Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2738.265ON37636217320.0
Smik_4.3588.265ON37136212441e-171
Skud_4.3748.265ON37333912311e-169
YDR113C (PDS1)8.265ON37336411671e-159
TDEL0F039208.265ON3223363876e-43
SAKL0H16962g8.265ON3363413133e-32
NCAS0B038308.265ON3253813109e-32
ZYRO0C01584g8.265ON2823282912e-29
Kpol_543.418.265ON3063272528e-24
KLTH0G13618g8.265ON3023181954e-16
AGR083W8.265ON2952941804e-14
NDAI0J013508.265ON4223201824e-14
Ecym_43058.265ON3112941762e-13
TPHA0A017808.265ON3523191718e-13
KNAG0H032308.265ON2812921628e-12
KLLA0F19206g8.265ON2632101511e-10
Kwal_56.237818.265ON2932991477e-10
KAFR0B055108.265ON2752511318e-08
CAGL0L12298g8.265ON2862101245e-07
TPHA0C040202.502ON48537712.5
KAFR0K024905.591ON89531687.9
NOTE: 1 genes in the same pillar as Suva_2.273 were not hit in these BLAST results
LIST: TBLA0E04460

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.273
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   671   0.0  
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   483   e-171
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   478   e-169
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   454   e-159
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   153   6e-43
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   125   3e-32
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...   124   9e-32
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   116   2e-29
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...   101   8e-24
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    80   4e-16
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    74   4e-14
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    75   4e-14
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    72   2e-13
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    70   8e-13
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    67   8e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    63   1e-10
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    61   7e-10
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    55   8e-08
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    52   5e-07
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    32   2.5  
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    31   7.9  

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/362 (92%), Positives = 336/362 (92%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
           KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180
           LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180

Query: 181 AKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240
           AKNQ           TDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT
Sbjct: 181 AKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240

Query: 241 AXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS 300
           A               IEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS
Sbjct: 241 AKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS 300

Query: 301 NNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL 360
           NNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL
Sbjct: 301 NNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL 360

Query: 361 YN 362
           YN
Sbjct: 361 YN 362

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  483 bits (1244), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/362 (68%), Positives = 281/362 (77%), Gaps = 5/362 (1%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           MPANEDKENNIVY+GN SS+ +FPQTPAHLLKRSHSNVLKPP RLDQLKKDVNSN+   L
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNR+KSF+F  E +NQ+KDA+I+PQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180
           LS RKNDQLRKLSQ+SRNRNR N++ +LNN+RKLQKYGSVLGYNALPKMKSLVLKDL DP
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180

Query: 181 AKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240
            KN+           ++NKLS+KLQ+A  QQHSS+DEHEFSG IGLFNNQGGLQQLIKN+
Sbjct: 181 GKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240

Query: 241 AXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS 300
                           IEIAPQR +PLPYVPDGY PF+QEDI KLK+FNSPY LDLE   
Sbjct: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLE--- 297

Query: 301 NNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL 360
           ++  S DKV LL L  +NEE E+D   H  GD++E   L L  +N       A+P IESL
Sbjct: 298 DDGGSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKI--TAIPTIESL 355

Query: 361 YN 362
            N
Sbjct: 356 CN 357

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  478 bits (1231), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 248/339 (73%), Positives = 272/339 (80%), Gaps = 5/339 (1%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           MPANEDKENNIVYTGNESS  +FPQTPAHLLKRSHSNVLKPPVRLDQLKKD+NSN+GK L
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNRSKSFVF  ET N +KD+E +PQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180
           LS RKNDQLR+LSQ+SRNR R NYN +LNNSRKLQKYGSVLGYNALPKMKSLVLKDLA P
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180

Query: 181 AKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240
           AKNQ            ++KL  KLQ+AF QQHSS+DEHE +G IGLFNNQGGLQQLIKNT
Sbjct: 181 AKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240

Query: 241 --AXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEG 298
                             IEIAPQRQEPLPYVPDGYP FQ+EDI KL+TFNSPY LDLE 
Sbjct: 241 TKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLE- 299

Query: 299 NSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPA 337
             ++ +S D+VGLLSL  ++EE E+D T HT GD +  A
Sbjct: 300 --DHGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACA 336

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/364 (65%), Positives = 281/364 (77%), Gaps = 10/364 (2%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           MPANEDKENNIVYTGNESS  +FPQTPAHLLKRSHSN+LKPPVRLDQLK+D NSN+G  L
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNRSKSF+F  ET+NQ+KDA++ PQ QNT
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFP-ETSNQSKDADL-PQLQNT 119

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180
           LS RKNDQLRKLSQ+SR+R+R N+N +L+NSRKLQKYGSVLGYNALPKMKSLVLKDLAD 
Sbjct: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADS 179

Query: 181 AKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240
            KN+           +++KL +KLQSA  +Q SS+ E+E +GG+GLFN QGGLQQLIKN+
Sbjct: 180 GKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNS 239

Query: 241 AXXXXXXXXXXXXXX---XIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLE 297
                              IEIAPQRQEPLPYVP+GY PFQQ+DI KLKTFNSPY LDLE
Sbjct: 240 TKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299

Query: 298 GNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLI 357
              +  ++ DKV LL L +++EE EKD T     +Q+E A L L  +N +  + AA+P +
Sbjct: 300 ---DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFK--EVAAVPTM 354

Query: 358 ESLY 361
           E +Y
Sbjct: 355 ELVY 358

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  153 bits (387), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 127/336 (37%), Positives = 170/336 (50%), Gaps = 58/336 (17%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           MP NE+KEN++V    ES   SFPQTPAHLLKRS S ++KP              +  NL
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKP----------SGEENPSNL 50

Query: 61  KYIQGG---KEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQ 117
            Y       K  SP++R+      QGR PLA+KDNNRS  F+  L+   Q    +     
Sbjct: 51  TYRDCDAPVKRASPSRRVQ-----QGRPPLASKDNNRSTGFLPQLQKLQQQPSLK----- 100

Query: 118 QNTLSTRKNDQLRKLSQVSRNRNRGNYNG-MLNNSRKLQKYGSVLGYNALPKMKSLVLKD 176
                       R LSQ S+ RN    +G +L N R+L+KYGSVLGYNALPKMKSLVLKD
Sbjct: 101 ------------RNLSQ-SKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKD 147

Query: 177 LADPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQL 236
           +    +                 L  KL +A      S++E E  G  GLF ++ GL  L
Sbjct: 148 VDQVGEQGEDENDDEDEDHI---LRLKLHNAI---DRSDEEGEEVG--GLF-DKSGLLHL 198

Query: 237 IKNTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDL 296
           ++++                IE  PQR EPLPY+P+G+    QED  KLKTF SPY ++ 
Sbjct: 199 VRDS-----KKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIED 253

Query: 297 EGNSNNTNSADKVGLLSLVEV-----NEEDEKDNTT 327
           + + ++ +  D  G L L E+     +E  E++N T
Sbjct: 254 DYSDSDDDKQD--GFLQLEEIGSAGDDENIERENLT 287

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  125 bits (313), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 116/341 (34%), Positives = 164/341 (48%), Gaps = 78/341 (22%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M  +E+KEN I       SS + P TP+HLLKRS S  +KP          + SNS    
Sbjct: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKP----------LASNS---- 39

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
                     PTK+         RLPLA+KDNN+S + +      N  + + +V      
Sbjct: 40  ----------PTKK------SGKRLPLASKDNNKSNTLI------NNGQKSALV------ 71

Query: 121 LSTRKNDQLRKLSQVSRNR----NRGNYNG---------MLNNSRKLQKYGSVLGYNALP 167
            +   N+ L    ++ RNR    N G++           +L +SR L+KYGSVLGYN LP
Sbjct: 72  -NLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSR-LKKYGSVLGYNGLP 129

Query: 168 KMKSLVLKDL-----ADPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSG 222
           ++KSLVLKD+         + +            DN L+ KL  A    H+ +D+ E  G
Sbjct: 130 RVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKAL-NNHNEDDKEE--G 186

Query: 223 GIGLFNNQGGLQQLIKNTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDI 282
            IGL  +  GLQQL+K+                 IEI P   E LP+VP+GY PF++ D+
Sbjct: 187 SIGLLGSNTGLQQLLKH-----RNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDV 241

Query: 283 LKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEEDEK 323
           +KL TF SP+ +  E +S+     D  GLL++  V  EDE+
Sbjct: 242 IKLNTFTSPFSMHKE-DSDCEECDDYDGLLTISMVKSEDEE 281

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score =  124 bits (310), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 162/381 (42%), Gaps = 102/381 (26%)

Query: 1   MPANEDKENNIVYTGNESS---STSFPQTPAH-LLKRSHSNVLKPPVRLDQLKKDVNSNS 56
           +  NEDKEN   Y  +  S   S   P+TPAH LLKRS S VLKP          VN+  
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP--------NSVNATD 54

Query: 57  GKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQ 116
                       +SP +R     Q Q RLPLA KDNN S                     
Sbjct: 55  ELG--------NISPRRR--QLLQLQNRLPLAKKDNNNS--------------------- 83

Query: 117 QQNTLSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKD 176
              + S+RKN                     LNN +KL+KYGSVLG +ALP+ KSL+L  
Sbjct: 84  ---SFSSRKNG--------------------LNNIKKLKKYGSVLGMDALPRTKSLIL-- 118

Query: 177 LADPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSG----GIGLFNNQ-- 230
                K+             DN    KL++A  Q  ++ +E E  G    GIGLF++   
Sbjct: 119 -----KDVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNED 173

Query: 231 ------GGLQQLIKNTAXXXXXXXXX---------XXXXXXIEIAPQRQEPLPYVPDGYP 275
                 GGLQQLI+                           IE AP R+EPLP+VP GY 
Sbjct: 174 NSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYT 233

Query: 276 PFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQE 335
           PF  EDI KLKTF+S Y LD     +    ADK+  L  +E + +DE +        ++ 
Sbjct: 234 PFTPEDINKLKTFHSSYKLD--SPVSTVEDADKLLALETIETSVDDEAEWEHEVRHHRRR 291

Query: 336 PAELSLALQNSEDDDNAAMPL 356
           P       ++S DD    +PL
Sbjct: 292 PT------RDSNDDSIDLVPL 306

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  116 bits (291), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 147/328 (44%), Gaps = 94/328 (28%)

Query: 5   EDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNLKYIQ 64
           ++KENN+V    E+ S + PQTP HLLKRS  NVLKP             N+      ++
Sbjct: 7   DNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-----------EENTP-----VK 50

Query: 65  GGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTR 124
             + VSP +        Q RLPLA+KD+N+S +             A  V ++Q TL   
Sbjct: 51  KSRSVSPVRG-------QRRLPLASKDHNKSSA-------------AGPVKKRQPTLQGE 90

Query: 125 KNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADPAKNQ 184
                                 +L+N RKLQKYGSVLGY  LP+ KSLVLKD        
Sbjct: 91  ----------------------LLSNPRKLQKYGSVLGYTDLPRTKSLVLKD-------- 120

Query: 185 XXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAXXX 244
                       +++L +KLQ A  ++  S +        GL    GGL +L+++T    
Sbjct: 121 -GDDEDDDEEEENSELQKKLQDAMNRREDSNE--------GL----GGLAKLVRDTK--- 164

Query: 245 XXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTN 304
                       IE AP R  PL Y PDG+  ++ EDI+KLK  +     D + + +N  
Sbjct: 165 ----------DDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEP 214

Query: 305 SADKVGLLSL--VEVNEEDEKDNTTHTI 330
             +  GLL L  +E N ED  +N    I
Sbjct: 215 QENDDGLLPLMSIESNNEDSNENEADEI 242

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score =  101 bits (252), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 149/327 (45%), Gaps = 68/327 (20%)

Query: 4   NEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNLKYI 63
           +++KENNI      +     PQTP +LLKR+HS          +LK  +        K I
Sbjct: 2   DQNKENNIFR---HAMLKDMPQTPNNLLKRTHS----------KLKTGI-------AKDI 41

Query: 64  QGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLST 123
           QGG  +        +T PQ RLPLA+KDNNRS SF+                   N ++ 
Sbjct: 42  QGGNVI--------NTSPQKRLPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINN 93

Query: 124 RKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADPAKN 183
               +     Q        N +G+L + RKL+KYGSVLGYNALPK+KSLVLKD++D   +
Sbjct: 94  NNIKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLVLKDISDNEDD 145

Query: 184 QXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAXX 243
                        + K              S + ++ + GIGL +  G LQQLI++    
Sbjct: 146 DDDLLSLKLRDSMNKK--------------SINTNKSNSGIGLLSG-GNLQQLIRDA--- 187

Query: 244 XXXXXXXXXXXXXIEIAPQRQEPLP---YVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS 300
                        +     +    P   Y+PD + PF + DI KLKTFNSP+ L+ + NS
Sbjct: 188 ----------NEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLE-QSNS 236

Query: 301 NNTNSADKVGLLSLVEVNEEDEKDNTT 327
           ++   + ++ LL+    +E    D  T
Sbjct: 237 DDEEDSSELLLLANTSDDEGTHNDKIT 263

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 79.7 bits (195), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 88/318 (27%), Positives = 123/318 (38%), Gaps = 82/318 (25%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M  +EDKEN+I       S ++ P TP HLL RS S +                      
Sbjct: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
                 K  SP +        + R PLA+KDNNRS S++   E                 
Sbjct: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKEP---------------- 63

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKD-LAD 179
                   LRK     R R   N+ G    + +L      L  +  PK+KSLVLKD + +
Sbjct: 64  --------LRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEE 109

Query: 180 PAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKN 239
                             N+L+ KL++       S D        GL    GGLQ L+  
Sbjct: 110 EGSQSEGAEVDEDDDDDSNRLAAKLRTKLL----SRDRDAEGEQTGLLGATGGLQSLL-- 163

Query: 240 TAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFN-SPYGLDLEG 298
                            +E+ P R EPLP+VP+GY PF +++I KL+  + SP+ L+  G
Sbjct: 164 -GPKLSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSG 222

Query: 299 --NSNNTNSADKVGLLSL 314
                + NS D   L +L
Sbjct: 223 VDEDEDINSQDSTQLFTL 240

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 113/294 (38%), Gaps = 81/294 (27%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M  +EDKEN +   G        P+TP H LKRS SN+                 +G+N 
Sbjct: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNL-----------------AGRN- 39

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
                                  R+PLA+KD N+S+  VF L+T+          Q +  
Sbjct: 40  ---------------------STRMPLASKDRNQSQG-VFGLKTSGAGGAGGAQAQSKRP 77

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLG--YNALPKMKSLVLKDLA 178
            S          S +++N              KL+KYGSVLG  Y +L K KSLVLKD +
Sbjct: 78  AS----------SSIAKNMP----------DSKLKKYGSVLGVGYGSLAKAKSLVLKDTS 117

Query: 179 DPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIK 238
           D                  N L+ KL+S         +E + S G+           L+ 
Sbjct: 118 DCESANEESEEE-----EGNPLAAKLKSRLCSAEEGGNEDDGSSGL-----------LLG 161

Query: 239 NTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPY 292
                             +E AP++   LP+VP+GY   +  D+ KL  ++SP+
Sbjct: 162 EALSQLAAAGETQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 139/320 (43%), Gaps = 48/320 (15%)

Query: 4   NEDKENNIVYTGNESSSTS-----FPQTPAHLLKRSHSNVL---KPPVRLDQLKKDVNSN 55
           +EDKEN   +  +     S     FPQTPAHLLKRS S++L   KP ++   L+  + S+
Sbjct: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSD 71

Query: 56  SGKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVP 115
           +G           +SP ++L    Q Q R PL+ KDNN S    F L+   Q  D + + 
Sbjct: 72  AGAGAV----PPNISPRRQL---LQLQNRFPLSKKDNNNS----FILKQQQQQFDHKRLK 120

Query: 116 QQQNTLS-----TRKNDQLRKLSQVSRN-RNRGNYNGMLNNSRKLQKYGSVLGYNALPKM 169
           +  + L         N+  R  S V ++  +  N     +NS      GS L Y+A+P +
Sbjct: 121 KYGSVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGS-LNYSAIPNL 179

Query: 170 KSLVLKDLADPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLF-- 227
              +  D     +              D+    KL+ A    +++ +    S G GL   
Sbjct: 180 DFNI--DTIQERRKGSDDDSEDDDTGADDLFGLKLKHAMNNNNNNNN----SDGSGLLFH 233

Query: 228 NNQGGLQQLI---------KNTAXXXXX----XXXXXXXXXXIEIAPQRQEPLPYVPDGY 274
           ++  GL QLI         KN+                    IE AP R++ LPY+P GY
Sbjct: 234 DSNHGLHQLINFNKKNMPEKNSISQSVKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGY 293

Query: 275 PPFQQEDILKLKTFNSPYGL 294
            PF  EDI KLK ++SP+ +
Sbjct: 294 TPFTNEDINKLKVYHSPFAI 313

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 123/294 (41%), Gaps = 67/294 (22%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M  +EDKEN  + TG+E S +  P+TP H LKRS SNV                      
Sbjct: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
                            H +   RLPLA+KD NRS+S  F L             +QQ  
Sbjct: 37  -----------------HLKNNSRLPLASKDRNRSQSG-FNL-------------KQQLV 65

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLG--YNALPKMKSLVLKDLA 178
                   +   ++  R  +      M ++  KL+KYGSVLG  Y  L K KSLVLKD +
Sbjct: 66  QGHVGGGVMVGQNKSKRPASNSFVKNMPDS--KLKKYGSVLGVNYPHLTKTKSLVLKDAS 123

Query: 179 DPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIK 238
           D +++              N L+ KL+S        E+E + S G+ L      L +L  
Sbjct: 124 DGSQDNGEESDDYDDE-EGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKL-- 180

Query: 239 NTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPY 292
                             IE AP++   L ++P+GY  F+ E+I+KL T+ SP+
Sbjct: 181 -----HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 122/319 (38%), Gaps = 81/319 (25%)

Query: 1   MPANEDKENNIVYTGNES-------SSTSFPQTPA-HLLKRSHSNVLKPPVRLDQLKKDV 52
           +  N DKEN+I Y  N+        S+ + PQTP   LLKR+HS  L   V         
Sbjct: 7   LNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAV--------- 57

Query: 53  NSNSGKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNN---RSKSFVFALETANQNK 109
                         K+   +K  + +     RLPLA+KDNN   RS SF+          
Sbjct: 58  -------------FKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFIL--------- 95

Query: 110 DAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPK- 168
                  Q N L   K     +LS ++ N+           S KL+KYGS+LG N     
Sbjct: 96  -------QNNKLVLNK-----QLSLLNNNQT----------SNKLRKYGSILGVNNNGNN 133

Query: 169 -------MKSLVLKDLADPAKNQXXXXXXXXXXXTDNKLSQKLQSA---FFQQHSSEDEH 218
                  +KSL+LKD+ D                    L   LQS       Q  +  ++
Sbjct: 134 TNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLLNQLKNAKKN 193

Query: 219 EFSGG----IGLFNNQGGLQQLIKNTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGY 274
            +S      IGLF    GLQ+LI  +                 + A      L Y P+GY
Sbjct: 194 SYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPD--LSYSPEGY 251

Query: 275 PPFQQEDILKLKTFNSPYG 293
            PF  EDI KL TF SPY 
Sbjct: 252 IPFNNEDIKKLNTFKSPYS 270

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 114/292 (39%), Gaps = 94/292 (32%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M  NEDKEN          + + PQTPA  +      VLKP          V S   ++ 
Sbjct: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKP----------VGSRGKQSF 40

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
              +     SPT+         GRLPLA+KDNN S   V                     
Sbjct: 41  SVRK-----SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYN--ALPKMKSLVLKDLA 178
           L  +  DQ+R+                 N+SRKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 70  LGRQPADQVREA----------------NSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 179 DPAKNQXXXXXXXXXXXTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQ--GGLQQL 236
            P ++                    L     +  S  D+      I    +Q  GGL +L
Sbjct: 114 APNESSKSVTKRLL-----------LDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRL 162

Query: 237 IKNTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTF 288
           ++ +                +EI PQ Q+ LPY+PDG+    + DI KL+ +
Sbjct: 163 VRQS------------QNRELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 92/210 (43%), Gaps = 57/210 (27%)

Query: 84  RLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGN 143
           R PLA+KDNNR++S +                  +N  +  K+D   K    S  +N   
Sbjct: 39  RRPLASKDNNRTQSILSV----------------KNNAALGKSDHPLKRPASSFMKN--- 79

Query: 144 YNGMLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADPAKNQXXXXXXXXXXXTDNKLSQ 202
              M  N  KL+KYGSVLG N  +P+ KSLVLKD     KN             +++  +
Sbjct: 80  ---MPEN--KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKND-----------DEDEEDE 123

Query: 203 KLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAXXXXXXXXXXXXXXXIEIAPQ 262
           +     F    S      + G G      GL+ LI+                  IE AP+
Sbjct: 124 EDDLPIFPSGKS-----LNLGFG-----NGLKALIR-----------EKEDELNIEYAPK 162

Query: 263 RQEPLPYVPDGYPPFQQEDILKLKTFNSPY 292
           RQ+ LPY+P+GY PF +E I KL+   SP+
Sbjct: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPF 192

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 109/299 (36%), Gaps = 85/299 (28%)

Query: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60
           M A E+KEN I       S  S P TP HLL RS S +                      
Sbjct: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120
                 K +SP +        + R PLA+KDNN+S  F+ A E                 
Sbjct: 33  ------KNISPKRA-------EQRKPLASKDNNKSTGFLGAKEP---------------- 63

Query: 121 LSTRKNDQLRKLSQVSRNRNRGNYNG-MLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAD 179
                   LRK     R R   N+ G  + N+R       +L  N  P++KSLVLKD  D
Sbjct: 64  --------LRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKD--D 106

Query: 180 PAKNQXXXXXXXXXXXTDNKLSQKLQSAF-FQQHSSEDEHEFSGGIGLFNNQGGLQQLIK 238
             + Q             N L+ KL+     +      E     G           +L  
Sbjct: 107 IEEEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHS 166

Query: 239 NTAXXXXXXXXXXXXXXXIEIAPQRQEPLPYVPDGYPPFQQEDILKLK-TFNSPYGLDL 296
            T                +E+ P R EPLP++P GY PF  EDI KL+ T  SP+ L+ 
Sbjct: 167 ETLDSDSDLE--------VEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNF 217

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 108/251 (43%), Gaps = 47/251 (18%)

Query: 90  KDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSR----NRNRGNYN 145
           K+NN S   V AL+T N N        ++NT STR +  L++L Q  +    ++N    N
Sbjct: 7   KENNLSTIPVLALQTPNTN------FVKKNTTSTRIS-PLKRLQQQGKLPLQSKNGNKSN 59

Query: 146 GML----NNSRKLQKYGSVLGYN-----ALPKMKSLVLKDLADPAKNQXXXXXXXXXXXT 196
            +L     N+ +++KYGS+LG        LPK KSL+LKD                    
Sbjct: 60  SILISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLILKD-----------NESSESEEE 108

Query: 197 DNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAXXXXXXXXXXXXXXX 256
           D  L++KL+ A  +  + ED  E  G +GLF  +   Q  I N                 
Sbjct: 109 DGLLNRKLKEALSRSQNDED-REGDGSVGLFAKEA-FQNHISN------------DDDSE 154

Query: 257 IEI--APQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSL 314
           I+I    ++   L Y+PD Y     ++I KLK  N         +S   ++   +  L L
Sbjct: 155 IDIINGKEKDVELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLEL 214

Query: 315 VEVNEEDEKDN 325
             V++ D ++N
Sbjct: 215 EHVSDSDTEEN 225

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 22/210 (10%)

Query: 87  LAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGN-YN 145
           + A + ++  + V  L         +++ + ++TL  +KN Q + L+   +N NR + Y 
Sbjct: 1   MGAVETDKENNVVGTLREKGPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYL 60

Query: 146 GMLNNS--RKLQKYGSVLGY---NALPKMKSLVLKDLADPAKNQXXXXXXXXXXXTDNKL 200
            +  NS  +KL+   +  G    NA  ++ SL+LKD+A   + +             N L
Sbjct: 61  SLKRNSNQKKLKPAVTRAGSTANNANRRVTSLILKDIASGDEKESASESDSEDDEESNPL 120

Query: 201 SQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAXXXXXXXXXXXXXXXIEIA 260
           + K++ A     +S +     G  GL N + GL+++  +                 IE+A
Sbjct: 121 ALKIKQALTHSIASAE-----GKTGLLNGKSGLRKIFND-----------RDLDREIEVA 164

Query: 261 PQRQEPLPYVPDGYPPFQQEDILKLKTFNS 290
             R+   PY P+GY P    D+ KLK  N+
Sbjct: 165 SVREPEKPYEPEGYEPLDDSDLEKLKLKNA 194

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 112 EIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGNYNGML 148
           E++ Q++N LS RK D +  L QV R+  RG  +G +
Sbjct: 239 ELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKI 275

>KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5.591
           YDR466W
          Length = 895

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 2/31 (6%)

Query: 272 DGYPPFQQEDILKLKTFNSPYGLDLEGNSNN 302
           +G+PPF+ E+  +LKTF     LD   NSNN
Sbjct: 216 EGHPPFRGEN--ELKTFEKIVALDYTWNSNN 244

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,502,327
Number of extensions: 2024390
Number of successful extensions: 7637
Number of sequences better than 10.0: 107
Number of HSP's gapped: 7843
Number of HSP's successfully gapped: 112
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)