Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2768.269ON56555727740.0
Skud_4.3778.269ON56255723480.0
YDR117C (TMA64)8.269ON56555722870.0
Smik_4.3618.269ON56555722480.0
NCAS0B038008.269ON56556217240.0
TDEL0F039608.269ON55855816540.0
NDAI0J013108.269ON57957515410.0
KAFR0B054708.269ON56256115270.0
CAGL0B01837g8.269ON56957115250.0
ZYRO0C01496g8.269ON56755915200.0
TPHA0J007808.269ON58356215190.0
Kpol_392.28.269ON56656314940.0
SAKL0H16874g8.269ON56356114900.0
KLTH0G13530g8.269ON57456314780.0
Kwal_56.237718.269ON56255814340.0
KLLA0F19294g8.269ON57056612261e-162
TBLA0I032008.269ON56356411671e-154
KNAG0H032008.269ON56157111571e-152
Ecym_43018.269ON56456511331e-148
AGR079W8.269ON54256210451e-135
KNAG0A053302.300ON51457810.26
SAKL0D08272g1.389ON1491133733.2
NDAI0C049508.441ON219114713.4
ZYRO0C02354g8.441ON22393696.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.276
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...  1073   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   909   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   885   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   870   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   668   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   641   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   598   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   592   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   592   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   590   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   589   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   580   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   578   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   573   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   556   0.0  
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   476   e-162
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   454   e-154
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   450   e-152
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   441   e-148
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   407   e-135
KNAG0A05330 Chr1 (787669..789210) [1542 bp, 514 aa] {ON} Anc_2.3...    36   0.26 
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    33   3.2  
NDAI0C04950 Chr3 (1146017..1146676) [660 bp, 219 aa] {ON} Anc_8....    32   3.4  
ZYRO0C02354g Chr3 complement(189771..190442) [672 bp, 223 aa] {O...    31   6.3  

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/557 (94%), Positives = 525/557 (94%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTR                LDHLSVSDVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540
           MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540

Query: 541 DHLNKSGVPNKWIDFEN 557
           DHLNKSGVPNKWIDFEN
Sbjct: 541 DHLNKSGVPNKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/557 (78%), Positives = 476/557 (85%), Gaps = 3/557 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTCKKQTNN+EYTFPTSTIKQTNF  QKS+G VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKHNEQLFPTVYSCWEN TLLPI+LTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R K+GTLCGVASR+APK+VLA+GIVEMDLPSY RV+GETGVAVK++HHFNDGLSKA KVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           L+PP A    S DEDI++ Q++  E  K  E  +                LDH SVSDVD
Sbjct: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           YFITRALYYTLTQDKSL LPIS SNFISNHIMRNLPPIDHNEVNVK+TSW+KSAKFLKH 
Sbjct: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHF 297

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TIVGK  DKDELKNFVPYK+G + SA+E GE+ NSKEKT GMMYS
Sbjct: 298 EKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           +TLYKPF++AKD +KEANL F+TYYTSQDIRSA++QYIS  NL D KDKGKVVMDDLL+N
Sbjct: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           MVNKKKK+ + AR++PRAQILDPLLANNFTEFYQI+KNDD+LL + P+KGSPPRIKI TE
Sbjct: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540
           MKIGRKVIT+VSNFE  QIDPE LA DLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII
Sbjct: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537

Query: 541 DHLNKSGVPNKWIDFEN 557
           DHLN  GVPNKWIDFEN
Sbjct: 538 DHLNNLGVPNKWIDFEN 554

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/557 (76%), Positives = 467/557 (83%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT +KQTNNEEY+F TSTIKQTNF+GQKS+GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKH EQLFPTVYSCWE   LLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RCKIGTLCG+AS+QAP+ VLA+GIVE+DLPS+ +VIGETGVAVKI+HHFNDGLSK FK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           LEPP      S+D +I + QIE  E  K  EK +                LDH +VSDVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           YFITRALYYTLTQDK L LPISASNFISNHIMRNLPPIDHNEVNVK+TSWKKSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TIVGKNTDKDELKNFVPYKLG + SA E  E+T SKEKTSGMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           LTLYKPFNLAKDL+KE NL   TYYTSQDIRSA++QYIS+KNL D KDKGKV+MDDLL++
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           MVNKKKK  + +R+I R +IL PLL NNFTEFYQI+K+DDTLL + PMKGS P IKIITE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540
           MKIGRKVIT+VSNFE  Q+DPE LAADLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540

Query: 541 DHLNKSGVPNKWIDFEN 557
           DHLNK G+P+KWIDFEN
Sbjct: 541 DHLNKLGIPSKWIDFEN 557

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/557 (75%), Positives = 474/557 (85%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTC KQTNNEEYTFPTS IKQTNF GQKS+GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PILFKEKH EQL+PTVYSCW+N +LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RC +GTLCGVA +Q+PK+VLA+G+VE+DLPSY RVIGETGVAVK++HHFNDGL KAFKVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           LEPP   +  SEDE+I++ Q E  E  K+ +K++                LDHL+VSDVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           YFITRALYY+LTQDK L LPISAS FISNHIMRNLPPIDHNEVNVK++SWKKSAKFLKH 
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TIVGKNTDKDELKNFVPYKLG ++ +K  GEN  SK++TSGMM+S
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           LTLYKPF+LAKDL++EA L   TYYTSQD+R+A+++YIS+KNL D KDK KVVMDDLL+N
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           MVNKKKK PD  R+I R++IL PLL+NNFTEFYQI++NDDTLL R PMKG PPRIKI+TE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540
           MKIGRKVITKVSNFE   IDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540

Query: 541 DHLNKSGVPNKWIDFEN 557
           D+LNKSG+P+KWIDFEN
Sbjct: 541 DYLNKSGIPSKWIDFEN 557

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/562 (59%), Positives = 409/562 (72%), Gaps = 11/562 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++YT P S +KQTNF    ++GT+YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH+ +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCKIGTLCGVASRQAP-KIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179
           + K+GTLCGVAS Q P ++V A+GIV MDLP + +V+GE+GVAV+I+HHF D L K+FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDV 239
            L+PP          D +  + E ++     E                   LDHLSV DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 240 DYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKH 299
           DYFITRALYYT+T D  L+LPISASNFIS HI +NLP +DHNEVN+K++SWKK+AKFLKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSK---EKTSG 356
                           T+VG N  KDELKNFVPYKLG +N     GEN  +K   +  SG
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSN-----GENKGAKKEGDSQSG 354

Query: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416
           MMYS+T YKP NLAKDL+KE+ +P +  Y   +IR  +  YI++KNLVD K+K  V++DD
Sbjct: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414

Query: 417 LLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIK 476
           LL+ MVNKK+ DP V+R I RAQIL+P L NNFTE +QIY +  T L ++PM+GSPPRIK
Sbjct: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIK 474

Query: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535
           I+TEMKIGRKVITKVSNFE   I+PE LAADLRK+CSGSTTIGE+ T  K+AEVQVQGPH
Sbjct: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534

Query: 536 GQLIIDHLNKSGVPNKWIDFEN 557
           GQ+IIDHLNK GVP KWID+EN
Sbjct: 535 GQIIIDHLNKLGVPTKWIDYEN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/558 (56%), Positives = 407/558 (72%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQ+CK+QT   +Y F TS +KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FKEKH E LFPTVYSCW    LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RC    +CG+ASR  PK++LA+G+V+++LPSYS VIG+ G+AVK++H+F DGL +AFK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           +EP      A    +    + E +   K TE  +                LD LSV DVD
Sbjct: 181 IEP------AVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVD 234

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           +F TRALYYT T D  L +PI+ASNFISNHI+ NLPP+D ++VN+K+TSWKK+AKFLKH 
Sbjct: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                           IVG N +KDELKNFVPYK     ++K   +N+N K+ + GMMYS
Sbjct: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASK---KNSN-KDSSPGMMYS 350

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
             LYKP NL KD ++ ++LP +  YT  +++ ++ QYI+ K LVD+K+K  V++DDLL++
Sbjct: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFD 410

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           M  +KKK  +  R + RAQI+DP +ANNFTEFYQ++K++DT L + P++G  PR+KI+TE
Sbjct: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLI 539
           MKIGRKV+T+VS+FE  ++DPE LAA+LRK+CSGSTTIGE+ T  K AEVQVQG HG LI
Sbjct: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530

Query: 540 IDHLNKSGVPNKWIDFEN 557
           ID+LNK G+P KWIDFE+
Sbjct: 531 IDYLNKQGIPTKWIDFES 548

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/575 (55%), Positives = 396/575 (68%), Gaps = 27/575 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTI-KQTNF--SGQKSLGTVY 57
           MFKKEPHIKALSNLKNS+RKKLLQT K QTN E Y F  S I KQTNF  +   S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDENNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
           T+++N PI FK KHN+ L+PTV++CW NH +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDPRCKIGTLCGVASRQAPK-IVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKA 176
           FD R   GTLCG+AS Q PK IV A+G+V+M++PS+ +V+GETGVAV+++HHF D L K 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVK-LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLS 235
           FK   L+P          E   +  +  ++ T+  E+ R                LDH  
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENR-------ESNEPDFEVLDHFK 233

Query: 236 VSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAK 295
             DVDYFITR+LYYT+TQD  + LPISASNFIS HI +NLP I HNEVN+K+TSWKK+AK
Sbjct: 234 TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAK 293

Query: 296 FLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNN--SAKEKGENTNSKEK 353
           FLKH                T+VG N  KDELKNFVPYK+G +   S      NTN K  
Sbjct: 294 FLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSD 353

Query: 354 TSGMMYSLTLYKPFNLAKDLVKEA-NLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKV 412
           T GMMYS T YKP N AKDL+K    +P +  YT Q+IR  +T YI+ KNL+D K+K  +
Sbjct: 354 TKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMI 413

Query: 413 VMDDLLYNMVNKKKKDPDVA-RVIPRAQILDPLLANNFTEFYQIYK---------NDDTL 462
           ++DDLL+NMV+K++ + + A R + R  IL+P+LANNFTE YQIY+          D   
Sbjct: 414 LLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEP 473

Query: 463 LSRTPMKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQ 522
           L ++P +G  P+I I+TEMKIGRKVITKVSNFE   I  + LAADLRK+CSGSTTIGE+ 
Sbjct: 474 LFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETM 533

Query: 523 TF-KSAEVQVQGPHGQLIIDHLNKS-GVPNKWIDF 555
           T  K+ EVQVQGPHGQ+IIDHLNK  GVP KWI++
Sbjct: 534 TSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/561 (52%), Positives = 389/561 (69%), Gaps = 12/561 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQT-NNEEYTFPTSTIKQTNFSGQKSLGTVYTD 59
           MFKKEP IKALS LKNS+RKKL+Q+ K Q  ++E+ +    +I QTNF    + GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  ENNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
            N+ PI+FK KH++ L+PT +  W N+ LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179
               IGT+C VA+++AP + +AVGIV+++LP Y +V+G+TGVAV+I+HHF D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLEPPAAFDVASEDE---DIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSV 236
           KLE PA+     ++E   D+       QE    TE                   LD L+V
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPP-----SGSEGPDDIAEVLDELTV 235

Query: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296
            DVDYFI RALY+T+ QD +L LP+ AS F+SNHIMRNLP +DH +VN+KRTSWKK+AKF
Sbjct: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295

Query: 297 LKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSG 356
           LK+                 IVG N DKDELKNFVPYK+G  N+AK+    ++S +    
Sbjct: 296 LKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIG--NTAKKAASKSDSTQTQGV 353

Query: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416
            + S+ LYKP NL +  +KE+N+     YTS +IR+ I  YI  KNLVD KDK  V++DD
Sbjct: 354 SVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDD 413

Query: 417 LLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIK 476
           LL+ MVN+K ++P   R+IPRA IL+PL+ANNF E++Q+YK D+T L + P+KG  P+I 
Sbjct: 414 LLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKID 473

Query: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHG 536
           I+TEMKIGRKV+T+VSNFE  +I PE LAADLRK+CSGSTTI E+   K +EVQVQGPHG
Sbjct: 474 IVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPHG 532

Query: 537 QLIIDHLNKSGVPNKWIDFEN 557
           QLIIDH NKSG+P+K+I FEN
Sbjct: 533 QLIIDHFNKSGIPSKFIQFEN 553

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/571 (54%), Positives = 396/571 (69%), Gaps = 27/571 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT+NEEY+F ++TIKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH+E+L+PTV +CW    L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R  +GT+CG+A ++ P +++AVGIV+M+LPS++RVIGETGVAV+IVHH  D L K FKVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LEPPAAF--------DVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLD 232
            EPPA          +    + DI   + ++ E    TEK +                LD
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKV-ESNSDTEKEK-------SNLDDMAEVLD 232

Query: 233 HLSVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPP-IDHNEVNVKRTSWK 291
            L + D+DYFITRALYYT++QD  L  P SASNF+SNHI  NLP   +  EVN+K++SWK
Sbjct: 233 ELRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWK 292

Query: 292 KSAKFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSK 351
           K+AKFLKH                TIV  N DKDE+K F+PY +  N  +    E  N+K
Sbjct: 293 KTAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAK 352

Query: 352 EKTSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGK 411
                 +  +TLYKP NLAKD +    +P +  Y   +I+  I +YI++K+LVD KDK  
Sbjct: 353 T----TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKC 408

Query: 412 VVMDDLLYNMVNKKKKDPDV-ARVIPRAQILDPLLANNFTEFYQIYK---NDDTLLSRTP 467
           V++DD+L  M+ KKK+D    +RVIPRA IL P+L NNF + Y +++   N+ T L++TP
Sbjct: 409 VLVDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTP 468

Query: 468 MKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGE--SQTFK 525
           +KG PP+I I+TEMKIGRKVITKVSNFE  QIDPE  AAD+RK CSGSTTIGE  S   K
Sbjct: 469 LKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKK 528

Query: 526 SAEVQVQGPHGQLIIDHLNKSGVPNKWIDFE 556
           +AEVQVQGPHGQLI+ +LN  G+PNKWIDFE
Sbjct: 529 TAEVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/559 (53%), Positives = 392/559 (70%), Gaps = 5/559 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK+PH+KALSNLKNSE KKLL TC+ QT N+EY+FPT  IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH   L+PTV++CW +  LLP+VLTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R K GT+CG+AS+ AP +V+AVG+V++DLPSY  V+G+TGVAV++VH+  DGLSK FKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
            EPP + + + E+E+ +   +E      ++++                  LD   + DVD
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEI--PSQEKAVDIDDIAEVLDEFRLEDVD 238

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
            F+TRALYYTLT D  L LPISASNFISNHI  NLP +DH +VNVK++SWKK+AKFLK+ 
Sbjct: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNF 298

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TI+G N  K EL+NF PY++   +       + N+K+  S  +  
Sbjct: 299 EKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRC 358

Query: 361 LTLYKPFNLAKDLVKEANL-PFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLY 419
            TLYKP NLAKD +++ +L P    YT+Q++++A+  YI+  NL D+K+K  V++DDLLY
Sbjct: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418

Query: 420 NMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIIT 479
           ++VNKK+KD    R++ RA I++PLLAN+FT  +QIYK D  L  + P +G+ P I+I+T
Sbjct: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLF-KNPSRGNLPNIEIVT 477

Query: 480 EMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQL 538
           EMKIGRKVIT+VS FE   ID + LAA LR++CSGSTTIGE+ T  K  EV VQGPHG L
Sbjct: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537

Query: 539 IIDHLNKSGVPNKWIDFEN 557
           IIDHLN  G+P KWI F+N
Sbjct: 538 IIDHLNSLGIPTKWIKFDN 556

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/562 (51%), Positives = 392/562 (69%), Gaps = 7/562 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+CK+Q N+ +Y FP+S IKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH++ LFP+VY+CW+N  LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R   G LCG+AS + P +V+A+GIV++DL SY++V+GETGVAV ++H+  DGLS +FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           LEPP       E  ++   Q + Q+       +                 L+ L V  +D
Sbjct: 181 LEPPETGAEVDETNEMLLNQ-DKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIID 239

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
            FIT++LYY+LT D  L  PISASNFISN+IM NLPP+D++ VN+K++SWKK+AKFL+H 
Sbjct: 240 DFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHF 299

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                           I G N +K ELK+FVPY+ G  NS K K + TN       MM S
Sbjct: 300 EKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQS 359

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           ++ YKP +L KDL++E+  P ++ YT+ ++R  IT+YI+ KNLVD+K+K  ++MDDL+Y+
Sbjct: 360 VSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDD----TLLSRTPMKGSPPRIK 476
           +V KKK   +  R+I RA +++P+  NNF E +QIYK  D      L + P++GS P+++
Sbjct: 420 LVYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478

Query: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535
           I+TEMKIGRKVIT+VSNFE   ID E LAADLRK+C+G+TTIGE+ T  K+AEVQVQGPH
Sbjct: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538

Query: 536 GQLIIDHLNKSGVPNKWIDFEN 557
            Q+II HLN   +P KWIDF+N
Sbjct: 539 SQVIIKHLNSLSIPTKWIDFKN 560

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/563 (53%), Positives = 399/563 (70%), Gaps = 12/563 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+CK QT + +Y FPTS IKQTNF+ Q S+G +YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
             +P+ FKEKH+E LFPTVY+CWE+ TLLPIVLTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R    T+CG+A+R  P  ++AVG+V++D+PSYS VIG+TGVAV ++H++ DG+S AFK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDH----LSV 236
            + P    V  +D+ +D T+ + Q     TE+ +                L      L+V
Sbjct: 181 RDIPTI--VGGKDKSVDATEND-QSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTV 237

Query: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296
            D+D+FITR+LYYTLT D  LA PI +S+FISNHIMRNLPP+DHN VN+K+TSWKKS+KF
Sbjct: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297

Query: 297 LKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSG 356
           LKH                TIVG N +K+ELK F PY++  ++S   K  N+N +E +  
Sbjct: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQE-SEN 356

Query: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416
           MMYSL  Y P   AK  +    LP++ +YT+ ++++A+T+YI  K LVD K+     +DD
Sbjct: 357 MMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDD 416

Query: 417 LLYNMV-NKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRI 475
            LY+M   KK  +P   R I RA +++    NNFTE YQ++KNDDT L++ P++GSPPRI
Sbjct: 417 RLYDMCYTKKSTNP--PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474

Query: 476 KIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGP 534
           KI+TEMKIGRK++T+VSNFE+  ID + LA DLR++CSGSTTIGE+ T  K+ EVQVQGP
Sbjct: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGP 534

Query: 535 HGQLIIDHLNKSGVPNKWIDFEN 557
           H ++IIDHLN   +P KWIDFEN
Sbjct: 535 HSKIIIDHLNSLSIPTKWIDFEN 557

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/561 (52%), Positives = 389/561 (69%), Gaps = 15/561 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y FPT  +KQT F GQ S GTVYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH   +FPTV++CW N  +LP+V TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           +C  G+L GVAS ++P+++ A+GIV++DLPSY+RVIGETGVAV I+H F+DGL KAFK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LEPPAAF-DVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDV 239
           LEPP A  D +S+ E+ +   ++  +  K    T                 L+ LS  D+
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATT---TQARMVNTEDASEQLNELSAEDI 237

Query: 240 DYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKH 299
           D+F+TR+LYYTLTQD  L LP++ASNF+SNHI+ NLPP+DHN++N+K++SWKKSAKFLKH
Sbjct: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297

Query: 300 XXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKT---SG 356
                            +VG N DKDELK FVPY++G +      GE T +K K    S 
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSH------GEPTQTKAKAQENSN 351

Query: 357 MMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDD 416
           MM +++LYKP + AK+  K  +LP    +T+Q++++A+  YI  KNLV+  DK  V++DD
Sbjct: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDD 411

Query: 417 LLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIK 476
            L+ M+N+  K  +  R I RAQI+ P LANNFTE +QI K D  L  +T +KG+ P I+
Sbjct: 412 TLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLF-KTALKGAIPEIQ 470

Query: 477 IITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPH 535
           I+TEMKIGRKV+TKVSNFE  Q+D E LAA+LRK CSGSTTIGE+ +  K+ EV VQGPH
Sbjct: 471 IVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPH 530

Query: 536 GQLIIDHLNKSGVPNKWIDFE 556
           G ++I  LN+ G+P KWI+F+
Sbjct: 531 GAIVIGMLNEYGIPTKWINFQ 551

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/563 (51%), Positives = 378/563 (67%), Gaps = 8/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEP IKALSNLKNSERK +   CK+QT + EY FP+  IKQT F    + GTV+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK ++ L+PTV++CW N  LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RC    +  VAS  AP +V A+GIV+++LP YSRVIGE+GVAV+IVH F D L K FKVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LEPP----AAFDVASEDE-DI-DNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHL 234
           L+PP    A  D  SE+E DI D+T +     +    K+                 L  L
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 235 SVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSA 294
            V DVD+F TR+LYY+L  D  L  PISASNF+SNHI+RNLPPIDH +VN+K+TSWKK+A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 295 KFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEK- 353
           KFLK+                TI+G +  K ELKNF PY++G   S+ EKG ++ + EK 
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 354 TSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413
            + +M +++LY+P +  K  +   +LP    +T QDI+SA+ +YIS KNLV   +K  V 
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 414 MDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPP 473
           +DDLLY++VN+  K  +  R I RAQI+ P+L  NF+E + I K D T L + P+KGS P
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 474 RIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQ 532
           +++I+TEMKIGRKV+TKVSNFE  Q+D + LA  LRK CSGSTTIGE+ T  K+ EV VQ
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 533 GPHGQLIIDHLNKSGVPNKWIDF 555
           GPHG  +I+ LN+SG+P KWI+F
Sbjct: 541 GPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/558 (50%), Positives = 371/558 (66%), Gaps = 6/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEP IKALSNLKNSERKKL   C++Q    +Y+FP+  IKQT F    + GTVYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK ++ L+PTV+SCW N  L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           RC    + GVAS  +P +V A+GIV+++LP YSRVIGE+GVAV+IVH F+D L KAFKVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVSDVD 240
           L+PP   D  +E +  +N+  E+    K   K                  L  LSV DVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHX 300
           +F TRALYYTLTQD  L +P SASNF+SNHI+RNLPP+DH +VN+K+TSWKK+AKFLKH 
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360
                          TIVG +  KDELK+FVPY+     +    G +T S+ + + MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYR-----TGGNSGGSTGSESEQNSMMKA 355

Query: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420
           L +YKP + AK  +   +L   + ++ Q+++ A+  YI+ K LV   +K  V +DDLL++
Sbjct: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415

Query: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480
           +VN+  K  +  R I RAQI+ P+L  NF E + + K D T L + P+KG  P+I+I+TE
Sbjct: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475

Query: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLI 539
           MKIGRKV+TKVSNFE  Q+D + LA  LRK CSGSTTIGE+ T  K+ EV VQGPHG  +
Sbjct: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAV 535

Query: 540 IDHLNKSGVPNKWIDFEN 557
           I+ LN+  +P KWI+F N
Sbjct: 536 IELLNQLAIPTKWINFVN 553

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  476 bits (1226), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 257/566 (45%), Positives = 352/566 (62%), Gaps = 15/566 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MF KEPHIK LSNLKNS+RKKL  T K+Q N EEY  PT+ IKQT+F      G++YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNTPILFKEKHNEQLFPTVYSCWE-NHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
           +N PI FK K  +QL+PT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179
              K G++ G+AS + P +V A+GI EMDL   S VIG  G+AV++VH+ +DGL KAFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLEPPAAFDVASEDEDIDNTQIEIQE---GTKTTEKT-RXXXXXXXXXXXXXXXXLDHLS 235
           +LEPPA   V    E I+ T IE Q    G +  E++                  L+ +S
Sbjct: 180 ELEPPA---VVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMS 236

Query: 236 VSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAK 295
           + DVD+ + RA+ Y++  D  + LPI AS FISNH+M+NLP +D N VN+K++SWKK+ K
Sbjct: 237 IEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATK 296

Query: 296 FLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTS 355
            LK+                T++  N +  +L N   YK     + K  G+ TN   K  
Sbjct: 297 LLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNK 356

Query: 356 GMMYS-LTLYKPFNLAKDLVK--EANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKV 412
              YS   LYKP +  +  +    A++P Q+YYT Q+++  +  Y++  NL+D ++K  V
Sbjct: 357 ITAYSGENLYKPMSACQRFITGITADVP-QSYYTQQELKKLLDLYVANNNLIDPENKSLV 415

Query: 413 VMDDLLYNMVNKKKKDPDVARVIPRAQILDP-LLANNFTEFYQIYKNDDTLLSRTPMKGS 471
             DD LY M N+  ++  + + I R  I+ P  L+ NF  ++QIYK +   L + P KG 
Sbjct: 416 KYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGP 474

Query: 472 PPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQV 531
            P ++I+TE KIGRKVIT+V+NFE  +ID E LAA LRK CSGSTTIGES++ K+AEVQV
Sbjct: 475 IPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQV 534

Query: 532 QGPHGQLIIDHLNKSGVPNKWIDFEN 557
           QGPHG ++I  LN  G+P KWI FEN
Sbjct: 535 QGPHGSIVISILNDYGIPTKWISFEN 560

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  454 bits (1167), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 234/564 (41%), Positives = 344/564 (60%), Gaps = 17/564 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK   I  LSNLKNSE + + QTC+   +N EY FP S +KQT F    + G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FK+K++  + PTVY+ WE    +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
           R K G +CG+AS + P  +LA+G+   D+ +    +G+TGVAV+++H ++D L+  FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LEPPAAFDVAS----EDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSV 236
           L PP   + ++    E    ++   EI E     +                   L+ L V
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 237 SDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKF 296
            D+D F+T++LYYT+TQ+ SL LPI +S F+S ++M+NLP +DHN+VN+K++SWKK+AKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 297 LKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSA---KEKGENTNSKEK 353
           LKH                TI G N +K +LK FVPY++G    A   K+K +N N    
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNKN---- 356

Query: 354 TSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413
               +  +TLY P            L  ++Y+TS +I SAI  YI+ KNL + KDK K+ 
Sbjct: 357 ---FLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKIS 413

Query: 414 MDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPP 473
           MDD+L+++V    K  +  R I R+Q+++P+L NNF  ++Q++ +D+  LS+ P KGSPP
Sbjct: 414 MDDVLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPP 472

Query: 474 RIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQG 533
            +K++TE     KVIT+VSNFE   ID + ++ +L+ +CSGST+I E      +EVQVQG
Sbjct: 473 TVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEVQVQG 530

Query: 534 PHGQLIIDHLNKSGVPNKWIDFEN 557
           PHG +++++  K G+P KW D+ N
Sbjct: 531 PHGDIVMEYFEKHGIPRKWFDYTN 554

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  450 bits (1157), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/571 (44%), Positives = 360/571 (63%), Gaps = 33/571 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK PHIK LSNLKNSE++KL Q  +KQ   +E+ F  +T+KQTNF    S+GT+Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NNTPI--LFKEKHNE-QLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
              P+   FKEKH    L+P+VY+CW +  LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSY--SRVIGETGVAVKIVHHFNDGLS 174
           FD      G  CG+A+ ++P +++AVG ++MDL  +  + V+G +GV V++ HHF DGL+
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KAFKVKLEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHL 234
            AF++KL+ P   + A+  E  +   +E +  +  T                    L+ L
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAEEPPVEAKPTSPVTNPV---------AVDDLAEVLETL 231

Query: 235 SVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPP-IDHNEVNVKRTSWKKS 293
           SV DVDYF+TRALYYTLTQ+  LALPI+ASNF+S H+M+ LP  ID  EVNVK++SWKK+
Sbjct: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291

Query: 294 AKFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDE--LKNFVPYKLGVNNSAKEKGENTNSK 351
           AK+LKH                 +VG    K    LK+FVPY +G  NS  E G  + + 
Sbjct: 292 AKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVG--NSIAESGPKSQT- 348

Query: 352 EKTSG-MMYSLTLYKPFNLAKDLVKEANLPF--QTYYTSQDIRSAITQYISIKNLVDAKD 408
             T+G +M+++T ++P     D   +  LP   Q Y++  +IR  + +YI+   L    +
Sbjct: 349 --TNGPVMFAVTSFQP-----DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNN 401

Query: 409 KGKVVMDDLLYNMVNKKKKDPDVA-RVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTP 467
              V+++D L+ MV K  ++     R++ R +IL+ ++  +F   YQ++K+ DT L++ P
Sbjct: 402 PKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHP 461

Query: 468 MKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGES-QTFKS 526
            KG PP++ IITEMKIGRKV+T+V NF+ L I     AADLRK+CS STTIG++  T   
Sbjct: 462 QKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVV 521

Query: 527 AEVQVQGPHGQLIIDHLNKSGVPNKWIDFEN 557
           +E+QVQG HG LIIDHL + GVP+ W+ FEN
Sbjct: 522 SEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  441 bits (1133), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 233/565 (41%), Positives = 347/565 (61%), Gaps = 16/565 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N+E+ F T+ +KQ  F    + GT++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH+E L PT+ +CW+   LL +VLTH  V++  L NGA+LM+ G+IPPF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
            C  G L GVAS + P +V A+G+ +++L    +V+GETGVAVK++H  NDGL + FK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LEPPAAFDVASEDE-------DIDNTQIEIQEGTKTTEKTRXXXXXXXXXXXXXXXXLDH 233
           +EPP+   V+ + E         D+     ++    T KT                 L+ 
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 234 LSVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKS 293
           LS+  VD+F+T+A+YYTL  D +L LPI ASNFI+NH+M+NLP I   +V++KR+SW ++
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 294 AKFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEK 353
           +KFLK+                T+V  N DK E+K+F PY+        +K  +T+SK  
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSKNN 354

Query: 354 TSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVV 413
               +  +  Y+P N AK  +            ++DI++ + +Y++ K LV+A D+  ++
Sbjct: 355 DKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIIL 414

Query: 414 MDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPP 473
           +DD L+++  KK    D  R + RA++ D +L+ +FTE + I+K D   LS  P+K    
Sbjct: 415 LDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKNR 472

Query: 474 RIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKS-AEVQVQ 532
            + ++TEMKI RK++T++SNFE   +DPE L+ +LRK CSGS+T+ E  T +S  EVQVQ
Sbjct: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532

Query: 533 GPHGQLIIDHLNKSGVPNKWIDFEN 557
           GPHG   I+ LN+ G+P+K+IDF+N
Sbjct: 533 GPHGNTAINILNEHGIPSKYIDFDN 557

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  407 bits (1045), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/562 (38%), Positives = 327/562 (58%), Gaps = 35/562 (6%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60
           MFKKEP++   SN KNSERK+L  + ++Q   E Y F ++ IK   F  Q ++GTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN P+ F+ KH++   PTVYSCW++  LLP+V TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180
             + G + G+AS +AP +V AVGI EMDL   + V   TGVAV+++H + DGL + FKV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LEPPAAFDVASEDEDIDNTQIE---IQEGTKTTEKTRXXXXXXXXXXXXXXXXLDHLSVS 237
            E P A +      +    + E      G    E+                  L+ L++ 
Sbjct: 181 REAPEASEAKGASPEAREPEAEPPKTAPGEGLAEE------------------LERLTME 222

Query: 238 DVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFL 297
           DVD+ +TRA+YYT+  D  L LP++AS FI+ H+++NLPP+D ++V VKR+SW K+AK L
Sbjct: 223 DVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLL 282

Query: 298 KHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGM 357
           KH                T+V  N+  + LK+F PY+  V++ A    +N+++ +     
Sbjct: 283 KHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRT-VSDKASTGSKNSSTTQ----- 336

Query: 358 MYSLTLYKPFNLAKDLVKEAN---LPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVM 414
             SL +   +   + L+ + N   +      +++DIR  + QY++ +  VD  DK  + +
Sbjct: 337 --SLEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRL 394

Query: 415 DDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPR 474
           DD L  +++ K  + D  R +PR + L  LL+ +F+E++ + + D  L    P KG  P 
Sbjct: 395 DDTLAQLLH-KNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPP 451

Query: 475 IKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGP 534
           IK+  E KI +KV+TKVSNFE   +DPE LAA+LR  CSGSTTI +    K+ EVQVQGP
Sbjct: 452 IKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGP 511

Query: 535 HGQLIIDHLNKSGVPNKWIDFE 556
           H   I+  LNK G+P+K+I  +
Sbjct: 512 HEATIVSILNKHGIPSKYITLD 533

>KNAG0A05330 Chr1 (787669..789210) [1542 bp, 514 aa] {ON} Anc_2.300
           YNL029C gene extends into a gap in the genome sequence
          Length = 514

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 393 AITQYISIKNLVDAKDKGKVVMDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNF 449
           AI+Q++ ++  VDAK + KV++D  LY     K +D  +  +I RAQ   P+  + F
Sbjct: 286 AISQWVHLEEQVDAKLREKVIID--LYREGRYKNEDAALETLINRAQSKVPIFEDKF 340

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa]
           {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
           YLR247C Hypothetical ORF
          Length = 1491

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 389 DIRSAITQYISIKN--LVDAKDKGKVVMDDLLYN--MVNKKKKDPDVARVIPRAQILDPL 444
           D R AI  ++++K+  L D K+K  V+    + N   + KK+ D D  + +     LD L
Sbjct: 731 DPRGAIEVFMAVKDQLLTDLKEKFGVLDPFSIKNEPFIGKKETDADFGKKVKEKLYLDLL 790

Query: 445 LANNF---TEFY----QIYKNDDTLLSRTPMKGSPPRIKIITEMKIGRKVITKVSNFEAL 497
               F   T +Y    +I +  D    +  +KG     KI T++      + K+ N++ L
Sbjct: 791 HQCFFFIGTAYYFLGSKILEKVDDENEKLKLKGLEHECKIYTQL-YSFDEMKKIENYQKL 849

Query: 498 QIDPELLAADLRK 510
           + D   LA +LRK
Sbjct: 850 EQDYYNLAENLRK 862

>NDAI0C04950 Chr3 (1146017..1146676) [660 bp, 219 aa] {ON} Anc_8.441
          Length = 219

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 27/114 (23%)

Query: 408 DKGKVVMDDLLYNMV-NKKKKDP---------DVARVIPRAQILDPLLANNFTEFYQIYK 457
           DKG +V D+++ NM+ ++   +P            R IP+A+ LD +LA   T   +  +
Sbjct: 59  DKGGLVSDEIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLAEQGTPLQRAVE 118

Query: 458 ---NDDTLLSRT------PMKG-------SPPRIKIITEMKIGRKVITKVSNFE 495
              +DD L+SR       P  G       +PP++ +I ++  G  +I +  + E
Sbjct: 119 LKVDDDLLVSRITGRLIHPASGRSYHKLFNPPKVDMIDDI-TGEPLIQRSDDNE 171

>ZYRO0C02354g Chr3 complement(189771..190442) [672 bp, 223 aa] {ON}
           highly similar to uniprot|P07170 Saccharomyces
           cerevisiae YDR226W ADK1 adenylate kinase
          Length = 223

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 13/93 (13%)

Query: 386 TSQDIRSAITQYISI-KNLVDAKDKGKVVMDDLLYNMV------NKKKKD---PDVARVI 435
           T   +RS + Q  ++ K      D+G +V DD++ NM+       K KK        R I
Sbjct: 38  TGDMLRSQVAQGTALGKEAKKIMDQGGLVSDDIMVNMIKSELSSEKCKKGFILDGFPRTI 97

Query: 436 PRAQILDPLLANN---FTEFYQIYKNDDTLLSR 465
           P+A++LD +L        +  ++  +D+ L+SR
Sbjct: 98  PQAELLDQMLKEQGKPLQKAVELKVDDELLVSR 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,955,137
Number of extensions: 2658005
Number of successful extensions: 8872
Number of sequences better than 10.0: 39
Number of HSP's gapped: 9056
Number of HSP's successfully gapped: 39
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)