Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2748.267ON1051055201e-69
Smik_4.3598.267ON1051054299e-56
Skud_4.3758.267ON1051054124e-53
YDR115W8.267ON1051054114e-53
Kwal_56.237768.267ON1301122452e-27
ZYRO0C01540g8.267ON97712344e-26
NCAS0B038208.267ON115762346e-26
KAFR0B054908.267ON85572309e-26
KLTH0G13574g8.267ON1121102302e-25
SAKL0H16918g8.267ON1111062302e-25
TDEL0F039408.267ON1101042292e-25
Kpol_543.428.267ON112552275e-25
TPHA0A017708.267ON104502259e-25
TBLA0E044708.267ON94922241e-24
NDAI0J013408.267ON141582252e-24
Ecym_43038.267ON109932181e-23
AGR081C8.267ON1301112103e-22
CAGL0B01793g8.267ON98502057e-22
KLLA0F19250g8.267ON1161162077e-22
KNAG0H032208.267ON86702012e-21
KLTH0G10516g2.293ON47442622.8
Suva_14.1752.92ON111082623.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.274
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...   204   1e-69
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...   169   9e-56
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...   163   4e-53
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...   162   4e-53
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    99   2e-27
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    95   4e-26
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    95   6e-26
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    93   9e-26
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    93   2e-25
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    93   2e-25
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    93   2e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    92   5e-25
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    91   9e-25
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    91   1e-24
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    91   2e-24
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    89   1e-23
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    86   3e-22
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    84   7e-22
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    84   7e-22
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    82   2e-21
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...    28   2.8  
Suva_14.175 Chr14 complement(322909..326241) [3333 bp, 1110 aa] ...    28   3.2  

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  204 bits (520), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60
           MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK
Sbjct: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  169 bits (429), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 94/105 (89%), Positives = 98/105 (93%)

Query: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60
           M+LF RLYQ QSRRM SSIS  SAL+VLRPQTSM++NSSPLKTMSLT FGFGFI QRRWK
Sbjct: 1   MTLFARLYQLQSRRMISSISSFSALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  163 bits (412), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 91/105 (86%), Positives = 95/105 (90%)

Query: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60
           M+L   LYQ QS+RM SSIS  SALSVLRPQ+SMLLNS P+KTMSLT  GFGFIGQRRWK
Sbjct: 1   MTLLTSLYQLQSKRMLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score =  162 bits (411), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 94/105 (89%), Positives = 94/105 (89%)

Query: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60
           M LF RL Q QSRRMFSSIS  SALSVLRPQT MLLNSSPLKT S TP GFG IGQRRWK
Sbjct: 1   MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 99.0 bits (245), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%), Gaps = 12/112 (10%)

Query: 3   LFGRLYQFQSRRMFSSISPISALSVL--RPQTSMLLNS-------SPLKTMSLTPFGFGF 53
           L  RL+QF +RR  +++S  S L+V   R   S + NS       S + +   + FG   
Sbjct: 22  LSSRLFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLFG--- 78

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 94.7 bits (234), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (81%), Gaps = 7/71 (9%)

Query: 35  LLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94
           LL  SPL +      GFG +GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 34  LLGPSPLSS------GFG-MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86

Query: 95  RKLKGRWFLSH 105
           RK KGRWFL+H
Sbjct: 87  RKHKGRWFLTH 97

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 94.7 bits (234), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 59/76 (77%), Gaps = 4/76 (5%)

Query: 30  PQTSMLLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89
           P  S +L+ SP+   SL PFG   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 44  PMGSNVLSQSPMMG-SLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99

Query: 90  KILKRRKLKGRWFLSH 105
           KILKRR+LKGRW+L+H
Sbjct: 100 KILKRRRLKGRWYLTH 115

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 93.2 bits (230), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 49/57 (85%)

Query: 49  FGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           F   F GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ SKILK RK KGRW+LSH
Sbjct: 29  FILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 93.2 bits (230), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 8/110 (7%)

Query: 3   LFGRLYQFQSRRMFSSIS---PISALS----VLRPQTSMLLNSSPLKTMSLTPFGFGFIG 55
           ++ RL+QF +RR  SS+S   P++A+S    V +    M    S   +  L    FGF  
Sbjct: 4   IYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFT- 62

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ KGRW+L+H
Sbjct: 63  QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 93.2 bits (230), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 64/106 (60%), Gaps = 9/106 (8%)

Query: 7   LYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFI-------GQRRW 59
           L+ F +RR F++ S  S L  L  Q   L+N +              I        QRRW
Sbjct: 8   LFHFSARRTFTTFSSFSPLRSLNSQA--LVNHNNPLLSQSQSQQPSSIMNILLGLTQRRW 65

Query: 60  KSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           KSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 66  KSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 10/104 (9%)

Query: 9   QFQSRRMFSSISPISALSVLRPQT------SMLLNSSPLKTMSLT-PFGFGFIGQRRWKS 61
           Q  +RR  +S+S  S L  L  Q        +    SPL ++SL  PFG   I QRRWKS
Sbjct: 10  QLNARRTLTSLSSFSPLRSLFAQNKSQGLLGVPETHSPLSSISLLFPFG---IMQRRWKS 66

Query: 62  RGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           RGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KGRW+L++
Sbjct: 67  RGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 50/55 (90%), Gaps = 1/55 (1%)

Query: 52  GFIG-QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           G +G QRRWKSRGNTYQPSTLKRKR FGFLARA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 58  GLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 91.3 bits (225), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR  GFLARA+SKQG+KIL+RRK KGRW+L+H
Sbjct: 55  QRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 62/92 (67%), Gaps = 1/92 (1%)

Query: 15  MFSSISPISALSVLRPQTSM-LLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKR 73
           +F+S++ I+  S      SM LLN S L   ++       I  RRWKSRGNTYQPSTLKR
Sbjct: 3   IFNSLTRIACFSKSTALNSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKR 62

Query: 74  KRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           KR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 63  KRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 91.3 bits (225), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 44/58 (75%), Positives = 49/58 (84%), Gaps = 3/58 (5%)

Query: 48  PFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           PF    I Q+RWKSRGNTYQPSTLKRKR +GFL+R + +Q SKILKRRKLKGRWFLSH
Sbjct: 87  PF---MINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 88.6 bits (218), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 66/93 (70%), Gaps = 5/93 (5%)

Query: 15  MFSSISPISALSVLRPQTSMLLNSS--PLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLK 72
           + SS SP+ +L  ++P  +   N+S    +  S+    FG + QRRWKSRGNT+QPSTLK
Sbjct: 20  LVSSFSPMKSL--VQPLATSAANTSVSTFQRPSVISLVFG-LNQRRWKSRGNTFQPSTLK 76

Query: 73  RKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           RKR  GFLARA+SK G KILKRRK KGRW+L++
Sbjct: 77  RKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 85.5 bits (210), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (64%), Gaps = 11/111 (9%)

Query: 2   SLFGRLYQFQSRR-MFSSISPISALSVLRPQT------SMLLNSSPLKTMSLTPFGFGFI 54
           S++  + Q+ SRR + + +SP+  ++ + PQ       +    ++P  +M     G   +
Sbjct: 24  SMYRSMLQWSSRRTIMTVVSPVRKMAPV-PQIQYGAIGAFTPAAAPKPSMLSMLLG---L 79

Query: 55  GQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
            Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 80  TQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 83.6 bits (205), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 84.3 bits (207), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 1   MSLFGR-LYQFQSRRM---FSSISPISALSVLRPQTSMLLNSSPLKTMSLTP------FG 50
           MS   R L Q+ S+R    FSS SP+  L     +    +N   +   S T       FG
Sbjct: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60

Query: 51  FGF-IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
             F + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 82.0 bits (201), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%)

Query: 36  LNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRR 95
           + +S L T  + P        RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRR
Sbjct: 17  VGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRR 76

Query: 96  KLKGRWFLSH 105
           K KGRW+LSH
Sbjct: 77  KEKGRWYLSH 86

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 27  VLRPQTSMLLNSSPLKTMS---LTPFGFGFIGQ-RRWKSRGN 64
           V+RP   MLL S+P  T+     T  G   +G+  RW SRGN
Sbjct: 132 VVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGN 173

>Suva_14.175 Chr14 complement(322909..326241) [3333 bp, 1110 aa]
           {ON} YNL163C (REAL)
          Length = 1110

 Score = 28.5 bits (62), Expect = 3.2,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 9/82 (10%)

Query: 28  LRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWKSRGN------TYQPSTLKRKRTFGFLA 81
           + P+T  ++NS  LK  SLTP     I +  WK   N      +     + +      L 
Sbjct: 272 MDPKTKKIINSKGLKGRSLTPLFTSLILENIWKIYQNVIISRDSNMVEKIAKTLNIKLLP 331

Query: 82  R-AKSKQGSKILKRRKLKGRWF 102
           R  +SK   ++L  R + G+W 
Sbjct: 332 RDLRSKDDKQLL--RTIMGQWL 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,144,722
Number of extensions: 364296
Number of successful extensions: 1173
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1171
Number of HSP's successfully gapped: 25
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)