNYPLSIDSASIQKVKF 564

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  237 bits (605), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/529 (28%), Positives = 269/529 (50%), Gaps = 22/529 (4%)

Query: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63
           Y+   NP + ++  +  KGLAI  +SDH+ LA I +++ +LV ++ WD  TGKFL   F 
Sbjct: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69

Query: 64  DGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLK--YESSNRNFANNVIDVLPKLIR 121
           DG+IR++DIFK GRLVSF R P  +I    WDRI +    +   + F  ++ + +P L++
Sbjct: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVK 129

Query: 122 FVKDSKRVTIAPYTPPNSLWRGPDEDDPENCEN----------LDIHVIFNE-GNDKITV 170
           FVKD + + + P       WR  D D     EN          LDIH+++ E G D   V
Sbjct: 130 FVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAV 189

Query: 171 FFNGDYAIL-LPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLL 229
             NG Y +  + V +    K++K +VK   G Y  FY + +    ++     ++  V+LL
Sbjct: 190 LVNGVYDLSDIHVPNRSPNKVIK-LVKASQGKYLGFYENASYRLIDVTPFSSNDIRVNLL 248

Query: 230 RYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAY-GYSKLKSELKCLFLLGEVP 288
              + ++  +  L   IE I +EL +P+  F+  +C +AY GY  L   +  L L GE+ 
Sbjct: 249 NNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEIS 308

Query: 289 SDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFS 348
            + +DWL N +GE+N ++WK LG E   K VQ+ +L F+P  E+ II  ++++  + A  
Sbjct: 309 EEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMR 368

Query: 349 IQXXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDED 408
           +        + + +  L+     +L  ++K I  L  D+  FE F+ W  + I+ ++DE+
Sbjct: 369 LSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYLIIDEN 428

Query: 409 YKPKFEFEDDPYFGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNV 468
           YK K        + +D+  +      D N    +V+D   +    N +      I +  +
Sbjct: 429 YKSKLSLSSSNSYPFDIQKYINLQFKDHNKAILTVVDE--FETYANKILIDLDMIDEKLI 486

Query: 469 NPHIQRQVLVQSRADVFSQR----YPSSKINLLDAIKLSKQNYIVYLIQ 513
            PH++  +++    D   Q     + SS + +LD +++ +++  +++++
Sbjct: 487 KPHLKTSIIISDIIDNTLQNSNKIFESSNLKVLDVLRIEEKSCFLFVVK 535

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  233 bits (595), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 173/630 (27%), Positives = 288/630 (45%), Gaps = 96/630 (15%)

Query: 9   NPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTIR 68
           NP FP++  +    +   R  D  +++ I +RN+  V   +WD  TGK+L+I F DGT R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 69  IHDIFKDGRLVSFLRIPR--------TKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120
           I+DIF+DG+L++ +R  R        TK+   IWDR+ +        F +++  ++P LI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 121 RFVKDSKRVTIAPYT--PPNSLWR--------------------GPDEDDPENCENLDIH 158
           +FVKDS  + I PY+     ++WR                      +++  ++   LD+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 159 VIFNEGNDKITVFFNGDYAILL---PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFN 215
           +I     D  T+  NG Y I L    ++     KI++ +    +G YHCF+ +G++ +  
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267

Query: 216 LERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFV-KRICDEAY--GYS 272
                 S   V+LL   M I E+I Y   H++ IN+ L   + DF+   I +E    G +
Sbjct: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327

Query: 273 KLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCER 332
            +  +LK   L GE+  +L +WL  ++GEKN K+WK L  E Y K++Q+F+LA +P CE 
Sbjct: 328 SMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387

Query: 333 IIIFVQKLKGILEAFSIQXXX--------XXXXDLTAVELLLKQSQ----------ELLN 374
            ++  QK   IL A  I+                 T +EL  +Q +          EL+ 
Sbjct: 388 TLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLELIE 447

Query: 375 I----------TLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYFGYD 424
           I           L+ I  + K  +L   FL W  + I   LDED+ PK +   +P    D
Sbjct: 448 ILQKFGSRCLQNLRKISYIEKQSSL---FLKWLQEMIFHALDEDHVPKLDTYSNPIICLD 504

Query: 425 LLNFFEKFL---SDRNTESSSVIDMKLYRD---------------LINSMTAMEKDIAKN 466
           L NF  K +   +D+N E        L  D               ++  +  + + I + 
Sbjct: 505 LSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEK 564

Query: 467 NVNPHIQRQVLVQSRADVFSQRY--PSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEAS 524
            + P +Q+ + +       ++R   PS +I + D +K+   + ++YL+QV   K +    
Sbjct: 565 GIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV---KSLDSRD 621

Query: 525 LERNTQKLYIGTLKDESLDIVSRESSIKMP 554
           L       Y+GT+    L  +     I+ P
Sbjct: 622 L------FYVGTINVVDLKPICHPKLIQFP 645

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  216 bits (551), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/426 (30%), Positives = 228/426 (53%), Gaps = 29/426 (6%)

Query: 3   DYFIDYNPRFPIFAIRV-VKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIF 61
           D F+ YNP++ +F +      L I R SD+  +  I VRNI L+ +Y WD   GK+L++F
Sbjct: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67

Query: 62  FKDGTIRIHDIFKDGRLVSFLRI-------PRTKISRGIWDR--IPLKYESSNRNFANNV 112
            KDG++RI+DIF  G+L+SFLR+        +  +   +WDR  IP    S  R   N++
Sbjct: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDL 127

Query: 113 IDVLPKLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFF 172
            + +P L++FV+D+K++ I P      LWR    ++    + +D+H+ ++  + ++T+  
Sbjct: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEK---KVVDVHLGYSCSSAQVTILI 184

Query: 173 NGDYAILLPVSDIE--NEKILKSVVKVQ--NGFYHCFYNDGTVSTFNLERLLQSEPSVDL 228
           NG+Y I   VSDI    +KI  S+ K +     Y   ++D +    +L  +L ++  +DL
Sbjct: 185 NGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDL 244

Query: 229 LRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVP 288
           +   + +      +  H   I + +  PY +F++ I     G + L   L+ LFL+GE+ 
Sbjct: 245 IETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIG----GINDLDV-LERLFLIGELD 299

Query: 289 SDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFS 348
           + L +W    + EKN K+W  LG E Y    QV  + FVP CER+++   ++ G+++   
Sbjct: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGID 359

Query: 349 IQXXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEK-FLMWFNDRIHEVLDE 407
           +Q             L + + Q  LN+ LK + +L +DET F++ FL W  D+++E ++ 
Sbjct: 360 LQESQETSL------LDISELQSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINN 413

Query: 408 DYKPKF 413
           +YK  F
Sbjct: 414 EYKSVF 419

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  205 bits (521), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 115/403 (28%), Positives = 210/403 (52%), Gaps = 7/403 (1%)

Query: 9   NPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTIR 68
           NP  P+   +   GL + R +D + +    +RN   +  Y W+ + G +++IFF+ GT+ 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 69  IHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSKR 128
           I+D  K  RL++ L   +  +  GIWDR     ++    F +++   +P LI+ ++D ++
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132

Query: 129 VTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPVSDIENE 188
           +    Y PP+S WR   E+  +N E LDIH++ +  +D  T   NG+  +  P +     
Sbjct: 133 ICPGTYFPPHSTWRAKKEESLKN-EFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191

Query: 189 KILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEF 248
            I   ++K +N  + CFY D TV   +   LLQ + +  L+ + + I  L+ YL  HI F
Sbjct: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249

Query: 249 INRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFKRWK 308
           I   ++TP+ +F+  +  EA     +   L  + + G + ++L++W+ N +G KN  RW 
Sbjct: 250 IKDNMSTPFNEFLTSVKGEAT-QEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308

Query: 309 VLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX---XXXXXXDLTAVELL 365
            LG   Y+K V + TL  +P CER +I V +L+G++E   ++          + + +E +
Sbjct: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIENV 368

Query: 366 LKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDED 408
              ++  +   L+ +  L   + LFEKFL WF++ +  V+ ++
Sbjct: 369 KHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDE 411

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  191 bits (485), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 202/413 (48%), Gaps = 21/413 (5%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67
           +NPR  ++ +   K ++++R  D  R+A + +R    +    W+++ GK  ++FF +G +
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80

Query: 68  RIHDIFKDGRLVSFLRI------PRTKISRGIWDRIPL-KYESSNRNFANNVIDVLPKLI 120
           RI+D    G L   + +          +   +W      ++    +     +   LP ++
Sbjct: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140

Query: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180
           R V+D+K++++ P       W      DP   ++  I +  +E +    +  +G  ++ +
Sbjct: 141 RLVRDAKQLSVVPLETGKLRWLA----DPG--KDAAIFLGHDEKSGDYLMTVDGLLSVRV 194

Query: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240
           P    +  KIL+   + ++G +     DGTV    L R L S    +L+RY   I+ L  
Sbjct: 195 PSGIKKMHKILR---QGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRFLCS 250

Query: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300
           YL  +I     +L  PY  F+ RI D AY   +L S  + + L G +P DL+DWLCN++G
Sbjct: 251 YLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLEDWLCNSIG 309

Query: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX---XXXXXX 357
           +KN+KRWK L    Y     V  LA +P CER+I+  ++L+GI +   +Q          
Sbjct: 310 DKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEF 369

Query: 358 DLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYK 410
           +   V  L+   Q LL+ +L+ ++DL +D  L   F  WF D + E +DEDYK
Sbjct: 370 ESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  187 bits (476), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 132/471 (28%), Positives = 229/471 (48%), Gaps = 36/471 (7%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTI 67
           +NPR  ++ +   K +A++RV D  ++A + +R+   +    W+ +  K  ++F  +G +
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80

Query: 68  RIHDIFKDGRLVSFLRI------PRTKISRGIWDRIP-LKYESSNRNFANNVIDVLPKLI 120
           RI+D    G L   + +         K+   +W  +   K+  S R    ++  ++P ++
Sbjct: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140

Query: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180
           R V+DSK++++AP       W      D        I +  +  + +  V  +G  ++  
Sbjct: 141 RLVRDSKQLSLAPLDLGKLSWLDGKYGDAA------IFLAHDCESTEYMVAIDGQLSLRF 194

Query: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240
           P S I N  + K + +  +G +     DGT+    L + L+     +L++    I+ L  
Sbjct: 195 P-SGIRN--VHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250

Query: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300
           YL  ++   + EL  PY  F+ R+   AY    L + L+ + L G +P DL++WLCN+VG
Sbjct: 251 YLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDLEEWLCNSVG 309

Query: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX-XXXXXXDL 359
           +KN+KRWK L    Y     V TLA VP CER+I+  ++++GI ++  +Q        +L
Sbjct: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369

Query: 360 TAVEL--LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYK------- 410
           T VEL  L+ + Q LL  TL  I +L +D  L + F  WF D + E +DEDYK       
Sbjct: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYKRPSRDGI 429

Query: 411 PKFEFEDDPYFGY-----DLLNFFEKFLSD---RNTESSSVIDMKLYRDLI 453
           P   +  D Y  Y     + +  FE  L +   R   S++++D K  R+ +
Sbjct: 430 PLDSYGLDQYLSYCWQSSETIQRFETSLPELAARPGVSAALLDRKYTREWL 480

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  182 bits (462), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/430 (26%), Positives = 209/430 (48%), Gaps = 23/430 (5%)

Query: 6   IDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDG 65
           I +NP   +F +  VKG+A++R  D  R+A + V++   + +Y W+ S G+  ++   +G
Sbjct: 18  IVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNG 77

Query: 66  TIRIHDIFKDGRLVS--FLRIPRTKISRGIWDRIPLKYESSNRN-FANNVIDVLPKLIRF 122
            IR++D    G+ V    L      + +  W +    + S   N F + +  ++P+L++F
Sbjct: 78  IIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKF 137

Query: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPV 182
           VKDS+++T+ P    + + R    D  ++     I + ++    KI +  +G + +   V
Sbjct: 138 VKDSRQLTMLPTDVGDGVPRWSKLDGNKSF----IFLGYDSKRQKILMAIDGAFKLSFSV 193

Query: 183 SDI--------ENEKI---LKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRY 231
           + +        E + +   ++ ++K  NG Y    +D  +     +  L    + +++  
Sbjct: 194 AALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMISC 252

Query: 232 MMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDL 291
              I+ L   L   +  +  EL  PY  F++R+     G   L  +L  L   G VP +L
Sbjct: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELLFTGSVPPEL 310

Query: 292 DDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX 351
           +DWL N +G+KN +RWK L    Y+  V++  L  VP CER+I+  ++L GI++   +  
Sbjct: 311 EDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLIG 370

Query: 352 XXXXXXDLTAVEL--LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDY 409
                 +L  +E   L+  SQE L   + SI  +  D  L E F+ WF+D + E +DEDY
Sbjct: 371 LKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDEDY 430

Query: 410 KPKFEFEDDP 419
           K K  +  DP
Sbjct: 431 KRKTSYNCDP 440

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/403 (18%), Positives = 165/403 (40%), Gaps = 31/403 (7%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVR--NIALVANYNWDVSTGKFLSIFFKDG 65
           +N R  ++ I     + I R  D  ++  IP+R  +   +     + + G   ++  + G
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79

Query: 66  TIRIHDIFKD---------GRLVSFLRIPRTK---ISRGIWDRIPLKYESSNR-NFANNV 112
           +++++   +D           +V  + + R +   + + +W+RI  K   + + +F   +
Sbjct: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139

Query: 113 IDVLPKLIRF-VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVF 171
              LPKL    V    ++T  P       W     ++  N     + + ++    K+ V 
Sbjct: 140 TQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESN-----MFLTYDNATRKVMVS 194

Query: 172 FNGDYAILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRY 231
            +G +       +    K+   +    N +      D  +    LE   +S    +L++ 
Sbjct: 195 IDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE-FTESHQMHELMKC 253

Query: 232 MMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLG-EVPSD 290
              I+ L+ YL  + + I  +L  P+  F+  +  +    S+L   LK +F LG     +
Sbjct: 254 CSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGLKDVFYLGYSAEKN 312

Query: 291 LDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQ 350
           +++W    +G      WK      +  +  +     +P CER+I+ V++L+G++++  + 
Sbjct: 313 IENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLN 372

Query: 351 XXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKF 393
                  +    EL+  +  ELL + L ++ ++ K     EKF
Sbjct: 373 IFGLDDDE----ELIAPEVDELLQMGLDTLTEIVKQ---VEKF 408

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 86/429 (20%), Positives = 177/429 (41%), Gaps = 40/429 (9%)

Query: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVR---NIALVANYNWDVSTGKFLSIFFKD 64
           +N R  ++ +   + L+I R  D  R+  IP+R   N  L+    W+   G+  ++  + 
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78

Query: 65  GTIRIH---------DIFKDGRLVSFLRIPRT---KISRGIWDRIPLKY-ESSNRNFANN 111
           G+++I+         +  +   LV  + + R    ++ + +W+RI  +  E     F + 
Sbjct: 79  GSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEFDSP 138

Query: 112 VIDVLPKLIRF-VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITV 170
           ++  LP+L    +    ++   P       + GP+ +     +  ++ + F+    K+ +
Sbjct: 139 LVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTRKVVL 193

Query: 171 FFNGDYAILLPVSDIENEKILKSVVKVQNGF--YHCFYND--GTVSTFNLERLLQSEPSV 226
             +G +         E  K    V  +  G   ++ F ND    +    LE   +     
Sbjct: 194 SIDGTFNFRYG----EKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE-FTEYHQVH 248

Query: 227 DLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLG- 285
           +L++    I+ L+ Y+  +   I  +L  P+  F   +  E   ++K    LK +F LG 
Sbjct: 249 ELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKDVFYLGY 307

Query: 286 EVPSDLDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILE 345
                +++W    +G      WK      +  +  V     +P CER+I+  ++L G+++
Sbjct: 308 SDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVK 367

Query: 346 AFSIQX-XXXXXXDLTAVEL--LLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIH 402
           +  +         +LTAVE+  LL+ S  LL   ++ +      E + +  L W    + 
Sbjct: 368 SLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLAWIEYMMD 427

Query: 403 EVL---DED 408
            +L   DED
Sbjct: 428 SLLHNEDED 436

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 88/196 (44%), Gaps = 10/196 (5%)

Query: 155 LDIHVIFNEGNDKITVFFNGDYAILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTF 214
           +DI +  +   +K+ +   G   I +    ++  K +K ++KV +G Y C   D +    
Sbjct: 157 IDIFMAIDSKTNKLILSIEGTLNIKVG-EKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVL 215

Query: 215 NLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKL 274
           +L   LQ      L++       L+ YL      +  +LT PY +FV+ +  E +     
Sbjct: 216 DLT-FLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH----- 269

Query: 275 KSELKCLFLLGEVPSDLDDWLCNAVGEKNFK--RWKVLGCEAYQKTVQVFTLAFVPTCER 332
           K+ L+ LF +G    ++ + L + V  + F+  +W  L  +    ++ +     +P  ER
Sbjct: 270 KNALQELFYIGVTKLEVMEEL-HEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLER 328

Query: 333 IIIFVQKLKGILEAFS 348
           +I+    ++ + EA +
Sbjct: 329 MIVLAASIEALCEAIT 344

>YGL111W Chr7 (299978..301369) [1392 bp, 463 aa] {ON}
           NSA1Constituent of 66S pre-ribosomal particles, involved
           in 60S ribosomal subunit biogenesis
          Length = 463

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 66  TIRIHDIFKDGRL--VSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFV 123
           T  + D+F D +L  +S   + RTK+  G     P+K +SSN  F       L  +I+  
Sbjct: 111 TSSVSDLFDDAKLESLSSKSVKRTKLVDGFVTLCPIKKDSSNNTFVAATKSGLLHIIKKG 170

Query: 124 KDSKRVTIA 132
           +D K + +A
Sbjct: 171 EDKKLIKLA 179

>TPHA0D00130 Chr4 (14561..16723) [2163 bp, 720 aa] {ON} Anc_8.4
           YFL047W
          Length = 720

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 191 LKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMM-VIKE 237
           LK++ KV   FY  F N  T    N++RL++SE ++D  + ++ +IKE
Sbjct: 395 LKAIKKVTFDFYSVFVNKITSIKLNVDRLMESEEAIDPTQDLLQLIKE 442

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,819,887
Number of extensions: 3322207
Number of successful extensions: 9852
Number of sequences better than 10.0: 45
Number of HSP's gapped: 10143
Number of HSP's successfully gapped: 46
Length of query: 649
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 533
Effective length of database: 40,180,143
Effective search space: 21416016219
Effective search space used: 21416016219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)