Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2758.268ON28528514190.0
Smik_4.3608.268ON28528512351e-172
YDR116C (MRPL1)8.268ON28528512021e-167
Skud_4.3768.268ON28528511771e-164
KLLA0F19272g8.268ON2662617821e-104
SAKL0H16896g8.268ON2852727691e-102
KLTH0G13552g8.268ON2812737611e-101
Kpol_392.38.268ON2812717601e-100
NCAS0B038108.268ON3142777571e-100
TPHA0J007708.268ON2782697504e-99
ZYRO0C01518g8.268ON2772677471e-98
TDEL0F039508.268ON2762767425e-98
Kwal_56.237758.268ON2812717341e-96
AGR080W8.268ON2752696844e-89
Ecym_43028.268ON2752736836e-89
NDAI0J013308.268ON3142466866e-89
CAGL0B01815g8.268ON2902486672e-86
KAFR0B054808.268ON2802606271e-80
KNAG0H032108.268ON2852446281e-80
TBLA0I031908.268ON2412134154e-49
KAFR0E034405.500ON154988790.24
Skud_15.495na 1ON156494760.57
KLLA0A10989g1.362ON53567750.65
YOR328W (PDR10)na 1ON156491731.3
TBLA0D017805.500ON159588721.5
NDAI0A042005.500ON155195702.5
KAFR0H015508.480ON74674675.7
TBLA0A061006.234ON116850676.0
KAFR0E03460na 2ON154677668.8
Ecym_15338.9ON25345659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.275
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   551   0.0  
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   480   e-172
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   467   e-167
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   457   e-164
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   305   e-104
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   300   e-102
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   297   e-101
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   297   e-100
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   296   e-100
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   293   4e-99
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   292   1e-98
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   290   5e-98
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   287   1e-96
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   268   4e-89
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   267   6e-89
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   268   6e-89
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   261   2e-86
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   246   1e-80
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   246   1e-80
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   164   4e-49
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    35   0.24 
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    34   0.57 
KLLA0A10989g Chr1 complement(951316..952923) [1608 bp, 535 aa] {...    33   0.65 
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    33   1.3  
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    32   1.5  
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    32   2.5  
KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.4...    30   5.7  
TBLA0A06100 Chr1 complement(1501079..1504585) [3507 bp, 1168 aa]...    30   6.0  
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    30   8.8  
Ecym_1533 Chr1 (1096585..1097346) [762 bp, 253 aa] {ON} similar ...    30   9.0  

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/285 (95%), Positives = 271/285 (95%)

Query: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60
           MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR
Sbjct: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120
           RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS
Sbjct: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120

Query: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180
           KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT
Sbjct: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240

Query: 241 LLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           LLQNIISARTAFRAAVDNQKA              HGPGIVIDFA
Sbjct: 241 LLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  480 bits (1235), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 255/285 (89%)

Query: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60
           ML   AIPKICIAS  RR LSHTA++LYAEEYK  AMSSNAPSLTKDQAKKRELKRLAQR
Sbjct: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120
           +AEAKRPAAT+PL+MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+VTF 
Sbjct: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180
           KPLRY+KVA FTNDE KL+ELR+KYPN ++GG DLVA+IK+ E PVDFDKAFATPDIVPT
Sbjct: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI SLL+ESLGSMPFRQRGN+ISLG+GKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240

Query: 241 LLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           +LQNIISAR+AF+AAV+NQK+              HGPGIVIDFA
Sbjct: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  467 bits (1202), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/285 (78%), Positives = 246/285 (86%)

Query: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60
           ML   AIPKIC+  P RR   HTA++LYA++YK AAMSSNAPSLTKDQAKKRELKRL QR
Sbjct: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60

Query: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120
           +AEAKRPA  SPL+MPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+VTF 
Sbjct: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180
           KPLRY+K+A FTNDE KL+ELREKYPN ++GG DLVAKIK+ E  VDFDKAFATPDIVP 
Sbjct: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDI+SLLQESLGSMPFRQRGN+IS+G+GKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240

Query: 241 LLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           +LQNIISAR AF+ AVDNQK+              HGPGIVIDFA
Sbjct: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  457 bits (1177), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/285 (80%), Positives = 250/285 (87%)

Query: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60
           ML   A PKIC+ S  RR LSHTA +LYAEEYK+ AMSSNAPSLTK+QAKKRELKRLAQR
Sbjct: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120
           RAEAKRPAAT+PL+MPVT+ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+V F 
Sbjct: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120

Query: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180
           KPLRY+KVAVFTNDE KLKELREKYPN ++GG DLV++IKN E PVDFDKA+AT DIVP 
Sbjct: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGN+ISLGIGKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240

Query: 241 LLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           +LQNII+AR AF+AAV +QK+              HGPGIVIDFA
Sbjct: 241 VLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 193/261 (73%), Gaps = 2/261 (0%)

Query: 25  RQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYL 84
           RQ     ++ A        LTK+Q +KREL+++ QRR +AK PA+  PL+MPV+ ALRYL
Sbjct: 8   RQFQITSFRLA--EETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYL 65

Query: 85  RAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREK 144
           RA EVG+P SQQTI LTTLVV ERG  P++GNV+F KPL+ VKVAVFTNDE +   +++K
Sbjct: 66  RAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDK 125

Query: 145 YPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVS 204
           Y   +VGG+DLV++IK  E  +DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGTV+
Sbjct: 126 YSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVA 185

Query: 205 DDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAXXX 264
           +D+  L+++S+ S+PFRQRGN+ISLG+ K +FTD+E+L+N+++ + AF+ ++ NQ+    
Sbjct: 186 EDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKP 245

Query: 265 XXXXXXXXXXXHGPGIVIDFA 285
                      HGPGIVIDFA
Sbjct: 246 SILSQTTLTSTHGPGIVIDFA 266

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  300 bits (769), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 204/272 (75%), Gaps = 5/272 (1%)

Query: 14  SPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPL 73
           S  R  L HT   L +EE  T A       L+KDQ K+REL+RL QR+A A++PAA  PL
Sbjct: 19  SCTRTSLFHTFTALKSEEPSTIATK-----LSKDQLKRRELRRLVQRKAAARKPAADHPL 73

Query: 74  HMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTN 133
           +MPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   ++GN++F KPL+ VK+AVFTN
Sbjct: 74  YMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTN 133

Query: 134 DEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRG 193
           DE KLK  R+++   +VGG++L+ KIK  E P+DFDKAFATPDI  +L SQ+ RILGPRG
Sbjct: 134 DEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRG 193

Query: 194 VLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFR 253
           +LP+ KKGTV++DI+SL+++S+G++PFRQRGN IS+ + KC FTD ++L+NI++A+ +F+
Sbjct: 194 LLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFK 253

Query: 254 AAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
            A+ NQKA              HGPG+VIDFA
Sbjct: 254 LALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 201/273 (73%), Gaps = 6/273 (2%)

Query: 13  ASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSP 72
           ASP+RR   H +  L AEE    A S     L+KDQ KKRE++R AQ++A A+RPA+  P
Sbjct: 15  ASPVRRL--HVSASLRAEEPVGNATSK----LSKDQLKKREVRRFAQKKAAARRPASEHP 68

Query: 73  LHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFT 132
           L+MPV  ALR+LRAAEVG+PQSQQT+++TT+V+ ERG   +SGNV+F   L+ +K+AVFT
Sbjct: 69  LYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFT 128

Query: 133 NDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPR 192
           NDE + +  REK+   +VGG++LV KIK  + P+DFDK+FATP+I   L SQ+ RILGPR
Sbjct: 129 NDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPR 188

Query: 193 GVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAF 252
           G+LP+ KKGTVS+++ SL+++S+G++PFRQRGN IS+ +G+C FTD++LL+NI++A+ + 
Sbjct: 189 GLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSV 248

Query: 253 RAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           + A+ NQKA               GPGIVIDFA
Sbjct: 249 KEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/271 (50%), Positives = 201/271 (74%), Gaps = 2/271 (0%)

Query: 17  RRYLSHTARQLYAEEYKTAAMSSNAP--SLTKDQAKKRELKRLAQRRAEAKRPAATSPLH 74
           RR   H+ R L AE    +  +S  P     KD+ K+REL+R ++R+A+A++PA++ PL+
Sbjct: 11  RRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPLY 70

Query: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTND 134
           MP++ ALRYLRAAEVG+P SQQ I +TT VV ERG   ++GN++++ P++ VK+AVF+ND
Sbjct: 71  MPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSND 130

Query: 135 EVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGV 194
             KL +++E++   ++GGTDLV KIK+ + PVDFDKAFATPDI P L SQ+AR+LGPRGV
Sbjct: 131 PEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRGV 190

Query: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRA 254
           LP++KKGTVS+D++SL++ S+G MPFRQ GN+IS+ +G+C F+D+++L+NII+ R+A+  
Sbjct: 191 LPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYNT 250

Query: 255 AVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
            + +QK+              HGPGI IDFA
Sbjct: 251 TLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  296 bits (757), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/277 (51%), Positives = 195/277 (70%), Gaps = 4/277 (1%)

Query: 11  CIASPIRRYLSHTARQLYAEEYKTAAMSSN---APSLTKDQAKKRELKRLAQRRAEAKRP 67
           C +S   R + H+   + AEE  +   S+     P+L+K+Q KKREL+RL+QR+ EAKRP
Sbjct: 38  CTSSSQSRGI-HSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRP 96

Query: 68  AATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVK 127
           A+  PL+MPV  ALRY+RAAEVGRP  QQTI LT+LVV E+G AP++G+++  +PL+ +K
Sbjct: 97  ASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALK 156

Query: 128 VAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVAR 187
           VAVF+ +E  L  ++EKY   +VGG +L+ KIKN E   DFDKAFA+ D+   L +Q+ +
Sbjct: 157 VAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGK 216

Query: 188 ILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIIS 247
            LG RG+LP+ KKGTVSDD+ SLL + +GS+PFRQ GN IS+GIGKC+F+D E+L+NII+
Sbjct: 217 TLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIA 276

Query: 248 ARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDF 284
           AR+A   A+  QK+              HGPGIVIDF
Sbjct: 277 ARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  293 bits (750), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 144/269 (53%), Positives = 190/269 (70%), Gaps = 1/269 (0%)

Query: 17  RRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMP 76
           R+   H +R +  E        +    L+KDQ KKREL+R   R+ EAK PA + PL+M 
Sbjct: 11  RKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQ 70

Query: 77  VTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEV 136
           V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  ++G++ F  PL+ VK+A+FTNDE 
Sbjct: 71  VPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDET 130

Query: 137 KLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLP 196
           ++K  +EK+   +VGG++L++KIKN E  VDFDKAFATPDIV  L S VARILGPRGV P
Sbjct: 131 QMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFP 189

Query: 197 SVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAV 256
           S+KKGTVS+++  L++ +LGS+PFRQ GN IS+ IGKC F+DR++L+N+IS R AF+ +V
Sbjct: 190 SIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSV 249

Query: 257 DNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
             QK               HGPGIVIDF+
Sbjct: 250 STQKTKKPSILGKTILSTTHGPGIVIDFS 278

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  292 bits (747), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 188/267 (70%), Gaps = 8/267 (2%)

Query: 18  RYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPV 77
           R L HTA  L AEE  +         LTK+Q +KRE++R A+R+ EAK+PA T PL+MP 
Sbjct: 18  RCLFHTAALLRAEEAGS--------KLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPT 69

Query: 78  TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVK 137
            +ALRYLRA EVG P SQQ I +TT VV +RG  PI+GNV+   PL+ V VAVF+NDE +
Sbjct: 70  PLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ 129

Query: 138 LKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPS 197
           L   R+K+   +VGG+D++AKIK  E PVDFDKAFATPDI   L SQVARILGP+ VLP 
Sbjct: 130 LSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPM 189

Query: 198 VKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVD 257
            K+GTV+ D+  L+++S GS+PFRQ+GN+ISL + KC F+DR++L+N+++ +TAF+ AV 
Sbjct: 190 AKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVS 249

Query: 258 NQKAXXXXXXXXXXXXXXHGPGIVIDF 284
           NQKA              HGPGIVID 
Sbjct: 250 NQKAKRPSILGRTTLTTTHGPGIVIDL 276

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  290 bits (742), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 201/276 (72%), Gaps = 6/276 (2%)

Query: 11  CIA-SPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAA 69
           CI  S +RR   HT   L AEE      ++N   L+KDQ KKRE++RLAQR+A AK+  +
Sbjct: 6   CIGRSVLRRSFLHTGNVLRAEE-----AAANVSKLSKDQLKKREIRRLAQRKAAAKKSPS 60

Query: 70  TSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVA 129
             PL+M + MALR+LRAAEVG+PQ+QQTI LTT VV ERG   ++G+V+F KPL+ VK+A
Sbjct: 61  DHPLYMSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIA 120

Query: 130 VFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARIL 189
           VF+ DE +LK  REK+   +VGGT+++ KIK+ E PVDFDKAFATPDI P L SQ+ARIL
Sbjct: 121 VFSGDEDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARIL 180

Query: 190 GPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISAR 249
           GPRGVLP+VKKGTV+ D++ L+Q+S+GSMPFRQRGNAIS+ +GK  F+DR++L+N I+  
Sbjct: 181 GPRGVLPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATH 240

Query: 250 TAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
            A + A+ NQ +              HGPGIVIDFA
Sbjct: 241 DAVKEALANQVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 193/271 (71%), Gaps = 5/271 (1%)

Query: 15  PIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLH 74
           P  R L H    L AEE  +  +S     L+KDQ +KRE+++LAQ++A A+RPA   PL+
Sbjct: 16  PYARNL-HAFSALRAEETPSPVVSK----LSKDQLRKREIRKLAQKKAAARRPATDHPLY 70

Query: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTND 134
           MPV  ALR+LRAAE G+P SQQT+++TT+V+ ERG  P+SGN++F KPL+ +K+AVFTND
Sbjct: 71  MPVDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTND 130

Query: 135 EVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGV 194
           E + +  REK+   +VGG+DLV KIK     +DFDK+FATP+I   L SQ+ RILGPRG+
Sbjct: 131 EQQAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGL 190

Query: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRA 254
           LP+ KKGTV++++  LL+ S+G++PFRQRGN +S+ +GKC FTD++LL+NI++A+   + 
Sbjct: 191 LPAAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKE 250

Query: 255 AVDNQKAXXXXXXXXXXXXXXHGPGIVIDFA 285
           A+  QK               HGPGIVIDFA
Sbjct: 251 ALATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  268 bits (684), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 144/269 (53%), Positives = 193/269 (71%), Gaps = 6/269 (2%)

Query: 16  IRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHM 75
            RR L  TA QL  E    AA SS    L+KDQ KKREL+RLAQR+A A+RPA+ SPL+M
Sbjct: 11  FRRGLHLTAVQLSQE---AAATSSK---LSKDQLKKRELRRLAQRKAAARRPASASPLYM 64

Query: 76  PVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDE 135
           PV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A +SG VT   P+R  KVAVFTND 
Sbjct: 65  PVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDP 124

Query: 136 VKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVL 195
            + +  R KY   +VGG +LV ++K+ E  VDFDKAFATPDI P + +++ R+LGP+G+L
Sbjct: 125 EQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLL 184

Query: 196 PSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAA 255
           PSVKKGTV+ D++ LL + + S PF+QR N ISL IGKC+F+DR++++N+++ + AFRAA
Sbjct: 185 PSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAA 244

Query: 256 VDNQKAXXXXXXXXXXXXXXHGPGIVIDF 284
           + +QK               HGPGIVIDF
Sbjct: 245 MTSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  267 bits (683), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 133/273 (48%), Positives = 193/273 (70%), Gaps = 13/273 (4%)

Query: 16  IRRYLSHTARQLYAEEYKTAAMSSNAPS----LTKDQAKKRELKRLAQRRAEAKRPAATS 71
           +RR L+ T+ +  A         +N+PS    L+K+Q KK+EL+ L Q+RA AK+     
Sbjct: 11  VRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEH 61

Query: 72  PLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVF 131
           PL+MPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   +SGN+ F  PLR VKVAVF
Sbjct: 62  PLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVF 121

Query: 132 TNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGP 191
           TN++ + +  RE++   +VGGT+L+  IKN ++P+DFDKA ATPD+V  L SQ+A +LGP
Sbjct: 122 TNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGP 181

Query: 192 RGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA 251
           R +LP+VKKGTVS++I +L++E++ ++PFRQRG  +S+ +GKC F+D++LLQNI++ + A
Sbjct: 182 RRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKA 241

Query: 252 FRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDF 284
           F+ A+ +Q+               HGPGIVIDF
Sbjct: 242 FKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  268 bits (686), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 181/246 (73%)

Query: 39  SNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTI 98
           +NA  L+K+Q KKRE++RL+QR+ +A++PA + PL+M V  ALR++RAAEVGRP+ QQTI
Sbjct: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127

Query: 99  NLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAK 158
            LTTL+V E+GT+ ++GN+   +PL+ +K+AVF+ D+  L+E++ ++   +VGG + V  
Sbjct: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187

Query: 159 IKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSM 218
           IK+     +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTVSDD+ +L+   +G++
Sbjct: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247

Query: 219 PFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGP 278
           PF+Q GN IS+ IGKCYF+D+++L NII+AR AF+ A+ NQKA              HGP
Sbjct: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307

Query: 279 GIVIDF 284
           GIVIDF
Sbjct: 308 GIVIDF 313

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  261 bits (667), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 182/248 (73%), Gaps = 6/248 (2%)

Query: 43  SLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTT 102
           +LTK+QAKKRE+KRLA ++AEAK+PA   PL+MP+ +ALRYLR+AEVGRP   QTI +TT
Sbjct: 42  TLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTT 101

Query: 103 LVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNL--IVGGTDLVAKIK 160
           LVV ++G A ++GN+ F  PL+ +K+A+F++++ KL EL+ KY     I GG D++A IK
Sbjct: 102 LVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIK 161

Query: 161 NNESPVD-FDKAFATPDIVPTLQSQVARILGPRGVLPSVKK---GTVSDDITSLLQESLG 216
           + +  VD  +K FATP+I PT+ SQ+ R+LGP+G++P++KK    TV +D+ SL++E+LG
Sbjct: 162 SGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLG 221

Query: 217 SMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXH 276
            + FRQRGN++S+ +G+C F+DR++L+NII+ R AF+ +V +Q A               
Sbjct: 222 QVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTA 281

Query: 277 GPGIVIDF 284
           GPGIVIDF
Sbjct: 282 GPGIVIDF 289

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  246 bits (627), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 170/260 (65%), Gaps = 6/260 (2%)

Query: 26  QLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLR 85
           +L+ EE   A   +N     K QAKK+ L+   + R +A+ PA+  PL+M V  ALR+LR
Sbjct: 25  RLWLEEASVAPSKTN-----KQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLR 79

Query: 86  AAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKY 145
           A EVG+P+SQQTI LTTLV+ E+G  P+ GNV    PLR  KV V ++D  KL+E+++ +
Sbjct: 80  AVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNF 139

Query: 146 PNL-IVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVS 204
            N+ +VGG +LV K KN +  +DFDK  ATPDI+      + ++ GP+G+LP+VKKGTVS
Sbjct: 140 KNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVS 199

Query: 205 DDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAXXX 264
           +++  L+ E++ SMPFRQR   ISLGIGK  F+D+++L+NII+ R AF   + NQK    
Sbjct: 200 ENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQ 259

Query: 265 XXXXXXXXXXXHGPGIVIDF 284
                      HGPGIVIDF
Sbjct: 260 STLGKTTLTSTHGPGIVIDF 279

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  246 bits (628), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 169/244 (69%)

Query: 42  PSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLT 101
           P LTK+Q ++REL+++ + +  AKRPA+   +++ V  A+R LRA EVG+P SQQTI LT
Sbjct: 42  PKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLT 101

Query: 102 TLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKN 161
           T+VV E+G  P+ G+V    PL+ V++A F+ D   LK L+E+    IVGG +L+ ++K+
Sbjct: 102 TMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKS 161

Query: 162 NESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFR 221
            E PV FDKAFATPDI P L S++  +LG RG+LP++KKGTV  D+ ++++  +G+MPFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 222 QRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAXXXXXXXXXXXXXXHGPGIV 281
           QR   ++ GI KC+F+DR++L N+I+AR AF+ A+ NQK+              HGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 282 IDFA 285
           ID A
Sbjct: 282 IDLA 285

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  164 bits (415), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 125/213 (58%), Gaps = 2/213 (0%)

Query: 72  PLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVF 131
           PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  P+ G + F   +R   +AVF
Sbjct: 30  PLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVF 89

Query: 132 TNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGP 191
           T D  + K  +E   + I+GG++L+ KI + E  + F  AFAT D+V  L ++VA+ LG 
Sbjct: 90  TEDPEQHKIAKEMGID-IIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGK 147

Query: 192 RGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA 251
           + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  +GKC FTD E+L+N+I AR  
Sbjct: 148 QKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG 207

Query: 252 FRAAVDNQKAXXXXXXXXXXXXXXHGPGIVIDF 284
            + A+  Q                HGPGI ID 
Sbjct: 208 LQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1549

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 44  LTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTL 103
           L KD  K +E  + +    ++ +  +TSP  +   M ++YL    + R ++  +I L   
Sbjct: 470 LNKDNVKNKEAMKESHIAKQSNKLRSTSPYVVNYGMQIKYLLTRNIWRMKNNPSITLFQ- 528

Query: 104 VVGERGTAPISGNVTFSKPLRYVKVAVF 131
           V G  G A I G++ F K + +   A F
Sbjct: 529 VFGNSGIAFILGSM-FYKVMLHTTTATF 555

>Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR328W
           (REAL)
          Length = 1564

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 26  QLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLR 85
            L +EEYK    +  +  L  D +++RE  R A    ++KR   +SP  +   M ++YL 
Sbjct: 471 WLQSEEYKQL-QTQVSHHLGTDNSQQRERIRNAHVAKQSKRARPSSPYTVSFFMQVKYLL 529

Query: 86  AAEVGRPQSQQTINLTTLVVGERGTAPISGNVTF 119
             +  R ++  +I L T V+     A I G++ +
Sbjct: 530 FRDFWRIKNDPSIQLFT-VLSHAAMALILGSMFY 562

>KLLA0A10989g Chr1 complement(951316..952923) [1608 bp, 535 aa] {ON}
           conserved hypothetical protein
          Length = 535

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 117 VTFSKPL-RYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATP 175
           VTF KP+ R+V+V    N    LK+ ++   NL +    L+  + N + P++ D+ F   
Sbjct: 409 VTFLKPMKRFVQVIQVGN----LKQRQDDALNLRLQLWSLIDSLLNFDDPLNLDQVFVLT 464

Query: 176 DIVPTLQ 182
            I+P LQ
Sbjct: 465 LIIPYLQ 471

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
           PDR10ATP-binding cassette (ABC) transporter, multidrug
           transporter involved in the pleiotropic drug resistance
           network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 29  AEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAE 88
           +EEYK   +  N   L  D +++RE  + A    ++KR   +SP  +   + ++Y+   +
Sbjct: 474 SEEYKQLQVQVN-KHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRD 532

Query: 89  VGRPQSQQTINLTTLVVGERGTAPISGNVTF 119
           + R ++  +I L T V+     A I G++ +
Sbjct: 533 IWRIKNDPSIQLFT-VLSHAAMALILGSMFY 562

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1595

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 44  LTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTL 103
           L++D   KRE  + A    ++KR   +SP  +   + ++Y+    V R +    + L   
Sbjct: 546 LSEDTEVKREAIQNAHHAKQSKRARPSSPYTVSYGLQVKYILIRNVWRLKQSMEVPLFQ- 604

Query: 104 VVGERGTAPISGNVTFSKPLRYVKVAVF 131
           V+G    A I G++ F K L++V  A F
Sbjct: 605 VIGNSIMAFILGSM-FYKILKHVTTASF 631

>NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {ON}
           Anc_5.500
          Length = 1551

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 25  RQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYL 84
             L +E YK   M     SL ++  ++RE+ + A    ++KR   TSP  +   M ++Y+
Sbjct: 447 HWLKSENYKRL-MEEIDESLKQNTDEQREVMKEAHIAKQSKRSRPTSPYVVSYMMQVKYI 505

Query: 85  RAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTF 119
               + R ++  +I L   V G    A I G++ +
Sbjct: 506 LIRNIWRIKNSSSITLFQ-VFGNSVMAFILGSMFY 539

>KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.480
           YPL029W
          Length = 746

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 167 DFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGT--VSDDITSLLQESLGSMPFRQR- 223
           D D+ +A  + +  ++++   + G + VLP +KK T    D +T    E LG +    R 
Sbjct: 324 DEDRGWAWSNALLGVKAKEIHLCGEKSVLPVIKKITALTGDKLTINEYERLGELSVESRS 383

Query: 224 ---GNAISLGIGKC 234
              GN  +L  G C
Sbjct: 384 LKNGNMRNLRKGDC 397

>TBLA0A06100 Chr1 complement(1501079..1504585) [3507 bp, 1168 aa] {ON}
            Anc_6.234 YPL217C
          Length = 1168

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 19   YLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPA 68
            YL   A  L  EE K  A   N  +L+KD+  KR+ K+  QR+   K+ A
Sbjct: 1081 YLQKRAVVLGGEEKKARAFMHNILTLSKDKENKRKDKKSEQRKERLKKLA 1130

>KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {ON}
           
          Length = 1546

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 43  SLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTT 102
           SL +D  K +E  + A    ++K+   TSP  +   + ++YL      R  +  +I L  
Sbjct: 478 SLREDNVKNQEALKAAHVAKQSKKSRPTSPYVVSYGLQVKYLLIRNFWRMINSPSITLFQ 537

Query: 103 LVVGERGTAPISGNVTF 119
            V+G  G A I G++ +
Sbjct: 538 -VLGNSGMALILGSMFY 553

>Ecym_1533 Chr1 (1096585..1097346) [762 bp, 253 aa] {ON} similar to
           Ashbya gossypii ABR236W
          Length = 253

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 133 NDEVK--LKELREKYPNLIVGGTDLVAKIKNNESPV--DFDKAFA 173
           ++EVK  LKELREK     VGG+DL  +++     V  DFD  F+
Sbjct: 31  SEEVKEILKELREKVVIGFVGGSDLAKQVEQLGPTVLNDFDYCFS 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,885,620
Number of extensions: 1099525
Number of successful extensions: 3573
Number of sequences better than 10.0: 39
Number of HSP's gapped: 3672
Number of HSP's successfully gapped: 39
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)