Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Suva_2.2718.263ON50750726240.0
Skud_4.3728.263ON50750722930.0
Smik_4.3578.263ON50750722870.0
YDR111C (ALT2)8.263ON50750722870.0
TDEL0F039008.263ON55948917450.0
NCAS0B050208.263ON56848917320.0
NDAI0B019908.263ON58850517110.0
KLLA0F19162g8.263ON52850317000.0
KNAG0M012108.263ON52149516940.0
YLR089C (ALT1)8.263ON59249317010.0
KNAG0G020408.263ON59149017010.0
Skud_12.1578.263ON59249316930.0
Suva_10.1738.263ON59249316870.0
Smik_12.1488.263ON59249316830.0
SAKL0H17006g8.263ON53148916760.0
CAGL0L12254g8.263ON57449416690.0
ZYRO0C01628g8.263ON53448616480.0
NCAS0B038408.263ON49749716390.0
KAFR0B055308.263ON51449016230.0
KAFR0B05520singletonON51049016170.0
Kpol_392.58.263ON51248616030.0
KAFR0B027308.263ON53948915990.0
TPHA0A018008.263ON49849115700.0
KLTH0G13662g8.263ON51950615630.0
NDAI0J013608.263ON50150715560.0
Kwal_56.237918.263ON51849315470.0
TPHA0J007508.263ON52250015390.0
Kpol_543.398.263ON49249115270.0
Ecym_43078.263ON53450115270.0
AGR085W8.263ON52148815030.0
TBLA0E044408.263ON56248514990.0
TBLA0F030608.263ON50049414900.0
TBLA0G01630singletonON50049714660.0
CAGL0J05126g1.321ON4332581268e-07
Suva_6.1361.321ON4442581269e-07
TDEL0D019001.321ON4432581214e-06
YJL060W (BNA3)1.321ON4442581204e-06
TPHA0O014501.321ON4432581187e-06
SAKL0D06886g1.321ON4472571187e-06
NCAS0A092001.321ON4452631171e-05
Skud_10.1561.321ON4602581152e-05
KLTH0H10648g1.321ON4432541152e-05
Kpol_1035.231.321ON4442591124e-05
Kwal_14.25741.321ON4432571125e-05
Smik_10.1801.321ON4442871107e-05
KAFR0A017101.321ON4352571108e-05
KLLA0F01617g1.321ON4442551108e-05
KLLA0F03509g2.252ON3872221053e-04
NDAI0G057601.321ON4482621053e-04
AEL170C1.321ON4582631054e-04
KLTH0G09614g2.252ON3892231035e-04
Kwal_34.160181.472ON3791071035e-04
Ecym_6319singletonON3542251026e-04
KNAG0E018502.252ON3841551026e-04
ZYRO0G20636g1.321ON4532601027e-04
KNAG0B053201.321ON4332541010.001
Kpol_480.11.472ON3802801000.001
SAKL0F02156g3.511ON498911000.001
KNAG0G005501.472ON387139960.003
Kpol_1039.222.252ON386219950.005
Ecym_62921.321ON430278950.005
SAKL0D11528g1.472ON38391950.005
TDEL0C040902.252ON383142950.005
TPHA0F012602.252ON392219900.017
ADL249W2.252ON387154900.017
NCAS0G040501.472ON38466890.024
NCAS0B064402.252ON385155870.038
KLTH0G19624gsingletonON46850880.041
Kwal_47.189823.511ON49691860.057
CAGL0C01243g2.252ON383147850.071
KLTH0B00176g8.204ON44847850.075
Ecym_55428.204ON446110850.076
KLTH0G19646g1.472ON37992850.079
YIL116W (HIS5)2.252ON385147840.10
KLTH0G02002g3.511ON49691840.11
Kwal_23.48882.252ON389154810.23
TBLA0B009902.102ON54644800.31
Skud_9.552.252ON385147790.45
KNAG0B006603.511ON49659790.48
Ecym_32902.252ON386163780.50
KLLA0F10021g3.511ON49789780.66
TDEL0D057903.511ON49759760.89
Kpol_278.23.511ON49885760.90
TDEL0A016008.204ON47575761.1
KAFR0J015802.252ON383154751.2
SAKL0E08492g2.252ON384154751.4
Kwal_8.5858.204ON44650751.4
KLLA0A04906gna 1ON480155741.8
KLTH0E07678gna 1ON49276741.8
Smik_9.532.252ON388155741.8
ZYRO0A01672g2.252ON386105741.8
NDAI0B037302.252ON386150722.7
Suva_9.782.252ON386147722.9
TPHA0D033703.511ON49759723.0
Kwal_47.17462na 1ON49289713.6
Kpol_1032.398.204ON45351713.7
SAKL0H21824gna 1ON499185714.0
TDEL0E025005.377ON65778714.7
YGL202W (ARO8)3.511ON50059705.8
KLLA0B14190g1.525ON249158686.9
Smik_5.3198.204ON44370687.9
NDAI0C059608.204ON478126688.7
KLLA0E00969g8.204ON44575688.7
AGR141C8.204ON438107688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Suva_2.271
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...  1015   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   887   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   885   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   885   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   676   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   671   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   663   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   659   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   657   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   659   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   659   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   656   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   654   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   652   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   650   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   647   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   639   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   635   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            629   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   627   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   622   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   620   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   609   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   606   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   603   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   600   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   597   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   592   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   592   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   583   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   582   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   578   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              569   0.0  
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    53   8e-07
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    53   9e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    51   4e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    51   4e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    50   7e-06
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    50   7e-06
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    50   1e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    49   2e-05
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    49   2e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    48   4e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    48   5e-05
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    47   7e-05
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    47   8e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    47   8e-05
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    45   3e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    45   3e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    45   4e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    44   5e-04
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    44   5e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    44   6e-04
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    44   6e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    44   7e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    44   0.001
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    43   0.001
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    43   0.001
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       42   0.003
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    41   0.005
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    41   0.005
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    41   0.005
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    41   0.005
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    39   0.017
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    39   0.017
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    39   0.024
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    38   0.038
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    39   0.041
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    38   0.057
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    37   0.071
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.075
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    37   0.076
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    37   0.079
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    37   0.10 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    37   0.11 
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    36   0.23 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    35   0.31 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    35   0.45 
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    35   0.48 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    35   0.50 
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    35   0.66 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    34   0.89 
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    34   0.90 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    34   1.1  
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    33   1.2  
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    33   1.4  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   1.4  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   1.8  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    33   1.8  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    33   1.8  
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    33   1.8  
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    32   2.7  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    32   2.9  
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    32   3.0  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    32   3.6  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    32   3.7  
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    32   4.0  
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    32   4.7  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    32   5.8  
KLLA0B14190g Chr2 complement(1245746..1246495) [750 bp, 249 aa] ...    31   6.9  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    31   7.9  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    31   8.7  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    31   8.7  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    31   8.9  

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/507 (96%), Positives = 491/507 (96%)

Query: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60
           MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS
Sbjct: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60

Query: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120
           SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK
Sbjct: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120

Query: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXX 180
           RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIY            
Sbjct: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240
               CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK
Sbjct: 181 LSLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240

Query: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300
           KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK
Sbjct: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300

Query: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS
Sbjct: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420
           ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK
Sbjct: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420

Query: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480
           PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR
Sbjct: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480

Query: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507
           TTFLPPGTQWIQDWRQFHQDFFNKYRD
Sbjct: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/507 (82%), Positives = 456/507 (89%)

Query: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60
           MTMT Q+DLKSVF  KDLDFKPAAK+TKKDLN SVTKAEYAVRG+IPTRA+ELKEELK++
Sbjct: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60

Query: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVLSILEYPEIL+VDH+KLASLNLF+KDALK
Sbjct: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120

Query: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXX 180
           RA+ LL DIGGSVGAYSHSQGVPGIRQTVADFIT RDGGEPA PEDIY            
Sbjct: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240
               CKD++TGLL+PIPQYPLYTASASL+NAQVLPYYLDEE +WSTESDEIE+VV DAL+
Sbjct: 181 LSLLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240

Query: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300
           KGIRPSVL+VINPGNPTGAVLTE TIA+ICLIAAKYGI +ISDEVYQEN+F D KFHSMK
Sbjct: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300

Query: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           K+LRKLQ+ +PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS
Sbjct: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420
           ICSV TGQAI+DLMV PPQPGDESY+QDR+ER KI+NEM TRANLLYETFN LEGI+CQ 
Sbjct: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420

Query: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480
           PQGAMYLFP+L LP+KA RESERL +EPD  YC SLLESTGICTVPGSGFGQK GTYHVR
Sbjct: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480

Query: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507
           TTFL PGTQWIQ+W+ FHQ FFN+YRD
Sbjct: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/507 (82%), Positives = 457/507 (90%)

Query: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60
           M MT Q+DLKSVFTTKDL+FKPAAK+TKKDLNA VTKAEYAVRGAIPTRA+ELKEELKR 
Sbjct: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60

Query: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVLSILEYPEILRV  DKLASLNLF KDAL 
Sbjct: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120

Query: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXX 180
           RA+ LL+DIGGS+GAYSHSQGVPGIRQ+VA+FIT+RD GEPA PE+IY            
Sbjct: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240
               CKD QTGLL+PIPQYPLYTASASL+NAQVLPYYLDE ++WST+SDEIE+VV DAL+
Sbjct: 181 LSLLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240

Query: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300
           KGI+PSVL+VINPGNPTGAVL+E+TIAKICLIAAKYGI IISDEVYQEN+F  VKFHSMK
Sbjct: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300

Query: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           K+LRKLQ L+PGKFDNVQLASLHSISKGFMGECGQRGGYME+VGFS+DIRDALFKLMSIS
Sbjct: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360

Query: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420
           ICSV TGQA++DLMVKPPQPGDESYDQD  ER+KI++EM TRA LL+ETFNELEGI+CQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420

Query: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480
           PQGAMYLFP+L LPEKALRESERL IEPD  YCTSLLESTGICTVPGSGFGQ+ GTYHVR
Sbjct: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480

Query: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507
           TTFL PGTQWIQDW+ FHQDFFNKYRD
Sbjct: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/507 (82%), Positives = 460/507 (90%)

Query: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60
           MTMT Q+DLK VFT KDLDFKPA K+TKKDLN  VTKAEYAVRGAIPTRA+ELKEELK++
Sbjct: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60

Query: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVL+ILEYPEILRV H++LASLNLF++DAL+
Sbjct: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120

Query: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXX 180
           RA+RLL+DIGGS+GAYSHSQGVPGIRQTVADFIT RDGGEPA PEDIY            
Sbjct: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240
               CKDSQTGLL+PIPQYPLYTASASL+NAQVLPYYLDEE++WST SDEIE+VV DALK
Sbjct: 181 LSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240

Query: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300
           K IRPSVL+VINPGNPTGAVL+E TIA+ICLIAAKYGITIISDEVYQENIF DVKFHSMK
Sbjct: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300

Query: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           K+LRKLQ+L+PGKFDNVQLASLHSISKGFM ECGQRGGYMEI+GFSQ+IRDALFKLMSIS
Sbjct: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360

Query: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420
           ICSV TGQA++DLMVKPPQPGDESY+QD  ERLKI++EM TRANLLYETF ELEGI+CQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420

Query: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480
           PQGAMYLFP+L LP+KAL ESERL IEPD  YCTSLLESTGICTVPGSGFGQ+ GTYHVR
Sbjct: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480

Query: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507
           TTFL PGT+WIQDW++FHQDFF+KYR+
Sbjct: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/489 (63%), Positives = 388/489 (79%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78
           DF PA  LT +DLN +V KA+YAVRG+IP RAEEL+E+LKR  +SLPF+ I+NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138
           QL+QKPL+F RQVLSIL+YPE+L    ++L S  +F +DA++RA+R+L D+GGSVGAYS 
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190

Query: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQ 198
           SQGV GIR+TVADFITERD GEPA PEDI+                C+  +TG+L+PIPQ
Sbjct: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250

Query: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258
           YPLYTA+ +L N+ VLPYYLDEE+ WST + EIE VV ++++ GIRPSVLVVINPGNPTG
Sbjct: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310

Query: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318
           +VL+   I KI  +AAKYGI +I+DEVYQENIF   +FHSMKK+LR+LQ  HPG +DNVQ
Sbjct: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C V TGQA++DLMV PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438
           +PGDESY+QDRKER  I+ E+  RA LL++TFN LEGI+CQKP+GAMYLFP++ LP KA+
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498
           + ++ L   PD  YC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W  FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 499 QDFFNKYRD 507
           + F+++YRD
Sbjct: 551 KKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/489 (64%), Positives = 385/489 (78%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78
           +F PA +LT  +LN +V KA+YAVRGAIP RAEELK +L+   +SLPF+ I+NANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138
           QL+QKPL+F RQVLS+L+YPEIL+ D  KL +  LF KDAL+RA+ LL +IGG+VGAYS 
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199

Query: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQ 198
           SQGV GIR+TVA+FIT+RD GEPA PEDI+                CK  +TG+L+PIPQ
Sbjct: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259

Query: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDE++ WST   EIE VVL A  K IRPSVLVVINPGNPTG
Sbjct: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319

Query: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318
           AVL+E +I  I  IAAKYGI +I+DEVYQEN+F +VKFHSMKK+LR LQ  HPG +D VQ
Sbjct: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C V TGQA++DLMV PP
Sbjct: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439

Query: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438
           + GDES++QD+ ER  I +E+ TRA  LY+ FN LEGI+CQKPQGAMYLFP+L LP KA+
Sbjct: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499

Query: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498
           ++++ L + PD  YC SLLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W+ FH
Sbjct: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559

Query: 499 QDFFNKYRD 507
           QDF+N YRD
Sbjct: 560 QDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/505 (62%), Positives = 389/505 (77%)

Query: 3   MTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSN 62
           MT      S+   K  DF PA +LT  DLN +V KA+YAVRG+IP RAEELK +L+ + +
Sbjct: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143

Query: 63  SLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRA 122
           +LPF+ I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+ +   L    ++ +DA+ RA
Sbjct: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203

Query: 123 QRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXX 182
           + LL +IGGSVGAYS SQGV GIR+TVA+FITERDGGEPA PEDI+              
Sbjct: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263

Query: 183 XXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKG 242
             C+  +TG+L+PIPQYPLYTA+ +L N+  LPYYLDE++ WST   EIE VV DA+++ 
Sbjct: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323

Query: 243 IRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKI 302
           I PSVLVVINPGNPTGAVLTE +I  I  IAAKYGI +I+DEVYQENI   VKF+SMKK+
Sbjct: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383

Query: 303 LRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362
           LRKLQ  HPGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443

Query: 363 SVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQ 422
            V TGQA++DLMV PP+ GD SY+QD+ ER  I +E+  RA+ LYETF  LEGI+CQKPQ
Sbjct: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503

Query: 423 GAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTT 482
           GAMYLFPKL LP KA++E++ L + PD  YC SLL++TGICTVPGSGFGQ+ GTYH+RTT
Sbjct: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563

Query: 483 FLPPGTQWIQDWRQFHQDFFNKYRD 507
           FL PGT+WI+ W  FH++F++ YRD
Sbjct: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/503 (61%), Positives = 396/503 (78%), Gaps = 6/503 (1%)

Query: 9   LKSVFTTKDLDF----KPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSL 64
           + SV +   L F    KPA KL+  D+N +V KA+YAVRG IP RAEEL+++LK+  +SL
Sbjct: 28  MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSL 87

Query: 65  PFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQR 124
           PF+ II+ANIGNPQQLDQKPLTF R+VLS+L++PE+L    + L +L  +  D++KRA+R
Sbjct: 88  PFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKR 145

Query: 125 LLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXX 184
           LL ++GGSVGAYS SQGV GIR+TVADFIT+RD GE + PEDIY                
Sbjct: 146 LLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSIL 205

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           CK   TG+L+PIPQYPLYTAS +L N++ LPYYL EE +WST+ +EIE+VVLDA++KGI+
Sbjct: 206 CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 265

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304
           P+ LVVINPGNPTGA+L+E +I KI  +AAKYGI +I+DEVYQEN+F   KF+SMKK+LR
Sbjct: 266 PTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLR 325

Query: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSV 364
            LQ  + G++DN+QLASLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V
Sbjct: 326 NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPV 385

Query: 365 ATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGA 424
            TGQA++DLMV PPQPGDESY+QD++ER  I++ +  RA+ L+ETF+ LEGI+C+KPQGA
Sbjct: 386 VTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGA 445

Query: 425 MYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFL 484
           MYL+PKL LP K ++E++ L +EPD  YC +LLE+TGICTVPGSGFGQ  GTYH+RTTFL
Sbjct: 446 MYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFL 505

Query: 485 PPGTQWIQDWRQFHQDFFNKYRD 507
           PPGT+W++ W +FH+ FF+KYRD
Sbjct: 506 PPGTEWVETWEKFHKAFFDKYRD 528

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/495 (61%), Positives = 390/495 (78%), Gaps = 2/495 (0%)

Query: 14  TTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINAN 73
           T   L F+PA KL   DLN ++  AEYAVRGAIP +AEEL+ +L +  + LPFN+I  AN
Sbjct: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87

Query: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSV 133
           IGNPQQLDQKPLTF+RQV+SIL+YP +L  + ++L +   + +DA KRA  LL+ IGGSV
Sbjct: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDYE-EQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 134 GAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLL 193
           GAYS +QGV GIR++VADFIT RD GE A P+DI+                C+DS TG++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 194 LPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINP 253
           +PIPQYPLYTAS ++YN+ +LPYYLDEE+ WST+++EIE+ V+D++K+G+ P V+VVINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 254 GNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP-G 312
           GNPTGAVL+ +TIA+I  IAAKYGI +++DEVYQ NI+  VKFHSMKK+LR LQ  HP G
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIID 372
           ++DNVQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSV TGQA++D
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 373 LMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLF 432
           LM+ PP+ GD+SY+ D +ER +I+N M TR  LLY+TF +LEGI+CQ+PQGAMYLFPKL 
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 433 LPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQ 492
           L +KA+ E++ L ++PD  YC  LL++TGICTVPGSGFGQK GTYHVRTTFL PGTQWI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 493 DWRQFHQDFFNKYRD 507
           DW  FH+ F++KYRD
Sbjct: 507 DWETFHKAFYDKYRD 521

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/493 (62%), Positives = 384/493 (77%)

Query: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74
           T + +F PA +LT +D+N +V KA+YAVRGAIP RAEELK +L++   SLPF+ IINANI
Sbjct: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L++DIGGSVG
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           AYS SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+L+
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE + WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGAVL+  +IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
           V+PP  G+ES++ D+ ER  I+ +++TRA  LYETFN LEGI+CQKPQGAMYLFPK+ LP
Sbjct: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
            KA++E+  L + PD  YC  LLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W
Sbjct: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 RQFHQDFFNKYRD 507
             FH++FF++YRD
Sbjct: 580 ESFHKEFFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 386/490 (78%), Gaps = 2/490 (0%)

Query: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79
           F PAA++   DLN +V KA+YAVRG+IP RAE+L+ +L+    SLPF+ IINANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 80  LDQKPLTFTRQVLSILEYPEILR-VDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138
           L+QKPL+F RQVLS+L++PE+L  +  +  A+ +L+  DA++RA++LL+DIGGSVGAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQ 198
           SQGV GIR+TVADFIT RD  EPA PEDI+                CK  +TG+L+PIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258
           YPLYTA+ +L N+  LPYYLDE++ WST + EI+ VVLDA+ + I+PSVLVVINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFG-DVKFHSMKKILRKLQNLHPGKFDNV 317
           AVL+E  IA+I  IAAKYGI +I+DEVYQENIF  DVKFHSMKK+LRKLQ  HPGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 318 QLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKP 377
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C V TGQA++DLMV P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 378 PQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKA 437
           PQ G+ESY+ D+ ER  I++E+  RAN L+ETFN LEGI+CQKPQGAMYLFP+L LP KA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 438 LRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQF 497
           +++++ + +  D  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI  W +F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 498 HQDFFNKYRD 507
           H++F+NKYRD
Sbjct: 582 HKEFYNKYRD 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/493 (62%), Positives = 386/493 (78%)

Query: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74
           T + DF PA +LT +D+N +V KA+YAVRGAIP RAEELK +L++   SLPF+ IINANI
Sbjct: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L++DIGGSVG
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           AYS SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+L+
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE++ WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGAVL+  ++++I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKF
Sbjct: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
           V+PP  G+ES++ D+ ER  I+ +++TRA  LY+TFN LEGI+CQKPQGAMYLFPK+ LP
Sbjct: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
            KA++E+  L + PD  YC SLLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W
Sbjct: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 RQFHQDFFNKYRD 507
             FH++FF++YRD
Sbjct: 580 ETFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/493 (62%), Positives = 381/493 (77%)

Query: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74
           T + +F PA +LT  D+N +V KA YAVRGAIP RAEELK +L++   SLPFN IINANI
Sbjct: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L+ DIGGSVG
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219

Query: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           AYS SQGV GIR++VADFIT+RDGGE A PEDI+                C+  +TG+L+
Sbjct: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE + WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGAVL+  +IA+I  +AAKYG  +I+DEVYQENIF   +F+SMKK+LR LQ  HPGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
           V+PP  G+ES++ D+ ER  I+ ++ TRA  LYETFN LEGI+CQKPQGAMYLFPK+ +P
Sbjct: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
            KA++E+  L + PD  YC  LLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +W++ W
Sbjct: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579

Query: 495 RQFHQDFFNKYRD 507
             FH++FF++YRD
Sbjct: 580 EIFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/493 (61%), Positives = 381/493 (77%)

Query: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74
           T + +F PA +LT  D+N +V KA+YAVRGAIP RAEELK +L++   SLPFN IINANI
Sbjct: 100 TSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L+++IGGSVG
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVG 219

Query: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           AYS SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+L+
Sbjct: 220 AYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE + WST  +EIE VV +A++  I+ +VLVVINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPG 339

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGAVL+  +IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
           V+PP  G+ES++ D+ ER  I+ +++TRA  LY+TFN LEGI+CQKPQGAMYLFPK+ LP
Sbjct: 460 VRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
            +A++E+  L + PD  YC  LLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W
Sbjct: 520 FRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 RQFHQDFFNKYRD 507
             FH++FF+ YRD
Sbjct: 580 ETFHKEFFDHYRD 592

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 382/489 (78%), Gaps = 3/489 (0%)

Query: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79
           F+PA KL+ +DLN +V +A+YAVRG IP +AEELK +L R   SLPF+ IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 80  LDQKPLTFTRQVLSILEYPEILR-VDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138
           LDQKPLTF RQVLS+L+ P++L  +  ++L+   ++  DA+ RA RLL +IGGSVGAYSH
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS--QIYKPDAIDRAARLLSNIGGSVGAYSH 162

Query: 139 SQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQ 198
           SQGV G R+TVADFIT+RDGGE A  EDI+                C+  QTG+L+PIPQ
Sbjct: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222

Query: 199 YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDEE++WST  +EIE+VV +++ KG+ P  LVVINPGNPTG
Sbjct: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282

Query: 259 AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318
           A+L+  +I KI  +AAKYGI +I+DEVYQEN+F   +FHSM+K+L+ LQ  H GKFDN+Q
Sbjct: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378
           LASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C V TGQA++DLMV PP
Sbjct: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402

Query: 379 QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438
           +PGD SY+QD+KER +I++ +  RA++LYETFN LEGI+CQKPQGAMYLFP+L L  KA+
Sbjct: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462

Query: 439 RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498
           +++E L++ PD  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL PGT WI+ W +FH
Sbjct: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522

Query: 499 QDFFNKYRD 507
           + F+N+YRD
Sbjct: 523 KKFYNEYRD 531

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/494 (61%), Positives = 382/494 (77%), Gaps = 2/494 (0%)

Query: 14  TTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINAN 73
           +  +L F PA + T KD+N  V  A+YAVRGAIP RAEELK +L  + +SLPFN IINAN
Sbjct: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142

Query: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSV 133
           IGNPQQL QKPL+F RQVLS+L+YPE++    +   ++    +DA+ RA+RLLDDIGGSV
Sbjct: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSV 200

Query: 134 GAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLL 193
           GAYS SQGV GIR+TVADFIT RD G  A PEDI+                C+  +TG+L
Sbjct: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260

Query: 194 LPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINP 253
           +PIPQYPLYTA+ +L N+  LPYYL+EE  WST+ +E+E ++LD+++  I+PSVLVVINP
Sbjct: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINP 320

Query: 254 GNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGK 313
           GNPTGAVL+E  I +I  +AAKYGI +I+DEVYQEN+F DVKFHSMKK+LR+LQ   PG 
Sbjct: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380

Query: 314 FDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDL 373
           +DNVQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C V TGQA++DL
Sbjct: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440

Query: 374 MVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFL 433
           MV PPQ G+ESY+QD++ER  I+ E+  RA LL++ F +L+GI CQKPQGAMYLFPKL L
Sbjct: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500

Query: 434 PEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQD 493
           P KA++E+   ++ PD  YC SLLE TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+D
Sbjct: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560

Query: 494 WRQFHQDFFNKYRD 507
           W  FHQ+F+NK+++
Sbjct: 561 WVDFHQEFYNKFKN 574

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/486 (61%), Positives = 370/486 (76%)

Query: 22  PAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLD 81
           PA KL   ++N +V KA+YAVRGAIP  A EL  +LK+  +SLPF++I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 82  QKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141
           QKPLTF RQVLS+L+YP +L  +   L    L+ KDA+ RA+RLL+DIG SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 142 VPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQYPL 201
           + GIR+TVA FITERDGGE A  EDI+                CK  +TG+L+PIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261
           YTAS +L N+  LPYYLDE++ WST   EIE VV +A+++ I+PSVLVVINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321
           +E  I++I  IAAKYGI +I+DEVYQEN+F   +FHSMKKILRKLQ  +PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381
           LHS SKG  GECGQRGGYMEI GF+ DIR  + KL SIS+C V TGQA++DLMV PP+PG
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441
           DESY+ D++ER  I+  +  RA  L+ TFN LEGI+CQKP+GAMYLFP+L LP KA++ +
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501
           E   + PD  YC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W  FH+ F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 502 FNKYRD 507
           + +YRD
Sbjct: 529 YEEYRD 534

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/497 (58%), Positives = 385/497 (77%), Gaps = 1/497 (0%)

Query: 11  SVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSII 70
           S  + ++ DF+PA KL+ KD+N +V  A++A+RG+I  +AE+L+ +L ++ + LPF+ I 
Sbjct: 2   SPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEIT 61

Query: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIG 130
            ANIGNPQ+L+QKPLTF RQV+SIL+YPE+L  + D L    +F  D+  RA+RLL DIG
Sbjct: 62  VANIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIG 120

Query: 131 GSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQT 190
           GSVGAYS SQGV GIR+T A++IT+RDGGEP+ PEDI+                C+  QT
Sbjct: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180

Query: 191 GLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVV 250
           G+L+PIPQYPLYTA+ +L  + ++PYYLDEE+ WST + EIE++VLD++KKGI+PSV+VV
Sbjct: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240

Query: 251 INPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLH 310
           INPGNPTGAVL+E  IAKI  IAAKYGI +++DEVYQENIF  V+FHS KK+LR LQ  +
Sbjct: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300

Query: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAI 370
           PGKFDN+QLAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSV TGQA+
Sbjct: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360

Query: 371 IDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPK 430
           +DLM+ PP+ GD SY+ D+KER +I++ M  RA  LY  F++L+GI+CQKPQGAMYL+P 
Sbjct: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420

Query: 431 LFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQW 490
           L L +KA+ ++E LN+ PD  YC  LL++TGICTVPGSGFGQK GTYH+RTTFL PG +W
Sbjct: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480

Query: 491 IQDWRQFHQDFFNKYRD 507
           I  W +FH+ F+ KY+D
Sbjct: 481 INKWEKFHKHFYEKYQD 497

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/490 (61%), Positives = 377/490 (76%), Gaps = 4/490 (0%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEEL--KRSSNSLPFNSIINANIGN 76
           +FKPA K+T  DLN +V K+EYAVRG+IP RAEEL+ EL    SS+SL F +I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136
           PQQLDQKPLTF+RQV+SIL+YPE+L    + L S  +F  DA++RA+ LL  IGGSVGAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPI 196
           S SQGV GIR+TVA++IT RD GE A P+DI+                CKD  TG+L+PI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           PQYPLYTA+ +L +A++LPYYL+EE+ WST ++EIE+VVLDA+   ++PSV+VVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316
           TG+VL+++ I  I  I AKYGI +I+DEVYQENIF D +FHSMKK+LR LQ  +PGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV TGQA++DLMV 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436
           PP+ GDESY+ D  ER  I+  +  RA  LY  F +L+G++CQKPQGAMYLFPKL  P+ 
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496
            + E+   N+ PD  YC +LLE+TGICTVPGSGFGQK GTYH+RTTFL PG QW + W+ 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 497 FHQDFFNKYR 506
           FH++FF+KY+
Sbjct: 505 FHEEFFSKYQ 514

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/490 (60%), Positives = 379/490 (77%), Gaps = 4/490 (0%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEEL--KRSSNSLPFNSIINANIGN 76
           DF+PA K++  DLN  +  AEYAVRG+I  RAEEL+ EL  K   +S PF  II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136
           PQQLDQKPLTF+RQV+SILEYP +L+   D L S  ++ KDAL+RA+ L   IG SVGAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFK-DVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPI 196
           S +QGV GIR+T A FI++RD  E A  +DI+                C++  TG+L+PI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           PQYPLYTAS  ++NA++LPYYLDEE+ WST+ +EIE  V++A++ GI+PS +VVINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316
           TGAVL+ + I +I  +AAKYGI +I+DEVYQ+NIF   +FHSMKKILR+LQ  +PGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376
           VQLASLHS SKG  GECGQRGGYMEIVGFS ++R  L KL SI+ICSV TGQA++DLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436
           PP  GDESY++D++ER +I++ +  RA+ LY+TF+ LEGI+CQKPQGAMYLFP+L LP++
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496
           A+ E+++L +E D  YC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL PGT+WI DW++
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 497 FHQDFFNKYR 506
           FH+ F  +Y+
Sbjct: 501 FHEKFMKEYQ 510

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/486 (60%), Positives = 373/486 (76%), Gaps = 8/486 (1%)

Query: 22  PAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLD 81
           PA KL   DLN +V KA+YAVRG+IP RAEELK  L+ +   LPF+++INANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLE-AGQKLPFDTVINANIGNPQQLK 93

Query: 82  QKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141
           QKPLTF RQVLSIL+YPE+L       +  N+F KDA++RA++LL +IG SVG+YS SQG
Sbjct: 94  QKPLTFYRQVLSILQYPELLE------SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQG 146

Query: 142 VPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQYPL 201
           +P IR+TVA+FIT+RD GE + P DI+                CK+ ++G+L+PIPQYPL
Sbjct: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPL 206

Query: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261
           YTA+ +L NA  LPYYLDE   WST+ +EIE V+ D+L KGI+P+ LV+INPGNPTG++L
Sbjct: 207 YTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266

Query: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321
           +  ++ KI  +AA +GI II+DEVYQEN+F + KFHSMKK+LR LQ   PG++D VQLAS
Sbjct: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381
           LHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C V TGQA++DLMV PPQ G
Sbjct: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386

Query: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441
           DESY+QD+ ER  I N++  RA LL+E FN +EG+ CQKP+GAMYLFPK+ LP K L++S
Sbjct: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446

Query: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501
           + L+I PD  YC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI  W +FH +F
Sbjct: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506

Query: 502 FNKYRD 507
           ++KYRD
Sbjct: 507 YDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/489 (61%), Positives = 372/489 (76%)

Query: 17  DLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGN 76
           +L+FKPA +LT  DLN +V KA+YAVRG IPTRAEELK +L    NSLPF+ IINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  ++ KDA+ RA+++L DIGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPI 196
           S SQGV GIR+TVA+FITERDGGEPA PEDI+                CK  +TG+L+PI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           PQYPLYTA+ +L N+  LPY+LDE   WS    EIE V+  A++  I+P VLVVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316
           TGAVL++  I  I  IAAKYGI +I+DEVYQENIF  +KFHS+K +LR+LQ   PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376
           VQLASLHS SKG  GECGQRGGYMEI+GF+ ++R  + KL SIS+C V TGQA++DLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436
           PP+ G+ES+  D+ +R  I++++  RA LL++TFN L+GI+CQKP GAMYLFPKL LP +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496
           A++E++RL + PD  YC  LLE TGICTVPGSGFGQ +GTYH+RTTFL PG +WI  W+Q
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 497 FHQDFFNKY 505
           FH +F  KY
Sbjct: 529 FHIEFMEKY 537

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/491 (58%), Positives = 369/491 (75%), Gaps = 4/491 (0%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78
           DF P AK+T KDLN+ + K +YAVRG IP RAEELK +L++   SLPFN IINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASL---NLFAKDALKRAQRLLDDIGGSVGA 135
           QL QKPL+F R+VLSIL+YP+IL  D  KL +L    ++ KD ++RA++LL +IGGSVGA
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILE-DESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126

Query: 136 YSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLP 195
           YS SQGVPGI+QTVAD+IT+RD GE A PEDI+                C    TG+L+P
Sbjct: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186

Query: 196 IPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGN 255
           IPQYPLYTA+ +L  A  + YYL+EE +WS  + E+E  + +++K GI+P+ +V+INPGN
Sbjct: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246

Query: 256 PTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFD 315
           PTG++LTE  IA I  I+AKYG+ II+DEVYQEN+F   +FHS+KK+LRKLQ  + G ++
Sbjct: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMV 375
            VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSV TGQA+ID++V
Sbjct: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366

Query: 376 KPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPE 435
            PP+PGDESY+ D+ ER  I N++++R+  L++ F  LEG++C +PQGAMYLFPK   P+
Sbjct: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426

Query: 436 KALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWR 495
           K +  +++L+ E D LYC  LLE TGICTVPGSGFGQK  TYH+RTTFL PG  WI  WR
Sbjct: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486

Query: 496 QFHQDFFNKYR 506
           +FH +F  +YR
Sbjct: 487 KFHTEFCERYR 497

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/506 (57%), Positives = 369/506 (72%), Gaps = 8/506 (1%)

Query: 3   MTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSN 62
           ++ +  +KS  + K L     +K T +D+N  V  A+YAVRG IP RAEEL+ +L     
Sbjct: 21  LSAKAAVKSDLSQKAL----GSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPG 76

Query: 63  SLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN-LFAKDALKR 121
           SLPFN IINANIGNPQQLDQKPLTF RQVLS+L+ P +  ++      L+ LF  DA++R
Sbjct: 77  SLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPAL--IESLPTGELHKLFKPDAVER 134

Query: 122 AQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXX 181
           A+++L  +GGSVGAYS SQGV G RQ+VA+FI ERDG EPA   DI+             
Sbjct: 135 AKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAIL 193

Query: 182 XXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKK 241
              C  S+ G L+PIPQYPLYTA+ +L +A  LPYYLDE + WS +++++E+VV DA++K
Sbjct: 194 SMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRK 253

Query: 242 GIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKK 301
           G+RP+ LVVINPGNPTGA+L+   I KI  +AAKY + +I+DEVYQEN F D  F SMKK
Sbjct: 254 GVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKK 313

Query: 302 ILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISI 361
           +LR LQ   PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+
Sbjct: 314 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 373

Query: 362 CSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKP 421
           C V TGQA++DLMV+PP+ GD SY+ DR+ER  I+N +  ++ LLYETF  LEG+ CQKP
Sbjct: 374 CPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKP 433

Query: 422 QGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRT 481
           QGAMYLFPKL L  KA+R++E L + PD  YC  LLE+TGICTVPGSGF Q  GTYH+RT
Sbjct: 434 QGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRT 493

Query: 482 TFLPPGTQWIQDWRQFHQDFFNKYRD 507
           TFL PGT+W+  W++FHQ F +++RD
Sbjct: 494 TFLAPGTEWVDSWKKFHQKFVDEHRD 519

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/507 (56%), Positives = 373/507 (73%), Gaps = 12/507 (2%)

Query: 2   TMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSS 61
           T T Q DL         DF+PA KL+ KDLN +V KAE+AVRG IP +A+EL+ +L ++ 
Sbjct: 3   THTIQTDLH--------DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNP 54

Query: 62  NSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN--LFAKDAL 119
           +SLPFN I  ANIGNPQ+L QKPLTF RQV+SIL+YPE+L    ++L S    ++  D+ 
Sbjct: 55  HSLPFNEITVANIGNPQELHQKPLTFARQVVSILQYPELLN-RRNELTSTTPPIYNNDSF 113

Query: 120 KRAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXX 179
            RA++LL++IGGSVGAYS SQGV GIR+T+A++IT+RD GE A P DI+           
Sbjct: 114 DRAEKLLNEIGGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSY 173

Query: 180 XXXXXCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVL-DA 238
                    QTG+LLPIPQYPLYTA  +L+NA +LPYYL+EE+ WS +++EIE+ +  +A
Sbjct: 174 LLSILSNGPQTGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNA 233

Query: 239 LKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHS 298
           + KGI+P V+V+INPGNPTG++L+E+++ KI  IAAKYGI II+DEVYQEN+F   KFHS
Sbjct: 234 MTKGIQPKVMVIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHS 293

Query: 299 MKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS 358
            KK+LR LQ   P +++NVQLASLHS SKG  GECGQRGGYMEI+GF+ D+R+ + KL  
Sbjct: 294 CKKVLRSLQKQFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLAC 353

Query: 359 ISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKC 418
           I +C V TGQA++DLM+ PP+ GD+SY  D  ER +I+N+ML RA  LY+ F+ +EGI+C
Sbjct: 354 IDVCPVVTGQAMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQC 413

Query: 419 QKPQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYH 478
           QKPQGAMYLFP+L L  K + E+++  +EPD  YC  LL  TGICTVPGSGFGQK  TYH
Sbjct: 414 QKPQGAMYLFPRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYH 473

Query: 479 VRTTFLPPGTQWIQDWRQFHQDFFNKY 505
           +RTTFL PG QWI  W +FH+ F  +Y
Sbjct: 474 LRTTFLAPGDQWINKWEKFHKAFLKRY 500

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/493 (57%), Positives = 363/493 (73%), Gaps = 3/493 (0%)

Query: 16  KDLDFKP-AAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74
           KD   KP  +K T +D+N  V  A+YAVRG IP RAEELK++L     SLPF+ IINANI
Sbjct: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134
           GNPQQLDQKPLTF RQVL++L+ P+++  D         F  DA++RA+++L  +GGSVG
Sbjct: 88  GNPQQLDQKPLTFYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGSVG 146

Query: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           AYS+SQGV G R++VA+FI ERDG EPA  +DI+                C   + G L+
Sbjct: 147 AYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALI 205

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTAS +L N+  LPYYLDEE+ WS ++++IE+VV D++KKGIRP+ LVVINPG
Sbjct: 206 PIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPG 265

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGA+L  +TI  +  +AAKY + II+DEVYQEN F D +F SMKK+LR LQ   PGK+
Sbjct: 266 NPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKY 325

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C V TGQA+IDLM
Sbjct: 326 DNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLM 385

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
           V+PP+ GD SY+QDR+ER  I++ +  R+ LLY+ F  +EG+ CQ+PQGAMYLFPKL L 
Sbjct: 386 VRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELS 445

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
            KA+ ++E   + PD  YC  LLE+TGICTVPGSGFGQ  GT+H+RTTFL PGT+WI  W
Sbjct: 446 NKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSW 505

Query: 495 RQFHQDFFNKYRD 507
           ++FH+ F   +RD
Sbjct: 506 KKFHEKFTEDHRD 518

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/500 (59%), Positives = 377/500 (75%), Gaps = 7/500 (1%)

Query: 11  SVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSII 70
           +  + K  +FKPA KLT  DLN +V KA+YAVRG IP RAE LK++L  + +SLPF  +I
Sbjct: 27  TTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVI 86

Query: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLN---LFAKDALKRAQRLLD 127
           NANIGNPQQL+QKPLTF RQVLS+L+YP +L    D+  S N   L+ +DA++RA+R+L+
Sbjct: 87  NANIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILN 142

Query: 128 DIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKD 187
           DIG SVG+YS SQGV G+R+TVA++I+ RDGGE A  EDI+                CK 
Sbjct: 143 DIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKG 202

Query: 188 SQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSV 247
            ++G+L+PIPQYPLYTA+ +L N   LPYYL+E + WST  +EIE VV +A+++ I P V
Sbjct: 203 KESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRV 262

Query: 248 LVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQ 307
           LVVINPGNPTGA+L+  +I KI  +AA +GI +I+DEVYQENIF   +FHSMKK+LR LQ
Sbjct: 263 LVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQ 322

Query: 308 NLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATG 367
              PGK++NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C V TG
Sbjct: 323 RRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTG 382

Query: 368 QAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL 427
           QA++DLM  PP+ G+ SY+QD+ ER  I++E+  RA  L++ FNE+EG+ CQKPQG+MYL
Sbjct: 383 QALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL 442

Query: 428 FPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPG 487
           FPK+ +P KAL +++ L+I PD LYC  LLE+TGICTVPGSGFGQK GT+H+RTTFL PG
Sbjct: 443 FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPG 502

Query: 488 TQWIQDWRQFHQDFFNKYRD 507
           T WI  WR+FHQ F NKYRD
Sbjct: 503 TSWIDQWREFHQIFCNKYRD 522

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/491 (56%), Positives = 359/491 (73%), Gaps = 3/491 (0%)

Query: 18  LDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNP 77
           + F PA KL+  DLN     A+YAVRG+IP RAE+L  ++     SLPF+ II ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 78  QQLDQKPLTFTRQVLSILEYPEILRVDH--DKLASLNLFAKDALKRAQRLLDDIGGSVGA 135
           QQ+ QKPLTF RQVLSILEYP IL      +KL  L ++ +D ++RA+++LD IGGSVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 136 YSHSQGVPGIRQTVADFITERDGGEP-AGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLL 194
           YS SQGV G RQTVADFI +RDG +  A P DI+                C   + G+L+
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254
           PIPQYPLYTA+ +L N+  +PYYL E   WST + EIE  + +++  G++P  +V+INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314
           NPTGA+L+E+ +A I  I+AKYGI II+DEVYQENIF   +FHSM+K+L  LQ+  PG +
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374
           DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSV TGQA++DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434
             PPQPGD SY  D++ER KI  +++ RA+ LY  F  LEG++CQ+PQGAMYLFPKL LP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494
           +KA+ ++ +L I PD  YC  LL++TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 495 RQFHQDFFNKY 505
           R+FHQ F+ ++
Sbjct: 481 REFHQQFYERF 491

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/501 (55%), Positives = 374/501 (74%), Gaps = 6/501 (1%)

Query: 9   LKSVFT-TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFN 67
           L+S+ + T  + F+P   L  +DLN++V +A+YAVRG IP RA EL+ +L R  +SLPF 
Sbjct: 38  LRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFK 97

Query: 68  SIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAK-DALKRAQRLL 126
            II ANIGNPQQL QKPL+F+R+VLS+LE P +L++    +  LNL  K DA++RA+R++
Sbjct: 98  KIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM---PMEVLNLIYKPDAVRRAKRMM 154

Query: 127 DDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCK 186
            D+  S+GAYSHSQGV G R+TVA++++ RDG EPA  EDI+                CK
Sbjct: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCK 213

Query: 187 DSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPS 246
             ++G+L+PIPQYPLYTA+ +L N   LPYYLDEE+ WS   D++ER+++++++KG++P+
Sbjct: 214 GQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPA 273

Query: 247 VLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKL 306
            LVVINPGNPTGA+L   ++ +I +IAAKY I +I+DEVYQEN+F  +KF+SMKK+LR L
Sbjct: 274 CLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSL 333

Query: 307 QNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVAT 366
           Q  +   F NVQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS   
Sbjct: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG 393

Query: 367 GQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMY 426
           GQA++DLM+  P+PGDESY++D  ER  I N +  R+  L+ETFN LEG++C+KPQG+MY
Sbjct: 394 GQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMY 453

Query: 427 LFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPP 486
           LFP+L LP+KA++ +E L+++PD  YCT LL STGICTVPGSGFGQ   T H+RTTFL P
Sbjct: 454 LFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCP 513

Query: 487 GTQWIQDWRQFHQDFFNKYRD 507
           GT+WI+ W  FH+ F++KYRD
Sbjct: 514 GTEWIESWELFHKSFYDKYRD 534

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/488 (57%), Positives = 356/488 (72%), Gaps = 3/488 (0%)

Query: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79
           F PA  +T  D+N +V KA+YAVRG IPTRAEEL+  L+    SLPF+ II ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 80  LDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHS 139
           L QKPLTF RQV+S+++ P++L +  + L     F  D + RA+R+L D GGSVGAYS S
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 140 QGVPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQY 199
           QGV G R+TVA FI  RDG  PA P+++Y                CK  +TG+L+PIPQY
Sbjct: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 200 PLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGA 259
           PLYTA+ +  NA  LPYYL+E   WST  DE+ERV+LD+ K+ I P  LVVINPGNPTG+
Sbjct: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 260 VLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQL 319
           VL+   +  I  +AAKYGI +I+DEVYQ+N+FGD KFHSM+K+L+ LQ   P  + NVQL
Sbjct: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 320 ASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQ 379
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C V TGQA++DLMV PP 
Sbjct: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 380 PGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALR 439
            GD SY+Q  +E   IY+E+  R+ LL++TF  LEGI+C  PQGA+YLFPKL LP+KA+ 
Sbjct: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 440 ESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQ 499
            +++L I  D LYC+ LL+ TGICTVPG+GFGQ  GTYHVRTTFLPPGT+WI+ W+ FH+
Sbjct: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 500 DFFNKYRD 507
            F++KYRD
Sbjct: 514 KFYDKYRD 521

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/485 (57%), Positives = 357/485 (73%), Gaps = 4/485 (0%)

Query: 23  AAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLDQ 82
           A +L  +DLN +V KA+YAVRGAIP+ A++LK +L +   +LPF S+IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 83  KPLTFTRQVLSILEYPEILRVDHDK-LASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141
           KPL+F RQVLSILEYP +L  DH++ L     +A D+++RA+ LL DIG S+GAYS+SQG
Sbjct: 141 KPLSFGRQVLSILEYPALL--DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197

Query: 142 VPGIRQTVADFITERDGGEPAGPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLLPIPQYPL 201
           V GIRQTVADFIT RD GE A P+DI+                CK  QTG+L+PIPQYPL
Sbjct: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPL 257

Query: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261
           YTA+ +L +A  LPYYLDE   WST+ +EI +V  D+L+ GI+P+ LVVINPGNPTG+VL
Sbjct: 258 YTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317

Query: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321
           T   I  +  +AAKYG+ +I+DEVYQ+NIF   +FHSMKKILR LQ   P K+DN+QLAS
Sbjct: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381
           LHS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS   GQA++DLM  PP+ G
Sbjct: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437

Query: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441
           + SY+ D+ ER  I      R+N LYE FN LEG+ CQKPQGAMY+FP + LP  A++ +
Sbjct: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497

Query: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501
           + L+I PD  YC  LL++TGICTVPGSGFGQ+ GTYHVRTTFL PG +W++ W +FH +F
Sbjct: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557

Query: 502 FNKYR 506
           F KYR
Sbjct: 558 FEKYR 562

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/494 (55%), Positives = 363/494 (73%), Gaps = 8/494 (1%)

Query: 20  FKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQ 79
           F PA K +  D+N S+ KAEYA+RG IP RAEEL  +L  +S SLPF  I+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 80  LDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHS 139
           LDQ+PLTF RQV+S++++P++L+   D L +  +++KD+++RA +LL+ IGGSVGAYS S
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 140 QGVPGIRQTVADFITERD-GGEPA------GPEDIYXXXXXXXXXXXXXXXXCKDSQTGL 192
           QGV  IR+ VA FI +RD   +P          +++                 KD   G+
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 193 LLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVIN 252
           LLPIPQYPLYTA+ +L  +++LPYYL+E  +WST+  +IE++V+DA+K+ I+P+ LVVIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 253 PGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPG 312
           PGNPTGA+LT+++I  I  IAA+YGI II+DEVYQEN++   +FHS KK+L +L+  +P 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIID 372
           K+DNVQLASLHSISKG  GECGQRGGYMEI GFS D++  L K+ SISICSV TGQ ++D
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 373 LMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLF 432
           LMV PPQPGDESY+ D+ ER  I++ ++ ++N LY+ F  L GI CQKPQGAMYLFP+L 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 433 LPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQ 492
           L E A+  +  LN++PD  YC  LLE+TGICTVPGSGFGQ  GTYH+RTTFLPPG +WI 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 493 DWRQFHQDFFNKYR 506
            W +FH +F  KY+
Sbjct: 487 SWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/497 (54%), Positives = 354/497 (71%), Gaps = 10/497 (2%)

Query: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78
           D  PA K +  D++ S+   EYA+RG IPTRA+EL+E+L  S N LPF  II ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138
           QL+Q+PLTF RQVLS++EYP ++    + L    ++A DA+KRA+ +L+ IGGSVGAYS 
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 139 SQGVPGIRQTVADFITERDGGEPAGPE---------DIYXXXXXXXXXXXXXXXXCKDSQ 189
           SQG+  IR+ VA  I +RD  E    +         +I+                 KD  
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 190 TGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLV 249
            G+LLPIPQYPLYTA+ +L N+++LPYYL+E+ +WST+ +EIE ++ DA+ + I+P+ LV
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 250 VINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNL 309
           +INPGNPTGA+L+  +I +I  IAAKYGI II+DEVYQ NI+ D KFHS KKIL  L+  
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 310 HPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQA 369
           +P K+DNVQLASLHSISKG  GECGQRGGY E++GFS +I+  + KL SI ICSV TGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 370 IIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFP 429
           ++DLM KPP+ GD SY  D++ER  I + ++ ++N LY+ F+ L GI CQKPQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 430 KLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQ 489
           +L L    + E++  N+EPD  YC  LLE+TGICTVPGSGFGQK GTYHVRTTFLP G +
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 490 WIQDWRQFHQDFFNKYR 506
           WI+ W +FH +F N+Y+
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 103/258 (39%), Gaps = 44/258 (17%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITII 281
           +W  + D +E+   +  K        V+IN P NP G V TE  + K+  +  ++   +I
Sbjct: 172 EWQIDWDALEKTFNNKTKA-------VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVI 224

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY E+++    F  +  I   + NL              +++ G  G+     G+  
Sbjct: 225 SDEVY-EHLYFTESFPRIANINEDIANL--------------TLTVGSAGKSFAATGWR- 268

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI------ 395
            +G+     D L   +S         +A   +    P P  E+     +  LKI      
Sbjct: 269 -IGWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALKIDYFPKM 318

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
             E   +  +L   F++L G+   +P+G  ++   F K+ +PE  +   E L    D   
Sbjct: 319 REEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRI 377

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   GI  +P + F
Sbjct: 378 SYWLINEIGIVAIPPTEF 395

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 104/258 (40%), Gaps = 44/258 (17%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITII 281
           +W+ + ++ E+ +    K        V+IN P NP G V T + +  +  I  K+ + II
Sbjct: 183 EWTIDFEQFEKAITSKTKA-------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVII 235

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY+   F D           ++  L P      ++  L +++ G  G+     G+  
Sbjct: 236 SDEVYEHLYFTDS--------FTRVATLSP------EIGQL-TLTVGSAGKSFAATGWR- 279

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI------ 395
            +G+   +   L              +A   +    P P  E+      + LKI      
Sbjct: 280 -IGWVLSLNAELLSY---------AAKAHTRICFASPSPLQEACANSINDALKIGYFENM 329

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
             E +T+  +L   F+EL G+    P+G+ ++   F K+ +PE      E ++   D   
Sbjct: 330 RQEYITKFKILTSVFDEL-GLPYTAPEGSYFVLVNFSKVKIPEDYPYPQEIMDKGKDFRI 388

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 389 SHWLINELGVVAIPPTEF 406

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 100/258 (38%), Gaps = 44/258 (17%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITII 281
           +W+ + ++    + D  K        V+IN P NP G V T   + +I  I  K  + II
Sbjct: 182 EWTVDYEQFANAITDKTKA-------VIINTPHNPIGKVFTREELTRIGEICVKKNVVII 234

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY+   F D           ++  L P      ++  L ++S G  G+     G+  
Sbjct: 235 SDEVYEHLYFTDS--------FTRIATLSP------EIGQL-TLSVGSAGKSFAATGWR- 278

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI------ 395
            VG+   +   L   +S         +A   +    P P  E+      + L+I      
Sbjct: 279 -VGWVVSLNPELLSYVS---------KAHTRICFASPSPLQEAVANSINDALEINYFENM 328

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
             E   + ++    F EL G+   +P+G  ++   F K+ +PE      E  N   D   
Sbjct: 329 RQEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRI 387

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 388 AYWLINELGVVAIPPTEF 405

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 100/258 (38%), Gaps = 44/258 (17%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITII 281
           +W+ + ++ E+ +    K        V+IN P NP G V T   +  +  I  K+ + II
Sbjct: 183 EWTIDFEQFEKAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVII 235

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY+   F D           ++  L P      ++  L +++ G  G+     G+  
Sbjct: 236 SDEVYEHLYFTDS--------FTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR- 279

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI------ 395
            +G+   +   L              +A   +    P P  E+      + LKI      
Sbjct: 280 -IGWVLSLNAELLSY---------AAKAHTRICFASPSPLQEACANSINDALKIGYFEKM 329

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
             E + +  +    F+EL G+    P+G  ++   F K+ +PE      E LN   D   
Sbjct: 330 RQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRI 388

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 389 SHWLINELGVVAIPPTEF 406

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 102/258 (39%), Gaps = 42/258 (16%)

Query: 222 ADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITII 281
            +W+ + ++ E V+ +  K       +++  P NP G V T   + +I  I  K+ + II
Sbjct: 181 TEWTLDFEQFENVITNKTK------AIIINTPHNPIGKVFTREELKRIGDICVKHNVIII 234

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY    F D           ++  L P      ++  L ++S G  G+     G+  
Sbjct: 235 SDEVYDNLYFVDE--------FTRIATLSP------EIGQL-TLSVGSAGKTFAATGWR- 278

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLK------I 395
            +G+   +   L    S         +A   +    P P  E+  +     L+      +
Sbjct: 279 -IGWVVSLNPELLNFAS---------KAHTRICFASPSPIQEACAESINIALRNGYFENM 328

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
            NE + +  +    F+EL G+   + +G  +L   F ++ +PE      E +N   D   
Sbjct: 329 RNEYVKKYKIFTSVFDEL-GLPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINKGKDFRI 387

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 388 SNWLINELGVVAIPPTEF 405

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 106/257 (41%), Gaps = 42/257 (16%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIIS 282
           +W+ + DE+   +    K       L++  P NP G V T   + +I  I  +  + IIS
Sbjct: 186 EWTVDYDELRAAITPKTK------ALILNTPHNPIGKVFTREELLEIGNICVENNVVIIS 239

Query: 283 DEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEI 342
           DEVY E+++   +F  +  +  ++ NL           S+ S  K F    G R G++  
Sbjct: 240 DEVY-EHLYFTSEFTRIATLSPEIGNL---------TLSVGSAGKTFAA-TGWRIGWI-- 286

Query: 343 VGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERL------KIY 396
              SQ+    L K  S++   +             P P  E+  +  +  L      K+ 
Sbjct: 287 --VSQNAE--LLKYASMAHTRICFAS---------PSPFQEACAKSIEIALQNNYFEKMR 333

Query: 397 NEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYC 453
            E + + ++    F+EL G+   +P+G  ++   F K+ +PE      E L+   D    
Sbjct: 334 QEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKAKDFRIS 392

Query: 454 TSLLESTGICTVPGSGF 470
             L+   G+  +P + F
Sbjct: 393 YWLINELGVVAIPPTEF 409

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 104/263 (39%), Gaps = 44/263 (16%)

Query: 218 LDEEADWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKY 276
           + E  +W+ + ++ +  +    K        V+IN P NP G V T   + +I  I  + 
Sbjct: 179 VTEGTEWTVDMEQFKNAITSKTKA-------VIINTPHNPIGKVFTREELLQIGNICVEK 231

Query: 277 GITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQR 336
            + IISDEVY+   F D           ++  L P      ++  L +++ G  G+    
Sbjct: 232 NVIIISDEVYEHLYFTDE--------FTRIATLSP------EIGQL-TLTVGSAGKTFAA 276

Query: 337 GGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERL--- 393
            G+   +G+   +   L + +S         +A   +    P P  E+      + L   
Sbjct: 277 TGWR--IGWVISLNSELLQYVS---------KAHTRICFASPSPLQEACANSINDALESN 325

Query: 394 ---KIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIE 447
              K+  E + +  +    F EL G+   KP+G  ++   F K+ +PE      E LN  
Sbjct: 326 YFEKMRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKG 384

Query: 448 PDVLYCTSLLESTGICTVPGSGF 470
            D      L+   G+  +P + F
Sbjct: 385 KDFRISHWLINELGVVAIPPTEF 407

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 100/258 (38%), Gaps = 44/258 (17%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITII 281
           +W+ + ++ E  +    K        V+IN P NP G V T   +  +  I  K+ + II
Sbjct: 199 EWTIDFEQFENAITSKTKA-------VIINTPHNPIGKVFTREELTTLGNICVKHNVVII 251

Query: 282 SDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYME 341
           SDEVY+   F D           ++  L P      ++  L +++ G  G+     G+  
Sbjct: 252 SDEVYEHLFFTDS--------FTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR- 295

Query: 342 IVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI------ 395
            +G+   +   L              +A   +    P P  E+      + LKI      
Sbjct: 296 -IGWVLSLNAELLSY---------AAKAHTRICFASPSPLQEACANSINDALKIDYFEKM 345

Query: 396 YNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLY 452
             E +T+  +    F++L G+    P+G  ++   F K+ +PE      E L+   D   
Sbjct: 346 RQEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEILDKGKDFRI 404

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 405 SHWLINELGVVAIPPTEF 422

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 104/254 (40%), Gaps = 30/254 (11%)

Query: 220 EEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGIT 279
           E  +W+ + DE+   +    K       L++  P NP G V T   + +I  I  +  + 
Sbjct: 179 EGTEWTVDYDELRAAITPKTK------ALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 280 IISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY E+++   +F        ++  L P +   + L ++ S  K F    G R G+
Sbjct: 233 IISDEVY-EHLYFTPEF-------TRVATLSP-EIGQITL-TIGSAGKSFAA-TGWRIGW 281

Query: 340 MEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEM 399
             IV  + ++ +    +    IC  +            P   D  Y +  +E      E 
Sbjct: 282 --IVSLNPELLEYA-SMAHTRICFASPSPLQEACANALPIALDNGYFKKMRE------EY 332

Query: 400 LTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYCTSL 456
           + + N+    F+EL G+   KP+G  ++   F K+ +PE      E  +   D      L
Sbjct: 333 IHKFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYWL 391

Query: 457 LESTGICTVPGSGF 470
           +   G+  +P + F
Sbjct: 392 INELGVVAIPPTEF 405

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 104/259 (40%), Gaps = 44/259 (16%)

Query: 222 ADWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITI 280
            +W+ + DE  R +    K        V+IN P NP G V T   + K+  I  +  + I
Sbjct: 182 TEWTVDFDEFTRAITPKTKA-------VIINTPHNPIGKVFTREELTKLGNICVENNVII 234

Query: 281 ISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           I+DEVY+   F D +F  +  +  ++  L           S+ S  K F    G R G+ 
Sbjct: 235 IADEVYEHLYFVD-EFPRIATLSEEIGQL---------TLSVGSAGKSFAA-TGWRIGW- 282

Query: 341 EIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDE--SYDQDRKERLKIYNE 398
            +V  + D+     K  +  IC  +            P P  E  SY  D   ++  +  
Sbjct: 283 -VVSQNPDLLQYASKAHT-RICFAS------------PSPIQEACSYSIDHALKIDYFEN 328

Query: 399 M----LTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVL 451
           M    + +  +    F+EL G+    P+G+ ++   F K+ +P+      E ++   D  
Sbjct: 329 MRQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFR 387

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   G+  +P + F
Sbjct: 388 ISNWLINELGVVAIPPTEF 406

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/257 (20%), Positives = 101/257 (39%), Gaps = 42/257 (16%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIIS 282
           +W+   DE+E  +    K       L++  P NP G V T   + +I  I  K+ + IIS
Sbjct: 182 EWTVNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVKHNVVIIS 235

Query: 283 DEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEI 342
           DEVY E+++   +F  +  +  ++  +              +++ G  G+     G+   
Sbjct: 236 DEVY-EHLYFTPEFTRIATLSPEIGQI--------------TLTVGSAGKSFAATGWR-- 278

Query: 343 VGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERL------KIY 396
           +G+   +   L K  S++   +             P P  E+        L      K+ 
Sbjct: 279 IGWVVSLNPELLKYASMAHTRICFSS---------PSPLQEACANSLNTALDNGYFEKMR 329

Query: 397 NEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYC 453
            E + +  +    F+EL G+   +P+G  ++   F K+ +P+      E  +   D    
Sbjct: 330 QEYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELRSKGKDFRIS 388

Query: 454 TSLLESTGICTVPGSGF 470
             L+   G+  +P + F
Sbjct: 389 YWLVNELGVVAIPPTEF 405

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 110/287 (38%), Gaps = 40/287 (13%)

Query: 197 PQYPLYTASASLYNAQVL--PYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVI--N 252
           P +  Y ++  L   +V+  P    +E D      E   +  +  +K I P    VI   
Sbjct: 147 PFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFEKAITPKTKAVIINT 206

Query: 253 PGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPG 312
           P NP G V T   +  +  I  K+ + IISDEVY+   F D  F  +  I  ++  L   
Sbjct: 207 PHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTD-SFTRIATISPEIGQL--- 262

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIID 372
                   ++ S  K F    G R G+  +V  + D+   + K  +  IC          
Sbjct: 263 ------TLTVGSAGKLFAA-TGWRIGW--VVSLNADLLSYVSKAHT-RIC---------- 302

Query: 373 LMVKPPQPGDESYDQDRKERLKI------YNEMLTRANLLYETFNELEGIKCQKPQGAMY 426
                P P  E+      + LKI        E +T+  +    F+EL G+    P+G  +
Sbjct: 303 --FSSPSPLQEACANSIDDGLKIGYFEKMRQEYITKFKIFTSIFDEL-GLPYTAPEGTYF 359

Query: 427 L---FPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGF 470
           +   F K+ +P+      E  +   D      L+   G+  +P + F
Sbjct: 360 VLVNFSKVKIPKDYSYPEEIRDKGKDFRISHWLINELGVVAIPPTEF 406

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 103/257 (40%), Gaps = 42/257 (16%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIIS 282
           +W  + D ++   +++  K I     ++  P NP G V TE  + ++  I  K  + IIS
Sbjct: 174 EWQIDWDSLQ-AAMNSKTKAI-----IINTPHNPIGKVFTEPELRRLGDICVKNNVVIIS 227

Query: 283 DEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEI 342
           DEVY+   F D           ++  L P      ++  L +++ G  G+     G+   
Sbjct: 228 DEVYEHLYFKDS--------FTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR-- 270

Query: 343 VGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQ--DRKERLKIYNEML 400
           +G++  +   L              +A   +    P P  E+     +  E+++ + E  
Sbjct: 271 IGWALSLNQELLSY---------AAKAHTRICFASPSPLQEAVANAFNDAEKVEYFKETR 321

Query: 401 TRANLLYETF----NELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYC 453
            +    YE F    NEL G+   +P+G  ++   F K+ +P       E LN   D    
Sbjct: 322 LQYIRKYEIFTNVLNEL-GLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRIS 380

Query: 454 TSLLESTGICTVPGSGF 470
             L+   G+  +P + F
Sbjct: 381 YWLMNELGVVAIPPTEF 397

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 104/255 (40%), Gaps = 50/255 (19%)

Query: 233 RVVLDALKKGI--RPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENI 290
           ++  D L K I  R   +++  P NP G V T   + ++  I  K  I IISDEVY+   
Sbjct: 185 KIDFDILNKTINERTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYEHLY 244

Query: 291 FGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIR 350
           FGD +F  +  I +++ +L           S+ S  K F    G R G++         R
Sbjct: 245 FGD-EFTRIATISKEIGDL---------TLSVGSAGKSFAA-TGWRIGWVV-------SR 286

Query: 351 DALFKLMSISICSVATGQAIIDLMVKPPQPGDES------------YDQDRKERLKIYNE 398
           +A  +L+S         +A   +    P P  E+            Y ++ +E  K    
Sbjct: 287 NA--ELLSY------VSKAHTRICFSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFA 338

Query: 399 MLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYCTS 455
           +LTR       F+EL G+   KP G  ++   F K+ +P++     E      D      
Sbjct: 339 ILTRV------FDEL-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYW 391

Query: 456 LLESTGICTVPGSGF 470
           L+   G+  +P + F
Sbjct: 392 LVNELGVVAIPPTEF 406

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 102/222 (45%), Gaps = 32/222 (14%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQ--VLPYYLDEEADWSTESDEIERVVLDALKKG 242
           C  ++  +L+    Y +YT  + + + +   +P  L EE  +  + ++I    L+ L+  
Sbjct: 108 CVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKI----LETLQND 163

Query: 243 IRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKI 302
               ++ + +PGNPTG  +  N I KI L   + G+ ++ DE Y + + G  K  S+  +
Sbjct: 164 PSIKLVFITSPGNPTGTFIDVNRIEKI-LSQWQTGLVVV-DEAYIDFVEGSDK-GSLAPL 220

Query: 303 LRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362
             K +N          +A L ++SK F G  G R G          + +++    +IS C
Sbjct: 221 ATKYEN----------IAVLQTLSKSF-GLAGIRLGVTYTSKAMSRVLNSMKAPYNIS-C 268

Query: 363 SVATGQAIIDLMVKPPQPGD-----ESYDQDRKERLKIYNEM 399
           S A      ++ +K  QP +     E+    +KE+L++  E+
Sbjct: 269 STA------EVALKAVQPKNLKLMEENAATVKKEKLRVLKEL 304

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 103/262 (39%), Gaps = 42/262 (16%)

Query: 218 LDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYG 277
           + E  +W+ + ++    +    K       ++V +P NP G V T+  + K+  I  +  
Sbjct: 182 ITEGTEWTIDFEQFRNAITPKTK------AVIVNSPHNPIGKVFTKEELTKLGEICVENN 235

Query: 278 ITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY+   F D           ++  L P      ++  L +++ G  G+     
Sbjct: 236 VIIISDEVYEFLYFNDS--------FTRIATLSP------EIGQL-TLTVGSAGKTFAAT 280

Query: 338 GYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERL---- 393
           G+   +G+       L + +S         +A   +    P P  E+      + L    
Sbjct: 281 GWR--IGWVISQNPELLQYVS---------KAHTRICFASPSPLQEACANSINDALESGY 329

Query: 394 --KIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEP 448
             K+  E + +  +    F EL G+   KP+G  ++   F K+ +PE      E L+   
Sbjct: 330 FEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEILDKGK 388

Query: 449 DVLYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 389 DFRISHWLINELGVVAIPPTEF 410

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 103/263 (39%), Gaps = 44/263 (16%)

Query: 218 LDEEADWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKY 276
           + E  +W  + D + + + +  K        V+IN P NP G V T   + K+  I  + 
Sbjct: 192 VTEGTEWVIDYDMLRQTINEKTKA-------VIINSPHNPIGKVFTREELLKLGNICVEK 244

Query: 277 GITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQR 336
           GI IISDEVY+   F D +F  +  +  ++              S H+++ G  G+    
Sbjct: 245 GIYIISDEVYEHLYFTD-EFTRIATLSEEI--------------SQHTLTVGSAGKSFAA 289

Query: 337 GGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIY 396
            G+   +G+       L  L S         +A + +    P P  E+     +  LK  
Sbjct: 290 TGWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTT 338

Query: 397 NEMLTRANL------LYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIE 447
               TRA          + F++L G+   + +G+ +L   F +L LP       E  +  
Sbjct: 339 YYADTRAAYQKKYERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKG 397

Query: 448 PDVLYCTSLLESTGICTVPGSGF 470
            D      L+   G+  +P S F
Sbjct: 398 RDFRVAYWLINELGLVAIPCSSF 420

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 100/223 (44%), Gaps = 25/223 (11%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPY-YLDEEADWSTESDEIERVVLDALKKGI 243
           C   +  +L+  P Y +Y+  A + + +++    + E+  +   +D+    V++ L+   
Sbjct: 108 CVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNSFQMNTDK----VIETLQGDS 163

Query: 244 RPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKIL 303
              +  V +PGNPTGA++   +I KI L   + GI  I DE Y       + F S     
Sbjct: 164 NIKIAFVTSPGNPTGALIDIASIEKI-LSQWQSGIVAI-DEAY-------IDFCSTGGSA 214

Query: 304 RKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS-ISIC 362
             L N +P       LA L ++SK F    G  G  + +   S+D+   L  + +  +I 
Sbjct: 215 APLVNKYP------NLAVLQTLSKSF----GLAGVRLGVTFTSKDLSRVLNAMKAPYNIS 264

Query: 363 SVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANL 405
           S+A+   +  L  +  Q   ++  +  +ER ++   + +  N+
Sbjct: 265 SMASNLVLKALSSESVQTMKDNVQEIVEERERVLKALTSMENV 307

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 16/107 (14%)

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPS--VLVVINPG 254
           P Y   ++   ++ A+V   +L +E ++     E+ER+        I+P+   +V+  P 
Sbjct: 113 PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNTPN 164

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKK 301
           NP  +V+   T+ +I  +A K+GI +  DEVY         FHS +K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 100/225 (44%), Gaps = 48/225 (21%)

Query: 222 ADWSTESDEIERVVLDALKKGIRPSVLVVIN-PGNPTGAVLTENTIAKICLIAAKYGITI 280
           ++W+ + D+    + +  K        V+IN P NPTG V T   +  +  I  +  + I
Sbjct: 166 SEWTLDFDQFRSAISEKTKA-------VIINSPHNPTGKVFTREELLTLGNICVEKNVYI 218

Query: 281 ISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY EN++             KL +L P +  N+ L ++ S  K F    G R G++
Sbjct: 219 ISDEVY-ENLY-------FTPECVKLASLSP-EISNITL-TIGSAGKIF-AVTGWRIGWI 267

Query: 341 EIVGFSQDIRDALFKLMS---ISICSVATGQAIIDLMVKPPQPG-----DESYDQDRKER 392
                S+++   L KL S   I IC  +           PPQ       D + + D  +R
Sbjct: 268 ----ISENVE--LLKLASSAHIKICFSSPS---------PPQLACAHAIDIALNSDYFDR 312

Query: 393 LKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLP 434
           ++   + + +  +L   F EL G+    P+G+ ++   F KL +P
Sbjct: 313 MR--KDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 72/155 (46%), Gaps = 23/155 (14%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPY-YLDEEADWSTESDEIERVVLDALKKGI 243
           C  ++  +L+  P Y +Y+  A + + +V+    + E+  +  +SD+    VLD L    
Sbjct: 108 CVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDK----VLDILNNDQ 163

Query: 244 RPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKIL 303
              +L + +PGNPTGA +    I K+ L     G+ ++ DE Y +   G     S   ++
Sbjct: 164 EIKLLFITSPGNPTGAQIETARIEKV-LQNWDRGLVVV-DEAYVDFCGG-----STAPLV 216

Query: 304 RKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
            K QN          L +L ++SK F G  G R G
Sbjct: 217 TKYQN----------LVTLQTLSKSF-GLAGIRLG 240

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 102/260 (39%), Gaps = 42/260 (16%)

Query: 220 EEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGIT 279
           E  DW+ + +E+ +      K       L++  P NP G V T+  + KI  +  +  + 
Sbjct: 187 EGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 280 IISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY+   F D           ++  L P      ++  L +++ G  G+     G+
Sbjct: 241 IISDEVYEFLYFTDS--------YTRIATLSP------EIGQL-TLTVGSAGKTFAATGW 285

Query: 340 MEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPGDESYDQDRKERLK----- 394
              +G+   +   L       +  V+ G   I      P P  E+     ++ LK     
Sbjct: 286 R--IGWVISLNPEL-------LSYVSKGHTRI--CFSSPSPIQEAVANSIEDALKGDYFE 334

Query: 395 -IYNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDV 450
            +  + + +  +    F E+ G+    P+G  ++   F K+ +PE      E L+   D 
Sbjct: 335 AMRTDYIRKFEIFTSVFKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKDF 393

Query: 451 LYCTSLLESTGICTVPGSGF 470
                L+   G+  +P + F
Sbjct: 394 RISYWLINELGVVAIPPTEF 413

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 101/254 (39%), Gaps = 36/254 (14%)

Query: 223 DWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIIS 282
           +W  + D +E+ +        R   +++  P NP G V T   + ++  I     I IIS
Sbjct: 172 EWEIDWDILEKTI------NSRTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIIS 225

Query: 283 DEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEI 342
           DEVY+   F D +F  +  +  ++  L           ++ S  K F    G R G+   
Sbjct: 226 DEVYEHLYFSD-EFPRIATLSPEIGQL---------TFAVGSAGKTFAA-TGWRIGWT-- 272

Query: 343 VGFSQDIRDALFKLMS-ISICSVATGQAIIDLMVKPPQPGD--ESYDQDRKERLKIYNEM 399
           V  ++++ + + K  + I   S +  Q  I   +   Q  D  E+  Q+  ++ KI+  +
Sbjct: 273 VSLNKELLNYVAKAHTRICFSSPSPFQEAIAHALPEAQKIDYFETMRQEYIQKFKIFTAV 332

Query: 400 LTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEPDVLYCTSL 456
               N+ Y              +G+ ++   F K+ +PE  +   E      D      L
Sbjct: 333 FDELNMPYTV-----------AEGSYFICVNFSKVKIPEDYVFPQELQEKAKDFRISYWL 381

Query: 457 LESTGICTVPGSGF 470
           +   G+  +P + F
Sbjct: 382 MNELGVVAIPPTEF 395

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 119/280 (42%), Gaps = 48/280 (17%)

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           P Y    +   ++ A+V    L +E D+      ++ ++ +  K      ++++ NP NP
Sbjct: 110 PTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPNNP 163

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316
            G+V+ ++ + +IC +  +  I + SDEVY+        FHS++      + + P   + 
Sbjct: 164 LGSVIKKDLLKQICKLCEENDIYLHSDEVYRP------IFHSLED-----EMVPPSACEL 212

Query: 317 VQLASLH-SISKGFMGECGQRGGYMEIVGFSQDIRDAL----FKLMSISICSVATGQAII 371
              A +  S+SK +    G R G++ +    Q +RDA     + ++S+S+      Q ++
Sbjct: 213 YSKAIVSGSMSKAY-SVAGIRLGWL-VSKDKQFLRDAASRRDYNMISVSMIDDQIAQYVL 270

Query: 372 DLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKL 431
           D         +  Y   R   L + N  L   + + E  ++ E     KP  A     K+
Sbjct: 271 D---------NREYVIKRNYELCLNNFRLLN-DFMDEHSDKFEFY--HKPTAATVCLAKV 318

Query: 432 FLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFG 471
               K + ++ +        + T L E  G+  VPG  FG
Sbjct: 319 ----KGVNDTMK--------FATFLAEKYGVLAVPGEAFG 346

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 202 YTASASLYNAQ-----VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-N 255
           Y+ S+SLY A+     V P  LDE   +    +++E ++ +   +  +P +L  I  G N
Sbjct: 165 YSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           PTG+ L+++  AKI  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 69/139 (49%), Gaps = 17/139 (12%)

Query: 236 LDALKKGIRPSVLVVI--NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGD 293
           LD LKK I+ +  ++I  NP NP G V+++  +  IC +  +  + +  DEVY+      
Sbjct: 142 LDTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYRP----- 196

Query: 294 VKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDAL 353
             FHS+   +   ++     +DN  ++   S+SK F    G R G++ +   ++ +RDA 
Sbjct: 197 -IFHSLPSGVTTPRS-AAQIYDNAVVSG--SMSKAF-SLAGIRLGWI-VSKNAKLLRDAA 250

Query: 354 ----FKLMSISICSVATGQ 368
               +  +S+S+   A  Q
Sbjct: 251 SRRDYNTISVSMVDDAVAQ 269

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 100/219 (45%), Gaps = 22/219 (10%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           C+     +L   P Y +Y+  A++ + +++   L  E D S + +  E  VL  LK   +
Sbjct: 105 CRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITE-DNSFQMNVPE--VLSTLKNDPK 161

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304
             +L + +PGNPTG ++ +  I  I L     G+ ++ DE Y +    +   +SM K++ 
Sbjct: 162 IKLLFITSPGNPTGKLVNKKDIEFI-LENWTNGLVVV-DEAYIDFADAEGTTYSMAKLVT 219

Query: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSI--SIC 362
           K  N          L  L ++SK F G  G R G    V F+ +   ++   M    +I 
Sbjct: 220 KYPN----------LTVLQTLSKSF-GLAGIRLG----VTFASEEFSSVLNAMKAPYNIS 264

Query: 363 SVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLT 401
           S+ +  AI  +  +      E+     +E+ ++ NE+++
Sbjct: 265 SLTSKYAIEAVQEENLNYMIENARNVNQEKHRLLNELIS 303

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 115/278 (41%), Gaps = 49/278 (17%)

Query: 220 EEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGIT 279
           E  DW  + + +     D  K      ++++ NP NP G V   + + ++  +    G  
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 280 IISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGE----CGQ 335
           II+DEVY+   F           L ++ NL        +  +  +I+ G  G+     G 
Sbjct: 217 IIADEVYEFLQF-------TPNPLSRISNLS-------EAIAQKTITIGSAGKIFRVTGW 262

Query: 336 RGGYMEIVGFSQDIRDALFKLMSISI----CSVATGQAIIDLMVKPPQPGDESYDQDRKE 391
           R G+M     S++ R+ + K+ ++ +    CS +  Q    L ++  +  +  Y      
Sbjct: 263 RVGWM----ISKN-RELVEKVTAVHVRMGFCSPSISQVASGLGIQ--RALECGY------ 309

Query: 392 RLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYL---FPKLFLPEKALRESERLNIEP 448
            L + NE   + +++Y+  + L G+   KPQGA ++   F K+ +PE         N   
Sbjct: 310 FLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRAR 368

Query: 449 DVLYCTSLLESTGICTVPGSGF----GQKSGTYHVRTT 482
           D      L +   I  +P S F     +K+   ++R T
Sbjct: 369 DFFISYWLTQEFCILLLPCSEFYCEEHRKNSETYLRIT 406

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 6/91 (6%)

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           P Y   ++   ++ A+V    L+ E D+  +  +++ ++     KG     +V+ NP NP
Sbjct: 113 PTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI-----KG-NTKCIVLNNPNNP 166

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQ 287
            G+V+   T+ +I  +A K  I +I DEVY+
Sbjct: 167 LGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 21/142 (14%)

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256
           P Y +Y+  AS+ + +++   L   +D S + D     VLD LKK     ++ + +PGNP
Sbjct: 117 PTYGMYSVCASVNDVEIVKCPL-VTSDNSFQVDT--EAVLDTLKKDPLIKLVFITSPGNP 173

Query: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316
           TGA +  + I KI L     GI ++ DE Y +   G             L N +P     
Sbjct: 174 TGAKIETSRIEKI-LQNWDQGILVV-DEAYIDFCGGSTA---------PLVNKYP----- 217

Query: 317 VQLASLHSISKGFMGECGQRGG 338
             + +L ++SK F G  G R G
Sbjct: 218 -NICTLQTLSKSF-GLAGIRVG 237

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 102/219 (46%), Gaps = 28/219 (12%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           CK +   +++  P Y +Y+  A++ +  V+   L  E D S + D ++R  L+ LKK   
Sbjct: 105 CKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVE-DNSFQMD-VKRT-LETLKKDDL 161

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQE--NIFGD----VKFHS 298
             +L + +PGNPTG ++    I  + L   K G+ ++ DE Y +    F +     ++ S
Sbjct: 162 IRLLFITSPGNPTGKIIAIKDIIYV-LEHWKNGLVVV-DEAYVDFSTYFNEETKKTEYFS 219

Query: 299 MKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS 358
           + K++ K  N          L  L ++SK F G  G R G    V F+ +    +   M 
Sbjct: 220 VAKLVTKYPN----------LTVLQTLSKSF-GLAGIRLG----VTFASEELARILNAMK 264

Query: 359 I--SICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKI 395
              +I S  +  AI  +  +  +  +++ ++  KE+ ++
Sbjct: 265 APYNISSTTSNHAIKAVQPESLRLMEDNANEVNKEKYRV 303

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 26/154 (16%)

Query: 189 QTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDE---IERVVLDALKKGIRP 245
           Q  +LLP P Y +Y   A + +   +   L   +D S + DE   +E++ LD   K I+ 
Sbjct: 113 QKVMLLP-PTYGMYKVCADINDVGYVEVPLIS-SDNSFQIDEDRILEQLNLD---KSIK- 166

Query: 246 SVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRK 305
            V+ + +PGNPTGA +    + K+ L     GI ++ DE Y       + F + K  L  
Sbjct: 167 -VVFITSPGNPTGACIEVGRVEKL-LRNWTAGIVVV-DEAY-------IDFSADKPSLSP 216

Query: 306 LQNLHPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           L N HP       L  L ++SK   G  G R G+
Sbjct: 217 LVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 236 LDALKKGIRPSVLVVI--NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGD 293
           ++ LKK I+ +  ++I  NP NP G+ ++  T+  IC +  +  I +  DEVY+      
Sbjct: 141 IETLKKMIKSNTKLIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYKP----- 195

Query: 294 VKFHSM 299
             FHSM
Sbjct: 196 -IFHSM 200

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 23/155 (14%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPY-YLDEEADWSTESDEIERVVLDALKKGI 243
           C  ++  +L+  P Y +Y+  A++ + +V+    + E+  +   SD+    VLD LK   
Sbjct: 108 CVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNSFQLNSDK----VLDILKNDP 163

Query: 244 RPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKIL 303
              ++ + +PGNPTG  +    I K+ L     G+ ++ DE Y +   G     S+  ++
Sbjct: 164 LIKLVFITSPGNPTGVKIETKRIEKV-LQNWDNGLVVV-DEAYIDFCGG-----SLAPLV 216

Query: 304 RKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
            + QN          L  L ++SK F G  G R G
Sbjct: 217 TQYQN----------LIVLQTLSKSF-GLAGIRLG 240

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 237 DALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           D  KK  R  + +V    NPTGA+ + ++  K+  +A KY I IISD+VY
Sbjct: 180 DGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 202 YTASASLYNAQ-----VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-N 255
           YT S+S+Y A+     V P  LD +       + +E ++ +      +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGINVFPVPLDADG---LIPERLEAILDNWNPDTAKPKLLYTIPTGQN 221

Query: 256 PTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           PTG+ L+++   +I  IA K+ + II DE Y
Sbjct: 222 PTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 68/147 (46%), Gaps = 22/147 (14%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVI 251
           L LP P Y +Y+  A++ + +VL   L  E D S + D   + V+  L       ++ + 
Sbjct: 115 LTLP-PTYSMYSVCANINDVEVLECPLIYE-DNSFQPDS--QKVISILSSDPLIKLVFLT 170

Query: 252 NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP 311
           +PGNPTGA +  N I KI  + +  G  ++ DE Y +   G     S   ++ K  N   
Sbjct: 171 SPGNPTGAKIDSNIIIKI--LESWDGGFVVVDEAYIDFCGG-----STAPLVTKYPN--- 220

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGG 338
                  L +L ++SK F G  G R G
Sbjct: 221 -------LITLQTLSKSF-GLAGIRLG 239

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 240 KKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           KK  R  + +V    NPTGA+ + ++  K+  +A KY I IISD+VY
Sbjct: 184 KKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 240 KKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSM 299
           KK  R  + +V    NP+G   + +T  K+  +A KY I +ISD+VY   ++ D    ++
Sbjct: 184 KKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVY-DQPCDAL 242

Query: 300 KKILRKLQNLHPGKFDNVQLASLHSISKGFMGEC---GQRGGYMEIVGFS 346
            K L +L +L    ++  +    ++IS     +    G R GY E V  +
Sbjct: 243 PKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 10/92 (10%)

Query: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSV--LVVINPG 254
           P Y   ++  S++ A V   +L+ E  ++          +  LK  +R +   +V+ NP 
Sbjct: 113 PTYQQLSSVPSMFGADVELLHLEAEDGYTPN--------IQKLKSKVRANTKYIVLNNPN 164

Query: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           NP G+V++   + +I   A +  I I+ DEVY
Sbjct: 165 NPLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 69/147 (46%), Gaps = 22/147 (14%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVI 251
           L+LP P Y +Y+  A++ + +V+   L   +D S + D     VL  LK      ++ V 
Sbjct: 116 LVLP-PTYSMYSVCANINDIEVVQCPL-TVSDGSFQMDT--EAVLTILKNDSLIKLMFVT 171

Query: 252 NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP 311
           +PGNPTGA +  + I K+ L     G+ ++ DE Y +   G     S   ++ K  N   
Sbjct: 172 SPGNPTGAKIKTSLIEKV-LQNWDNGLVVV-DEAYVDFCGG-----STAPLVTKYPN--- 221

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGG 338
                  L +L ++SK F G  G R G
Sbjct: 222 -------LVTLQTLSKSF-GLAGIRLG 240

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 9/91 (9%)

Query: 202 YTASASLYNAQ-----VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-N 255
           YT S+S+Y A+     V P  LD +       + +E ++ +   +  +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGVNVFPVPLDADG---LIPERLEAILDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           PTG+ L+++   +I  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 71/154 (46%), Gaps = 19/154 (12%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           C   +  +L+  P Y +Y+    + + + +   L  E D S + D  E+V+ + L+    
Sbjct: 108 CVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVE-DNSFQMD-TEKVI-ETLQNDPS 164

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304
             ++ + +PGNPTGA++    I K+ L   + G  ++ DE Y       + F +    + 
Sbjct: 165 IKLVFITSPGNPTGALIKPENIEKL-LSQWQSGFVVV-DEAY-------IDFCTTGGSVA 215

Query: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
            L N +P       LA L ++SK F G  G R G
Sbjct: 216 PLVNKYP------NLAVLQTLSKSF-GLAGIRLG 242

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 244 RPSVLVVINPG-NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           RPS+L  I+ G NPTG  ++    A+I  +A KY   I+ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 68/147 (46%), Gaps = 22/147 (14%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVI 251
           L+LP P Y +Y+  A++ + +V+   L   +D S + D      L  LK      ++ V 
Sbjct: 116 LVLP-PTYSMYSVCANINDVEVVQCPL-TVSDNSFQMDT--EAALTILKNDPLIKLIFVT 171

Query: 252 NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP 311
           +PGNPTGA +    I KI L   + G+ ++ DE Y +   G     S   ++ K  N   
Sbjct: 172 SPGNPTGAKIKTCLIEKI-LQNWENGLVVV-DEAYIDFCGG-----STAPLVTKYPN--- 221

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGG 338
                  L +L ++SK F G  G R G
Sbjct: 222 -------LVTLQTLSKSF-GLAGIRLG 240

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 229 DEIERVVLDALKKGIRPSVLVVINPG-NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           +++E+++ +  +   +P +L  I  G NPTG+ L+++   KI  +A K+   II DE Y
Sbjct: 191 EKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 26/163 (15%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPY-YLDEEADWSTESDEIERVVLDALKKGIRPSVLVV 250
           L+LP P Y +Y+  A + + +V+    + E+  +  + D     VL+ L       +L +
Sbjct: 116 LVLP-PTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDN----VLETLSNDDSIKLLFI 170

Query: 251 INPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLH 310
             PGNPTGA ++   I ++ L     GI ++ DE Y       + F S       L N +
Sbjct: 171 TTPGNPTGASISTQKI-EMLLNNWSAGIVVV-DEAY-------IDFSSSDSA-APLVNKY 220

Query: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDAL 353
           P       L  + ++SK F G  G R G   +   S+DI   L
Sbjct: 221 P------NLVVIQTLSKSF-GLAGVRLG---LTFASEDISKVL 253

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 202 YTASASLYNAQ---VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-NPT 257
           +++S S   AQ   V P  LDE         ++E ++ +  +   +P +L  +  G NPT
Sbjct: 166 FSSSISAAEAQGVNVFPIPLDEHG---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPT 222

Query: 258 GAVLTENTIAKICLIAAKYGITIISDEVY 286
           G+ L+ +   +I  IA K+   II DE Y
Sbjct: 223 GSSLSFDRKEEIYRIAQKHDFIIIEDEPY 251

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIERVVLDALKKGIRPSVLVVINPG-NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           +++E+++ +      RP +L  I  G NPTG  L ++   +I  IA K+   II DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 6/85 (7%)

Query: 204 ASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGI-RPSVLVVINPG-NPTGAVL 261
           ASA        P  +DE      + +EI    LD    G  +P +L  I  G NPTG  L
Sbjct: 169 ASAEAQGITTFPIPIDEHGIIPEKLEEI----LDNWTPGAPKPKLLYTIPTGQNPTGTSL 224

Query: 262 TENTIAKICLIAAKYGITIISDEVY 286
            +    +I  IA K+   II DE Y
Sbjct: 225 ADERKVEIYRIACKHDFLIIEDEPY 249

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 218 LDEEADWSTESDEIERV--VLD---ALKKGIRPSVLVVI-NPGNPTGAVLTENTIAKICL 271
           L E  D  TE ++ E++  + D   A+ K I   V+  I    NPTG   +  T  K+  
Sbjct: 159 LQEFEDKFTEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIE 218

Query: 272 IAAKYGITIISDEVY 286
           IA KY + II+D+VY
Sbjct: 219 IARKYDMLIIADDVY 233

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 21/154 (13%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           C  S+  +L+  P Y +Y+  A++ +  V+   L  E D S + D  E  +L+ L     
Sbjct: 107 CVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITE-DNSFQIDATE--ILNILANDPL 163

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304
             ++ + +PGNPTGA +  + I  + L     G+ I+ DE Y      D    S   ++ 
Sbjct: 164 IKLVFITSPGNPTGAKIEIDRIEYL-LKNWDQGLVIV-DEAYI-----DFSGGSTAPLVT 216

Query: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
           K  N          L +L ++SK F G  G R G
Sbjct: 217 KYPN----------LVTLQTLSKSF-GLAGIRLG 239

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 21/154 (13%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244
           C  S+  +++  P Y +Y+  A + +   +   L  E D S + D  +  VL+ L +   
Sbjct: 108 CVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAE-DNSFQMDTSK--VLETLAQDPT 164

Query: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304
             ++ + +PGNPT A++    I K+  +    G  ++ DE Y +   G            
Sbjct: 165 IKLIFITSPGNPTAALIDTAEIEKV--LNNWTGGLVVVDEAYIDFCGGSTT--------- 213

Query: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
            L N +P       LA + ++SK F G  G R G
Sbjct: 214 PLVNKYP------NLAVIQTMSKSF-GLAGVRLG 240

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 237 DALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           D  KK  R  + +V    NP+GA  ++    K+  +A +Y I IISD+VY
Sbjct: 182 DDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 41/155 (26%)

Query: 237 DALKKGIRPSVLVVI-NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY--------- 286
           D   +G  P +L  I N  NPTG  L E    ++  +A++Y   II D+ Y         
Sbjct: 197 DVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFG 256

Query: 287 --QENIFGDV------KFHSMKKILRKLQNLHPGKFDNV-QLASLHSISKGFMGEC---- 333
             + N+ GDV      K + + K+ R L      ++D+V ++  L S+SK F   C    
Sbjct: 257 APELNVPGDVNEMQWFKENFVNKLGRSLL-----EWDDVGRIIRLESVSKTFAPGCRLGW 311

Query: 334 --GQR------GGYMEI-----VGFSQDIRDALFK 355
             G R        Y E+      GF+Q + + +F+
Sbjct: 312 AIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQ 346

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 13/76 (17%)

Query: 213 VLPYYLDEE-ADWSTESDEIERVVLDALKKGIRPSVLVVINPG-NPTGAVLTENTIAKIC 270
           ++P  L+E  A+WS+   E+             P +L  I  G NPTG  L++N    I 
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPM-----------PKLLYTIPTGQNPTGCTLSDNRKPHIY 236

Query: 271 LIAAKYGITIISDEVY 286
            +A +Y I II D+ Y
Sbjct: 237 RLAQQYDIIIIEDDPY 252

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 66/155 (42%), Gaps = 38/155 (24%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPYYL---DEEADWSTESDEIERVVLDALKKGIRPSVL 248
           L+LP P Y +Y+  A++ + +V+   L   D     +TE+      VL  L       ++
Sbjct: 116 LVLP-PTYSMYSVCANINDVEVVQCPLTVSDNSFQMNTEA------VLTILNNDPLIKIM 168

Query: 249 VVINPGNPTGAVLTENTIAKICLIAA-----KYGITIISDEVYQENIFGDVKFHSMKKIL 303
              +PGNPTGA +      K CLI         GI ++ DE Y +   G     S   ++
Sbjct: 169 FATSPGNPTGAKI------KTCLIEEVLQKWDNGIVVV-DEAYVDFCGG-----STAPLV 216

Query: 304 RKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGG 338
            K  N          L +L ++SK F G  G R G
Sbjct: 217 TKYPN----------LVTLQTLSKSF-GLAGIRLG 240

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 11/105 (10%)

Query: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYL-DEEADWSTESDEIERVVLDALKKGI 243
           C  ++  +L+  P Y +Y+  A + + +++   L   +  +   +DE+ +   +      
Sbjct: 107 CVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQN------ 160

Query: 244 RPSV--LVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
            PS+  + + +PGNPTGA +  + I KI L     G+ ++ DE Y
Sbjct: 161 DPSIKLIFITSPGNPTGAKVETSRIEKI-LQNWDRGMVVV-DEAY 203

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 65/150 (43%), Gaps = 28/150 (18%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLP---YYLDEEADWSTESDEIERVVLDALKKGIRPSVL 248
           L+LP P Y +Y+  A + + +++     Y +      TES      VL  L+      +L
Sbjct: 117 LVLP-PTYSMYSVCAEINDIEIVECPLLYKNNSFQMDTES------VLTVLQNDPLIKLL 169

Query: 249 VVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQN 308
            + +PGNPTGA +    I  + L     G+ ++ DE Y +   G     S   ++ K  N
Sbjct: 170 FITSPGNPTGARIETERIETV-LQNWTDGLVVV-DEAYIDFCGG-----STAPLVTKYPN 222

Query: 309 LHPGKFDNVQLASLHSISKGFMGECGQRGG 338
                     L +L ++SK F G  G R G
Sbjct: 223 ----------LVTLQTLSKSF-GLAGIRLG 241

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 70/147 (47%), Gaps = 22/147 (14%)

Query: 192 LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVI 251
           L+LP P Y +Y+  A++ + +V+   L   +D S + D     VL  L+      ++ V 
Sbjct: 116 LVLP-PTYSMYSVCANINDIEVVQCPL-VVSDNSFQMDV--EAVLTILENDPLIKLVFVT 171

Query: 252 NPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP 311
           +PGNPTGA +  + I ++ L   + G+ ++ DE Y +   G     S   ++ K  N   
Sbjct: 172 SPGNPTGAKIKTSLIEQV-LQNWQNGLVVV-DEAYIDFCGG-----STAPLVTKYPN--- 221

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGG 338
                  L +L ++SK F G  G R G
Sbjct: 222 -------LVTLQTLSKSF-GLAGIRLG 240

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 229 DEIERVVLDALKKGIRPSVLVVINPG-NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           +++E ++ +      +P +L  I  G NPTG+ L++     I  IA K+   II DE Y
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 202 YTASASLYNAQ---VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-NPT 257
           Y++S    +AQ    +P  LD E     + +E+     D       P +L  I  G NPT
Sbjct: 164 YSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPT 223

Query: 258 GAVLTENTIAKICLIAAKYGITIISDEVY 286
           G  L+++    I  +A KY + II DE Y
Sbjct: 224 GCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 236 LDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           +  LKK  +  + V+    NP+G      T  K+  +A KY + II+D+VY
Sbjct: 186 ISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDDVY 236

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 26/185 (14%)

Query: 202 YTASASLYNAQ---VLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG-NPT 257
           Y++S    +AQ    +P  +D +     + +E+     D       P +L  I  G NPT
Sbjct: 165 YSSSVEAADAQGLNCIPVPMDNQGIIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPT 224

Query: 258 GAVLTENTIAKICLIAAKYGITIISDEVYQENIFG-----DVKFHSMKKILRKLQNLHPG 312
           G  L+E     I  +A KY I I+ D+ Y     G     D +    + I+ +    + G
Sbjct: 225 GCTLSECRKPCIYRLAQKYDILIVEDDPYYFLQMGTYVSPDKRETDEQDIVTQELKQNHG 284

Query: 313 KF------------DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           +F             + ++  L S+SK F   C  R G+  IVG S+ + D  + L  +S
Sbjct: 285 EFVKSLSRSFLDLDRDGRVVRLDSMSKTFAPGC--RLGW--IVG-SKHLLDNYWNLHEVS 339

Query: 361 ICSVA 365
           I S  
Sbjct: 340 IQSTC 344

>TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {ON}
           Anc_5.377 YDR332W
          Length = 657

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 298 SMKKILRKLQNLHPGKFDNVQL-ASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKL 356
           S++ ++R+L+N  P  FD + +  + H+++K ++         + +VGFS     A  K 
Sbjct: 130 SVQSLIRRLENYQPNAFDLIIIDEAHHAVAKSYLQILQYFKQDVPVVGFSATFERADKKA 189

Query: 357 MSISICSVATGQAIIDLM 374
           +   I  +   + I+D++
Sbjct: 190 LETVIDEIVYHRGILDMI 207

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 229 DEIERVVLDALKKGIRPSVLVVINPG-NPTGAVLTENTIAKICLIAAKYGITIISDEVY 286
           +++ +V+ +      +P +L  I  G NPTG  + ++    I  IA KY   I+ DE Y
Sbjct: 193 EKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

>KLLA0B14190g Chr2 complement(1245746..1246495) [750 bp, 249 aa]
           {ON} no similarity
          Length = 249

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 33/158 (20%)

Query: 201 LYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPT--- 257
           +YT + ++YN  VL  Y  + AD S +  ++ R+    L++  R S ++     N +   
Sbjct: 60  IYTRNLTMYNCFVLFQYCGKSADGSLDESDVSRLY-HTLRRNYRTSNVIYTGSFNQSVFN 118

Query: 258 ----GAVLTENT-----------------IAKICLIAAK--YGITIISDEVYQENIFGDV 294
                A+L ENT                 I+KI  IA K  Y  +++  +V Q++    +
Sbjct: 119 NCFKDAILPENTNDSLLLSQFLQVQQPSVISKIMSIAEKRHYTPSVVGVKVSQKSSLIPL 178

Query: 295 KFHSMKKILRKLQNLHPG-KFDN---VQLASLHSISKG 328
           K   +K +L++   ++    +DN   +  AS H  + G
Sbjct: 179 K--ELKPLLQEFSTMYEDFTYDNLMKIAAASKHKTNHG 214

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 218 LDEEADWSTESDEIERVVLDALKKGIRPSVLVVI-NPGNPTGAVLTENTIAKICLIAAKY 276
           LD     S      E +   AL K I   VL  I    NP+G   +  T  ++  IA KY
Sbjct: 158 LDHHEGESQPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKY 217

Query: 277 GITIISDEVY 286
            + +ISD+VY
Sbjct: 218 DMLVISDDVY 227

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 55/126 (43%), Gaps = 17/126 (13%)

Query: 231 IERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENI 290
           I R   +++KK  +  +  V +  NP+G   +  T  K+  +A  Y I II+D+VY+   
Sbjct: 202 IRRPNANSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE--- 258

Query: 291 FGDVKFHSMKKILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVG---FSQ 347
           F + K +    ++       P +F +++      +  G    C   G Y  +V    FS+
Sbjct: 259 FLNYKVNPATSVI-------PKRFVDIEREMWRDLPDG----CDLEGMYGHVVSNATFSK 307

Query: 348 DIRDAL 353
            I   L
Sbjct: 308 IIAPGL 313

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 212 QVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVLTENTIAKICL 271
           Q L Y+     D S+E   I     +A KK  R  + +V    NP G   +  T  K+  
Sbjct: 156 QKLEYFDSISNDNSSELQLI--TAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIE 213

Query: 272 IAAKYGITIISDEVY 286
           +A K+ + I+SD+VY
Sbjct: 214 LARKHDMLIVSDDVY 228

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 240 KKGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSM 299
           K+  R  + ++    NP+G+  +  T  ++  +A +Y + +ISD++Y    + D     +
Sbjct: 176 KRTYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAY-DQPSDQL 234

Query: 300 KKILRKLQNLHPGKFDNVQLASLHSISKGFMGEC---GQRGGYMEIV 343
            + L  L ++     +  Q +  H+++     +    G R GY E V
Sbjct: 235 PRALPSLVHVDRATLNEEQDSWGHTVANASFSKIVAPGLRCGYQESV 281

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,909,351
Number of extensions: 2285603
Number of successful extensions: 6782
Number of sequences better than 10.0: 110
Number of HSP's gapped: 6876
Number of HSP's successfully gapped: 110
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)